SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|162139411|ref|YP_279832.2| from Streptococcus pyogenes MGAS6180

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162139411|ref|YP_279832.2|
Domain Number 1 Region: 3-72
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 1.57e-29
Family Ribosomal L11/L12e N-terminal domain 0.0000646
Further Details:      
 
Domain Number 2 Region: 67-139
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 8.63e-28
Family Ribosomal protein L11, C-terminal domain 0.0000418
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|162139411|ref|YP_279832.2|
Sequence length 141
Comment 50S ribosomal protein L11 [Streptococcus pyogenes MGAS6180]
Sequence
MAKKVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISV
YEDKSFDFITKTPPAAVLLKKAAGVEKGSGTPNTTKVATVTRAQVQEIAETKMPDLNAAN
IEAAMRMIEGTARSMGFTVTD
Download sequence
Identical sequences A0A0E1EV13 A0A2H1X6B7 A2RG33 B5XK61 P0DE00 P0DE01 P66058 P66059 Q1J835 Q1JD61 Q1JI80 Q1JN34 Q48UX9 Q5XDH7 U2VYC0
NP_268753.1.14755 WP_002990800.1.100536 WP_002990800.1.100577 WP_002990800.1.100791 WP_002990800.1.100847 WP_002990800.1.100902 WP_002990800.1.101138 WP_002990800.1.101603 WP_002990800.1.101866 WP_002990800.1.102005 WP_002990800.1.1042 WP_002990800.1.10776 WP_002990800.1.11114 WP_002990800.1.11468 WP_002990800.1.11642 WP_002990800.1.11796 WP_002990800.1.1208 WP_002990800.1.12667 WP_002990800.1.12676 WP_002990800.1.13094 WP_002990800.1.134 WP_002990800.1.13499 WP_002990800.1.13655 WP_002990800.1.13702 WP_002990800.1.13723 WP_002990800.1.13803 WP_002990800.1.14556 WP_002990800.1.15156 WP_002990800.1.1526 WP_002990800.1.15301 WP_002990800.1.15867 WP_002990800.1.16107 WP_002990800.1.16883 WP_002990800.1.17594 WP_002990800.1.17618 WP_002990800.1.19034 WP_002990800.1.19471 WP_002990800.1.19566 WP_002990800.1.19969 WP_002990800.1.19971 WP_002990800.1.20146 WP_002990800.1.2016 WP_002990800.1.20187 WP_002990800.1.20282 WP_002990800.1.2074 WP_002990800.1.20768 WP_002990800.1.20957 WP_002990800.1.21068 WP_002990800.1.21420 WP_002990800.1.22005 WP_002990800.1.22309 WP_002990800.1.22587 WP_002990800.1.22610 WP_002990800.1.2271 WP_002990800.1.22927 WP_002990800.1.22931 WP_002990800.1.23344 WP_002990800.1.23345 WP_002990800.1.23366 WP_002990800.1.23784 WP_002990800.1.23854 WP_002990800.1.23879 WP_002990800.1.24256 WP_002990800.1.24700 WP_002990800.1.24771 WP_002990800.1.24800 WP_002990800.1.25243 WP_002990800.1.25549 WP_002990800.1.25570 WP_002990800.1.26201 WP_002990800.1.26216 WP_002990800.1.2644 WP_002990800.1.26529 WP_002990800.1.26775 WP_002990800.1.26802 WP_002990800.1.26942 WP_002990800.1.27012 WP_002990800.1.27096 WP_002990800.1.27102 WP_002990800.1.2743 WP_002990800.1.27781 WP_002990800.1.27947 WP_002990800.1.28087 WP_002990800.1.28592 WP_002990800.1.29494 WP_002990800.1.29586 WP_002990800.1.29629 WP_002990800.1.30208 WP_002990800.1.30259 WP_002990800.1.30461 WP_002990800.1.31038 WP_002990800.1.31126 WP_002990800.1.32327 WP_002990800.1.32791 WP_002990800.1.33081 WP_002990800.1.34145 WP_002990800.1.34147 WP_002990800.1.34154 WP_002990800.1.34661 WP_002990800.1.34964 WP_002990800.1.35136 WP_002990800.1.35339 WP_002990800.1.35416 WP_002990800.1.35535 WP_002990800.1.35765 WP_002990800.1.3577 WP_002990800.1.35803 WP_002990800.1.36083 WP_002990800.1.36559 WP_002990800.1.37580 WP_002990800.1.3764 WP_002990800.1.38004 WP_002990800.1.38426 WP_002990800.1.39245 WP_002990800.1.39740 WP_002990800.1.39774 WP_002990800.1.39950 WP_002990800.1.40253 WP_002990800.1.4028 WP_002990800.1.40473 WP_002990800.1.4053 WP_002990800.1.40861 WP_002990800.1.41087 WP_002990800.1.41146 WP_002990800.1.41304 WP_002990800.1.41398 WP_002990800.1.41814 WP_002990800.1.42026 WP_002990800.1.42545 WP_002990800.1.43805 WP_002990800.1.44171 WP_002990800.1.44357 WP_002990800.1.45044 WP_002990800.1.45784 WP_002990800.1.45787 WP_002990800.1.45887 WP_002990800.1.46237 WP_002990800.1.46364 WP_002990800.1.46419 WP_002990800.1.47538 WP_002990800.1.47933 WP_002990800.1.48446 WP_002990800.1.49019 WP_002990800.1.49195 WP_002990800.1.49289 WP_002990800.1.49308 WP_002990800.1.51065 WP_002990800.1.51111 WP_002990800.1.51270 WP_002990800.1.51625 WP_002990800.1.51729 WP_002990800.1.52414 WP_002990800.1.52458 WP_002990800.1.5255 WP_002990800.1.5275 WP_002990800.1.52963 WP_002990800.1.53322 WP_002990800.1.53400 WP_002990800.1.53936 WP_002990800.1.54255 WP_002990800.1.54994 WP_002990800.1.55020 WP_002990800.1.55040 WP_002990800.1.55521 WP_002990800.1.55942 WP_002990800.1.56127 WP_002990800.1.56335 WP_002990800.1.56455 WP_002990800.1.56879 WP_002990800.1.57070 WP_002990800.1.57973 WP_002990800.1.58073 WP_002990800.1.58327 WP_002990800.1.58465 WP_002990800.1.59139 WP_002990800.1.59543 WP_002990800.1.5959 WP_002990800.1.59712 WP_002990800.1.59971 WP_002990800.1.60269 WP_002990800.1.60378 WP_002990800.1.60429 WP_002990800.1.60435 WP_002990800.1.60446 WP_002990800.1.61127 WP_002990800.1.61350 WP_002990800.1.62083 WP_002990800.1.62427 WP_002990800.1.62548 WP_002990800.1.62966 WP_002990800.1.63074 WP_002990800.1.6385 WP_002990800.1.64024 WP_002990800.1.64314 WP_002990800.1.64903 WP_002990800.1.65209 WP_002990800.1.65729 WP_002990800.1.65801 WP_002990800.1.65831 WP_002990800.1.6624 WP_002990800.1.66344 WP_002990800.1.66918 WP_002990800.1.67715 WP_002990800.1.67764 WP_002990800.1.68080 WP_002990800.1.68191 WP_002990800.1.68302 WP_002990800.1.68539 WP_002990800.1.69171 WP_002990800.1.69206 WP_002990800.1.69338 WP_002990800.1.69536 WP_002990800.1.69602 WP_002990800.1.69961 WP_002990800.1.70332 WP_002990800.1.70768 WP_002990800.1.71085 WP_002990800.1.71274 WP_002990800.1.71714 WP_002990800.1.71931 WP_002990800.1.72175 WP_002990800.1.72435 WP_002990800.1.72664 WP_002990800.1.72799 WP_002990800.1.73416 WP_002990800.1.7367 WP_002990800.1.74272 WP_002990800.1.74376 WP_002990800.1.74388 WP_002990800.1.74440 WP_002990800.1.74742 WP_002990800.1.74766 WP_002990800.1.74769 WP_002990800.1.74773 WP_002990800.1.75067 WP_002990800.1.75380 WP_002990800.1.75397 WP_002990800.1.75746 WP_002990800.1.75979 WP_002990800.1.77086 WP_002990800.1.77451 WP_002990800.1.77464 WP_002990800.1.77602 WP_002990800.1.77721 WP_002990800.1.7902 WP_002990800.1.7969 WP_002990800.1.80116 WP_002990800.1.80549 WP_002990800.1.8063 WP_002990800.1.80675 WP_002990800.1.81017 WP_002990800.1.81227 WP_002990800.1.81317 WP_002990800.1.81515 WP_002990800.1.81523 WP_002990800.1.82325 WP_002990800.1.8309 WP_002990800.1.83533 WP_002990800.1.83949 WP_002990800.1.83959 WP_002990800.1.8445 WP_002990800.1.84495 WP_002990800.1.84548 WP_002990800.1.84888 WP_002990800.1.85790 WP_002990800.1.86460 WP_002990800.1.86569 WP_002990800.1.86840 WP_002990800.1.87115 WP_002990800.1.87245 WP_002990800.1.87367 WP_002990800.1.87596 WP_002990800.1.87861 WP_002990800.1.8796 WP_002990800.1.88255 WP_002990800.1.88297 WP_002990800.1.88361 WP_002990800.1.88525 WP_002990800.1.88809 WP_002990800.1.88958 WP_002990800.1.89166 WP_002990800.1.89339 WP_002990800.1.89421 WP_002990800.1.89609 WP_002990800.1.89617 WP_002990800.1.91031 WP_002990800.1.91222 WP_002990800.1.91460 WP_002990800.1.9206 WP_002990800.1.92241 WP_002990800.1.92390 WP_002990800.1.92885 WP_002990800.1.93188 WP_002990800.1.93335 WP_002990800.1.93434 WP_002990800.1.93887 WP_002990800.1.93979 WP_002990800.1.94658 WP_002990800.1.94718 WP_002990800.1.94743 WP_002990800.1.94792 WP_002990800.1.94988 WP_002990800.1.95191 WP_002990800.1.95380 WP_002990800.1.95441 WP_002990800.1.95717 WP_002990800.1.96175 WP_002990800.1.96236 WP_002990800.1.96338 WP_002990800.1.96528 WP_002990800.1.96685 WP_002990800.1.96787 WP_002990800.1.97076 WP_002990800.1.97489 WP_002990800.1.97674 WP_002990800.1.97748 WP_002990800.1.98310 WP_002990800.1.9843 WP_002990800.1.98562 WP_002990800.1.98938 WP_002990800.1.9914 WP_002990800.1.99282 WP_002990800.1.99582 WP_002990800.1.99639 WP_002990800.1.99902 WP_002990800.1.99981 gi|525809267|ref|YP_008242688.1| gi|139474300|ref|YP_001129016.1| gi|162139137|ref|YP_599991.2| gi|19745586|ref|NP_606722.1| gi|71910187|ref|YP_281737.1| gi|161761321|ref|YP_059719.2| gi|383479564|ref|YP_005388458.1| gi|162139190|ref|YP_601870.2| gi|21909860|ref|NP_664128.1| gi|162139089|ref|YP_596109.2| gi|162139411|ref|YP_279832.2| 160490.SPy_0460 160491.SpyM51491 186103.spyM18_0503 193567.SPs1533 198466.SpyM3_0324 286636.M6_Spy0401 293653.M5005_Spy_0374 319701.M28_Spy0363 370551.MGAS9429_Spy0377 370552.MGAS10270_Spy0378 370553.MGAS2096_Spy0395 370554.MGAS10750_Spy0376 471876.Spy49_0387 gi|386362235|ref|YP_006071566.1| gi|28896445|ref|NP_802795.1| gi|15674579|ref|NP_268753.1| gi|383493484|ref|YP_005411160.1| gi|410680065|ref|YP_006932467.1| gi|209558946|ref|YP_002285418.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]