SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|549483893|ref|YP_008617587.1| from Bacteroides sp. CF50

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|549483893|ref|YP_008617587.1|
Domain Number 1 Region: 113-353
Classification Level Classification E-value
Superfamily Nqo1 FMN-binding domain-like 1.18e-93
Family Nqo1 FMN-binding domain-like 0.000000255
Further Details:      
 
Domain Number 2 Region: 438-540
Classification Level Classification E-value
Superfamily Nqo1C-terminal domain-like 3.92e-36
Family Nqo1C-terminal domain-like 0.00074
Further Details:      
 
Domain Number 3 Region: 354-437
Classification Level Classification E-value
Superfamily Nqo1 middle domain-like 2.22e-26
Family Nqo1 middle domain-like 0.00046
Further Details:      
 
Domain Number 4 Region: 6-98
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.47e-23
Family Thioredoxin-like 2Fe-2S ferredoxin 0.004
Further Details:      
 
Domain Number 5 Region: 545-598
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.00000000000000239
Family Short-chain ferredoxins 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|549483893|ref|YP_008617587.1|
Sequence length 599
Comment NADH dehydrogenase [Bacteroides sp. CF50]
Sequence
MDMAQYKMHLLVCGGTGCRASQSEKIAGNLKEEIKNLGLENEAQVVITGCFGFCEKGPIV
KIIPDNTFYTQVKPEDCKEIISEHVLKGRKVTRLLYEDPATKEHIADSKHMGFYQKQIRI
ALRNCGFINPENIDEYIARDGYAALGKVLTEMTNQQVIDLIKKSGLRGRGGGGFPTGLKW
EIAAGNKADQKYVVCNADEGDPGAFMDRSILEGDPHSIIEAMAICGYCIGATKGIVYIRA
EYPLAIQRLKIAARQCREYGLLGTDILGSGFDFDIELRYGAGAFVCGEETALIHSMEGLR
GEPTVKPPFPAQSGYLGKPTNVNNVETFANIPAIILKGAEWFASIGTERSKGTKVFALAG
KINNVGLIEVPMGTTLREVIFEIGGGIKDGKKFKAVQTGGPSGGCLTEKHLDTPIDFDNL
IAAGSMMGSGGMIVMDEDDCMVSVAKFYLEFTVDESCGKCAPCRVGNKRLHEMLEKICSG
KGTIEDVEYLKNLGAVIKDTALCGLGQTSPNPVLSTIEHFYDEYKAHVTERICPAGQCKA
LKLYTILTDKCTGCTACSRSCPVGAISGEKRQPHVIDADKCIRCGACYDKCKFTAIHVQ
Download sequence
Identical sequences U5Q9R3
gi|549483893|ref|YP_008617587.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]