SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|549484107|ref|YP_008617803.1| from Bacteroides sp. CF50

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|549484107|ref|YP_008617803.1|
Domain Number 1 Region: 2-146,204-281,471-743
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 2.18e-114
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000166
Further Details:      
 
Domain Number 2 Region: 281-470
Classification Level Classification E-value
Superfamily ValRS/IleRS/LeuRS editing domain 1.36e-44
Family ValRS/IleRS/LeuRS editing domain 0.00000455
Further Details:      
 
Domain Number 3 Region: 737-919
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 3.74e-28
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|549484107|ref|YP_008617803.1|
Sequence length 920
Comment hypothetical protein BRDCF_08265 [Bacteroides sp. CF50]
Sequence
MEYNFLEIEKRWQKYWSDNEIYKVEVDNSRPKYYVLDMFPYPSGAGLHVGHPLGYIASDI
YSRYKRLRGYNVLHPMGYDAFGLPAEQYAIQTGQHPADTTDKNIKRYREQMDRIGFSYDW
SREVRTCDPDYYKWTQWAFLEMFAHWYNIKTHKAEKISDLISLFEKEGNLNVTAECGEVK
SFTAENWNSFSDQEKAAILMNYRIAYLGETSVNWCAALGTVLANDEVKEGLSVRGGHPVE
QKKMRQWQLRVSAYAERLLNDLDNLEWTDSLKDMQRNWIGRSQGAEMVFKVSNGTEEYDM
EIFTTRADTVFGVTFMVLAPESEWVEKLTTLEQKSVVGEYLNYAKKKTERERMAETRKVT
GVFSGSYATNPFTEEKIPVWISEYVLAGYGTGAIMAVPAHDSRDYSFAKHFNLPVIPLIE
GCDISEESFDAKEGIMCNSGFLSGMSVKQAIPAAIEEVEKRGIGRRKVNYRLRDAIFSRQ
RYWGEPFPIYYKDGIATPMDIENLPLRLPEVDKFLPTESGEPPLARAENWTFEGHPIEKS
TMPGFAGSSAYYLRYMDPRNDKALVSKEADEYWRNVDLYIGGTEHATGHLIYSRFWNKFL
YDLGYVCEPEPFKKLINQGMIQGRSNFVYRVKGTNTFVSYGLKDKYDTTEIHVDVNKVSN
DRLDIAAFKEWMPEYADAEFILENGEYICGWAVEKMSKSMFNVVNPDMICENYGADTLRM
YEMFLGPLEQSKPWDTNGIDGVHRFLKRFWRLFFNRDSFAVSEESASAKELKILHKLIKK
IGDDIEGFSFNTSVSAFMIAVNELYEVGCNKRDILEPMLILLSPFAPHITEELWFMLGHK
ESISGASFPEYVESYTIEDTFEYPVSFNGKMRFKVALSRALSPKEIEEYIIAHPDTVKYL
GESKIKKVIIVPCKIINIVC
Download sequence
Identical sequences U5QA95
gi|549484107|ref|YP_008617803.1| WP_022546311.1.75430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]