SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|549482542|ref|YP_008616215.1| from Bacteroides sp. CF50

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|549482542|ref|YP_008616215.1|
Domain Number 1 Region: 3-305
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.52e-77
Family G proteins 0.000000457
Further Details:      
 
Domain Number 2 Region: 283-364
Classification Level Classification E-value
Superfamily TGS-like 1.48e-36
Family G domain-linked domain 0.0000293
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|549482542|ref|YP_008616215.1|
Sequence length 367
Comment GTP-binding protein YchF [Bacteroides sp. CF50]
Sequence
MSLQCGIVGLPNVGKSTLFNCISSGKAQAANFPFCTIEPNIGSTIVPDPRLQVLEKLVHP
HRVVPATVEIVDIAGLVKGASKGEGLGNQFLANIRETDAIIHVLRCFDDPNVVHVDGSVN
PVRDKEIIDTELQIKDLDTVESRIGKVMKQAQTGGDKTAKRLYEILVKYKTALEQGLSAR
TVVFDNPEDKKLAKELFLLTDKPVLYLCNVDEASAKNGNIYVDQVREAIKDENAQLLVVA
AKIESEIAELESYEEREMFLNEIGLEESGVNRLIQSAYKLLNLETYFTAGIQEVKAWTYQ
KGTKAPQAAGIIHTDFEKGFIRAEVIKYQDYVKYGSEAACKEAGKMGVEGKEYVVQDGDI
MHFRFNV
Download sequence
Identical sequences U5Q2B8
WP_022544730.1.75430 gi|549482542|ref|YP_008616215.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]