SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|549483102|ref|YP_008616788.1| from Bacteroides sp. CF50

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|549483102|ref|YP_008616788.1|
Domain Number 1 Region: 7-198,471-747
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 4.9e-115
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0000000265
Further Details:      
 
Domain Number 2 Region: 753-998
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 3.74e-51
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.000021
Further Details:      
 
Domain Number 3 Region: 239-402
Classification Level Classification E-value
Superfamily ValRS/IleRS/LeuRS editing domain 2.22e-29
Family ValRS/IleRS/LeuRS editing domain 0.00034
Further Details:      
 
Domain Number 4 Region: 1064-1147
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0000366
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.028
Further Details:      
 
Weak hits

Sequence:  gi|549483102|ref|YP_008616788.1|
Domain Number - Region: 981-1041
Classification Level Classification E-value
Superfamily OmpH-like 0.0889
Family OmpH-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|549483102|ref|YP_008616788.1|
Sequence length 1151
Comment hypothetical protein BRDCF_03060 [Bacteroides sp. CF50]
Sequence
MRFAEYKNLDLVSINRSVLEKWNREHSFAKTLTEREGAEKFIFFEGPPSANGMPGIHHVM
ARSIKDVFCRYKTQMGYLVERKAGWDTHGLPVELGVEKMLGITKEDIGKSITVEEYNSAC
RKEVMKYTKEWEALTEQMGYWVDMQNPYITYDNRYIETLWYLLAQIYKKGLLYKGYSIQP
FSPAAGTGLSTHELNQPGCYRDVKDTTCVAQFKIVRDNSSEWIFNDEKGKALTFNGEPLD
AHFLAWTTTPWTLPSNTALCVGPNINYIRVISFNPYSGKPTIYILAQDLLSAHFNQKAEG
IQLEEYKNGDKLVPFKETGTATKGKILCGIRYEQLIPWVNPGEGAFRVIPGDFVTTSDGT
GIVHIAPTFGADDDKVARQNGVPPLMVTDSEGLKQAMVDRSGKFYKTEELEPSFISSSVN
AELYKEYAGRFVKNAYDPALGENDTTLDVDLAVMLKQQGLAFKIEKHVHSYPHCWRTDKP
VLYYPLDSWFIRTTAVQERMIELNKTINWKPEATGSGRFGKWLENLQDWNLSRSRYWGTP
LPIWRSEDGKEEMIISSVNELYDELEKSVKAGFMPSNPLRDNGYVPGDFSKENYEKIDLH
RPYVDSFVLVSPKGEKMNRESDLIDVWFDSGAMPYAQMGLEKLGSPEFGHTADFIAEGVD
QTRGWFFTLHAISTMVSDKVAYRTVISNGLVLDKEGNKMSKRLGNAVDPFLTLNEYGADP
LRWYMLTNAQPWDNLKFDVNGVDEVRRKFFGTLYNTYSFFSLYANVDNFTNSQPQIPLSE
RPEIDRWIISLLNTLVKEVKESYENWDVTSAGRKIQDFVGDNLSNWYVRLNRKRFWGGEM
DVDKLSAYQTLYSCLETISVLSAPIAPFFMDRLFCDLNAVTGRFKENTVHLVLMPEPDEK
TIDKALEERMELAQRASSMILALRRKVNIKVRQPLAKIMIPILDGTIREQFELVRQLVLN
EVNVKEVEYIFDTKGLITKRIKPNFKTLGKKYGKQMKEISNEFANFTQEQITEIESSAEY
SFMLPAGQVTLTPEDVDITSEDMPGWLVAVDGKLTIALDITVSDELRKEGTARELVNRIQ
NLRKESKFEVTDKVIVTVQPLEEIAEALQNYKEYICNQTLAKDIVLDEKVDGTEIEWDES
TLKIKVAKVQN
Download sequence
Identical sequences U5Q454
WP_022545301.1.75430 gi|549483102|ref|YP_008616788.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]