SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|549482561|ref|YP_008616234.1| from Bacteroides sp. CF50

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|549482561|ref|YP_008616234.1|
Domain Number 1 Region: 124-238
Classification Level Classification E-value
Superfamily Fe,Mn superoxide dismutase (SOD), C-terminal domain 2.75e-43
Family Fe,Mn superoxide dismutase (SOD), C-terminal domain 0.00000821
Further Details:      
 
Domain Number 2 Region: 36-123
Classification Level Classification E-value
Superfamily Fe,Mn superoxide dismutase (SOD), N-terminal domain 6.02e-27
Family Fe,Mn superoxide dismutase (SOD), N-terminal domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|549482561|ref|YP_008616234.1|
Sequence length 239
Comment hypothetical protein BRDCF_00220 [Bacteroides sp. CF50]
Sequence
MKNIISLLILIAVPLLASAQNNNGLSNNKKCISMKAINTLEFPQLPYSTGALEPFIDQQT
VEIHYGKHQKAYFDNFLAAVKGTDAEKLTILEVFKNISKYPAAVKNNGGGFYNHVIYWES
IKPNSGKPSAKLAEAINKKFGSMDELKKQFTDAGKTRFGSGWAWLSVDDKGELFVSSTAN
QESPLMDVAEKQGTPILAMDVWEHAYYLKYQNRRPDYIESFWQIINWDVVSGKYEAIVK
Download sequence
Identical sequences gi|549482561|ref|YP_008616234.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]