SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Cocvi1|33763|fgenesh1_pm.6_#_145 from Cochliobolus victoriae FI3 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Cocvi1|33763|fgenesh1_pm.6_#_145
Domain Number 1 Region: 52-170
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.00000000000000152
Family B3/B4 domain of PheRS, PheT 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Cocvi1|33763|fgenesh1_pm.6_#_145
Sequence length 201
Sequence
MGIPVNSPPTTFSRRPFGKLRILGIPHDASDARSEALLQDAESLARGVLEKQAYKSFGAK
PKKERCCLESLMRRAEGGLPRVNRLTDIYNAISVKYQIPFGGEDLDKYSGLPLLIRATGQ
EAIRQLERLCGVTNAGVTCRRWNWRQCSRTGISDSTTRVLFILDALEPCVASNLEAAADE
LVATLRGLSPDVRASRRLIRP
Download sequence
Identical sequences jgi|Cocvi1|33763|fgenesh1_pm.6_#_145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]