SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|549483267|ref|YP_008616954.1| from Bacteroides sp. CF50

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|549483267|ref|YP_008616954.1|
Domain Number 1 Region: 242-533
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.11e-94
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000315
Further Details:      
 
Domain Number 2 Region: 64-240
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.57e-56
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0000112
Further Details:      
 
Domain Number 3 Region: 536-640
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 3.93e-31
Family Anticodon-binding domain of Class II aaRS 0.00025
Further Details:      
 
Domain Number 4 Region: 2-60
Classification Level Classification E-value
Superfamily TGS-like 0.0000000000000015
Family TGS domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|549483267|ref|YP_008616954.1|
Sequence length 644
Comment threonyl-tRNA synthetase [Bacteroides sp. CF50]
Sequence
MINITFPDGGIRQYEKGITPYDIAHSISPRLAQDVLAATVNGKVVELGRPINEDSTLMLH
KWEDQQAKSTFWHSSSHLMAEALELLYPGIKFGIGPSIETGFYYDVDPGEKTITEADLKR
IEDKMLELAREKQHFVRREVSKDEAMKTYTDKGDQYKCELIRDLEDGTISFYTNGSFTDL
CRGPHLNDTSVIKAVKLTSIAGAYWRGNEKNKMLTRIYGVTFPQKKLLDEYLVLMEEAKK
RDHRKLGKELELFAFSQRVGQGLPLWLPKGAQLRERLENFLKNVQKKGGYLPVITPHIGQ
KELYVTSGHYAKYGADSFQPIHTPQEGEEFLLKPMNCPHHCEIYRTKPRSYKDLPIRFAE
FGTVYRYEQSGELHGLTRVRGFTQDDAHIFCRQDQIKEEFNKVIDIVLYIFKTLDFKDYT
AQISLRDPNNKEKYIGTDENWEKAERAIIESAEEKGLKTVVELGEAAFYGPKLDFMVKDA
IGRKWQLGTIQVDYNLPERFELEYVGADDKKYRPVMIHRAPFGSMERFVAVLIEHTGGKF
PLWLAPEQAVVLPVSEKYNDYAKKVVDLLTNNDIRASIDDRNETIGKKIRENELKRVPFI
LVVGEKEEDTGMVSVRKQGEGDKGTMSVVDFAGLINNEIKKQIE
Download sequence
Identical sequences U5Q7T3
WP_022545467.1.75430 gi|549483267|ref|YP_008616954.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]