SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|549483281|ref|YP_008616968.1| from Bacteroides sp. CF50

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|549483281|ref|YP_008616968.1|
Domain Number 1 Region: 179-387
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 8.01e-44
Family RelA/SpoT domain 0.00028
Further Details:      
 
Domain Number 2 Region: 9-188
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.98e-34
Family HD domain 0.0000726
Further Details:      
 
Domain Number 3 Region: 375-442
Classification Level Classification E-value
Superfamily TGS-like 0.0000000000000632
Family TGS domain 0.033
Further Details:      
 
Weak hits

Sequence:  gi|549483281|ref|YP_008616968.1|
Domain Number - Region: 637-712
Classification Level Classification E-value
Superfamily ACT-like 0.0174
Family BT0572-like 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|549483281|ref|YP_008616968.1|
Sequence length 713
Comment hypothetical protein BRDCF_03985 [Bacteroides sp. CF50]
Sequence
MISAKLDKIINTCKAEEQKWLIKSNEIASANLSGMVRGDGSPFMDHVIAVAEIVAFEIGL
SSEAIAAVFLHEASRSNNSLLEDYRKDFTEEIISIAQSLNKISGIEPKDTGLKSDNYRRL
IVSYSHDPRVSLIKLADRLEVMRSLDLFTKSKQTKKATETILLYAPLAHQLGLYNLKSEM
EDLSFKYTDQEQYRFITNKLKAGEQDRKRLMDIFVKPIELSLKKAHIQYRLKSRTKTAYS
IWKKMQAQQIPFEGVADIFAIRIIIDAPLEREQELCWKVYSMVTEHYQPDTSRLRDWITV
PKSNGYESLHTTVTAQNNQRIEVQIRSARMDDVAENGHASHWSYKGVKNDEGLNAWLGGV
KSLLESQDKRPENQFLDFVIDDIFVFTPDGDLRRLQSGSSVLDFAFDIHTNLGLKCSGAK
INGKPGSIREKLKTGDVVEIMSTKNQKPSSDWLNFVVSSKAKAKIKQKIKEEEGKQIQAG
KELFERRMANWKLEISDDLLNYLVKHYKYKTIGEFYAALADDKVDIIDVKAQVSLRETRQ
EAELRDPLTSQVPRHIHKEVNTSDFLIIDEKLNNVGFKLSKCCNPIMGDEVFGFVTIKEG
VKIHRIGCPNAARLMDNYPYRIQKVKWKESSTGQSFQTSIRVSSYGDSGLSQQIMEVINS
LSVSLRFFSINEHKGMIEAKMQVAVPNNQVLDKLIFNLKKIKGVKSVSRTTNV
Download sequence
Identical sequences U5Q4M0
gi|549483281|ref|YP_008616968.1| WP_022545481.1.75430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]