SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|549483528|ref|YP_008617219.1| from Bacteroides sp. CF50

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|549483528|ref|YP_008617219.1|
Domain Number 1 Region: 133-232,402-477
Classification Level Classification E-value
Superfamily TrmE connector domain 3.53e-46
Family TrmE connector domain 0.0013
Further Details:      
 
Domain Number 2 Region: 85-164,200-392
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.45e-41
Family G proteins 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|549483528|ref|YP_008617219.1|
Sequence length 477
Comment hypothetical protein BRDCF_05285 [Bacteroides sp. CF50]
Sequence
MSDMEDKLYYQDTICALSTPAGVGAIAVIRMSGPISIEILSKVFKPAKGSQVSETPSHRL
RFGTFYSNGEVLDEVLVSIFRGSGSFTGEESVEIACHGSLYIQNEILMVLVSQGARLAKP
GEFSQRAFFNGKMDLAQTEAIADLIASETRSAHRVALQQMRGGFSDELRKMRSSLLDLVS
LMELELDFSDEDVEFADRSQLCDLLNKSISQINALIESFKLGNVIKNGVPVVIVGATNTG
KSTLLNAILGEERAIVSDIHGTTRDFIEDVVNISGQAFRFIDTAGIRRTKELIEIAGIER
TYEKIQSASIVVLMLDAEREETYNTGIKELSSRVKEGQFIVVLLNKCDLFTKQKVSEKIN
SVARLAHDENLKIDRTIPFSAKTKYGLDIFKSILLESQENRDFTSSATLVTNVRHYEALK
LAGQALERVLQGMDDSLPTDLLTQDIREALFHIGEIIGEVSTDEILGNIFSKFCIGK
Download sequence
Identical sequences U5Q5D4
gi|549483528|ref|YP_008617219.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]