SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|549482976|ref|YP_008616659.1| from Bacteroides sp. CF50

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|549482976|ref|YP_008616659.1|
Domain Number 1 Region: 1-146
Classification Level Classification E-value
Superfamily MM3350-like 7.06e-20
Family MM3350-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|549482976|ref|YP_008616659.1|
Sequence length 155
Comment hypothetical protein BRDCF_02415 [Bacteroides sp. CF50]
Sequence
MVYKFKASIAGNKIFMREYEIRGSMSLYSLHLFLQNDLGFAPDQMVVFRGLNNTDKVKGE
YGLFDLGDGAMDSISLEKVIGKGEVKLQYVYDIYKDKAIILELLSTEEESPRRSYPRLVA
EKGRNPEQFSDNYDDFEQMIEMNDSEDLYQEDSDE
Download sequence
Identical sequences U5Q703
gi|549482976|ref|YP_008616659.1| WP_022545173.1.75430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]