SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|549483513|ref|YP_008617204.1| from Bacteroides sp. CF50

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|549483513|ref|YP_008617204.1|
Domain Number 1 Region: 3-192,344-589
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 5.63e-121
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0000000285
Further Details:      
 
Domain Number 2 Region: 191-343
Classification Level Classification E-value
Superfamily ValRS/IleRS/LeuRS editing domain 3.92e-54
Family ValRS/IleRS/LeuRS editing domain 0.00001
Further Details:      
 
Domain Number 3 Region: 591-829
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 1.79e-47
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00013
Further Details:      
 
Domain Number 4 Region: 816-880
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.00000000012
Family Valyl-tRNA synthetase (ValRS) C-terminal domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|549483513|ref|YP_008617204.1|
Sequence length 882
Comment hypothetical protein BRDCF_05210 [Bacteroides sp. CF50]
Sequence
MELPVKYDPSLTEEKWYAYWLKNNFFHSEPDNREPYTVVIPPPNVTGVLHMGHMLNNTIQ
DVLVRRARMKGKNACWVPGTDHASIATEAKVVAKLKAEGIEKSDITREEFLKHAWEWREK
HGGIILEQLKKLGASCDWKRTKFTMDPDLSEGVINTFVYFYKKGWIYRGVRMVNWDPVGQ
TAVSDEEVIRKETPSKLYYLKYFISENGVPSEEYLVIATTRPETIMADSAICIHPEDERY
KHLKGKKVFIPLINKEIPVIEDDYVTMDFGTGCLKVTPAHDINDYEIGLRHKLPVIDILD
QFGKLNQEARILVGEDRFDARKKIVKMLAESGNFLKEETYSSQIGYSERTNAVIEPRLSL
QWFLKMEEAAKNALSYVEDERIRLIPDKYKNTYKHWMDNVRDWCISRQLWWGQRIPAWYL
PSGDFVVEPDAQSALKAARAIDPTIKPEDLKQDSDVLDTWFSSWLWPISVFDSNKPGHPA
ARPNSDLAYYYPTNDLVTAPEILFFWVARMVMAGHEFCGDLPFRNVYLTGTVRDKQGRKM
SKSLGNSPDPIKLMEVYGADGVRVGMLICSSAGTDILFDESQVEQGRNFANKIWNAYRLI
KGWNVDENATQTTQAKVAVKWFDEMLSSSIETIDDHFEKFRISDALMLIYKLFWDDFCAW
YLELIKPQQGAGIDASTYNATITIFDKLLRILHPFMPFISEELWQNIGERKEGETIMLSS
QPEAEKYNPEFLADFEVVKDCIVNIRGIRQSKGISPKEPLSLLYKGELGAEMISVIEKMA
NINSVGSVSDKGADAKGVSFLTGSLEFFIPLEEHVDVEEELRKIEEEIKYYRGFLENVMK
KLSNEKFVSSAPKAVVDMELKKRQDGESKLMKLEELKKELTK
Download sequence
Identical sequences U5Q5B7
WP_022545715.1.75430 gi|549483513|ref|YP_008617204.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]