SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|549483545|ref|YP_008617237.1| from Bacteroides sp. CF50

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|549483545|ref|YP_008617237.1|
Domain Number 1 Region: 20-199
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.23e-54
Family HD domain 0.000014
Further Details:      
 
Domain Number 2 Region: 194-408
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 3.76e-47
Family RelA/SpoT domain 0.00012
Further Details:      
 
Domain Number 3 Region: 391-463
Classification Level Classification E-value
Superfamily TGS-like 9.81e-21
Family TGS domain 0.025
Further Details:      
 
Domain Number 4 Region: 646-719
Classification Level Classification E-value
Superfamily ACT-like 0.000000238
Family Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|549483545|ref|YP_008617237.1|
Sequence length 731
Comment hypothetical protein BRDCF_05375 [Bacteroides sp. CF50]
Sequence
MDIFTPEDNALIEREFEELRLASLKRCADQAEYEIVLKAFDFARSAHNGVRRRSGEPYII
HPICVAKIVVQEIGLGYKSIVSALIHDVVEDTEYNIEDIERLFGTKIASLVDGLTKIKSA
FDSTTTGQAENFKRILLTLNDDVRVILIKLADRLHNMRTIESMPQLKKDKILSETMYIFI
PLAHRLGLYSIKSEMENIWLMQSMPNEYEEIQAQIAKTVAERGCAIDQFIEPISESLRQD
NIEFTISKRTKTPYSIWRKMVEKNIPFDQVYDLFAVRIVFEPKENQPERVQCWHIYSLIT
ETYLSKTDRIRDWVSTPKVNGYEALHCTVLGKLGNWIEVQIRTKRMDDVAERGIAAHWAY
KGATPTENELENWLNRVREVLENPDVNALTFLDNFHKELFASEIFAFTPKGESISLPKGS
TALDFAYAIHSEVGNKAIAAKVNYKLVPLSYVLRNGDQLEIITAESQRPHREWLDFIKTP
KAKFHIMDVLNAEVKALMRDGQAKLTAKLKELNITSDPAIYKKLLDIYKQKDKEELVSRI
GASLIDLSDLKEKLEKYESKGPLIKLKKRSKEDFLLEENPMDKTLTYVIASCCGAIPGDQ
VIGFQDENGKVIVHKKSCPKAISLAASVAERIVKVKWALHSNLSFLARVTMKGLDRKGIL
NELTQIIAKVMNINIRKVIIDTHDNIFEGCIDLDVHNKEDLDKLIKELSLVKGIESVIRT
EIKDTTINENK
Download sequence
Identical sequences U5Q8I7
gi|549483545|ref|YP_008617237.1| WP_022545748.1.75430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]