SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|549483015|ref|YP_008616699.1| from Bacteroides sp. CF50

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|549483015|ref|YP_008616699.1|
Domain Number 1 Region: 99-321
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 2.35e-67
Family MurCDEF 0.0001
Further Details:      
 
Domain Number 2 Region: 324-479
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 3.66e-46
Family MurCDEF C-terminal domain 0.0000774
Further Details:      
 
Domain Number 3 Region: 1-99
Classification Level Classification E-value
Superfamily MurE/MurF N-terminal domain 4.58e-23
Family MurE/MurF N-terminal domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|549483015|ref|YP_008616699.1|
Sequence length 483
Comment hypothetical protein BRDCF_02615 [Bacteroides sp. CF50]
Sequence
MKLQEILSTSRILQILGDSNIEICSVCFDSRKVIKGSLFVALKGVTSDGHDYIAQAVAAG
ARAVICEVLPEEKISATIIQVTDSHLTLGIVASNFYGRPSEKLKLIGITGTNGKTTTVTL
LYRLFTDLGYKCGLLSTIVNYIAGKTIDATHTTPDPVQINELLAQMTDTGCEFCFMEVSS
HSLHQKRVAGLNFSGAIFSNITRDHLDYHKTFDEYIRVKKSLFDSLPSSAFALTNIDDKN
GLVMIQNTTAHIYRYSCHSPAEFNCRIIEKGMDGMLLNIDNREVWTKFIGEHNAYNLLAV
YSSAVIMGFDKEEVLVHISNMTSVAGRLEYLKGKNDLTAVVDYAHTPDALENVLRTLRES
ADDKSITTVFGCGGNRDKGKRPEMAAIAAKYSDRVIVTSDNPRFEEPEEIINDIRAGFSH
ADISRAMFITDRREAIRTAIITAPAGSIILVAGKGHENYQDVKGVKHHFDDKEIIADVIN
LIS
Download sequence
Identical sequences WP_022545213.1.75430 gi|549483015|ref|YP_008616699.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]