SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|549482723|ref|YP_008616402.1| from Bacteroides sp. CF50

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|549482723|ref|YP_008616402.1|
Domain Number 1 Region: 90-296
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 1.24e-44
Family MurCDEF 0.00016
Further Details:      
 
Domain Number 2 Region: 299-434
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 3.2e-30
Family MurCDEF C-terminal domain 0.0011
Further Details:      
 
Domain Number 3 Region: 12-86
Classification Level Classification E-value
Superfamily MurE/MurF N-terminal domain 8.89e-21
Family MurE/MurF N-terminal domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|549482723|ref|YP_008616402.1|
Sequence length 434
Comment hypothetical protein BRDCF_01060 [Bacteroides sp. CF50]
Sequence
MSIEQLYQIFRQSSGVCTDSRAILPGSLFFALKGETFDGNLFAQKAVESGASYAVVDDSS
LPSHERLILVDDVLLTLQQLARHHRRELGLPIIGITGTNGKTTTKELISRVLMTEYRTSF
TQGNLNNHIGVPLTLLKMDENTQIGVVEMGASAPGEIAALASICEPDYGIVTNVGKAHLL
GFGSFEGVVRTKGELYDFLKNNDGTVIYNIDNQNLCSMIEEREPVNSIPYGLKYEGASLL
PVTSDNPYMRIRLESGEVIETQLVGSYNADNVMAALAIGKLFFIDTKASYEAISNYVPTN
NRSQLVTGRYNKIIIDAYNANPTSMRAALSNFAVMEKRLSAMVLGDMLELGEESQNEHKG
ILEVISGMNADILFFVGKEYREAARSFGNIVSKAHFFDTSAELKEYLISNPLKEHTVLVK
GSRGTCVEKVVEAL
Download sequence
Identical sequences U5Q2R3
WP_022544917.1.75430 gi|549482723|ref|YP_008616402.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]