SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|549484194|ref|YP_008617893.1| from Bacteroides sp. CF50

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|549484194|ref|YP_008617893.1|
Domain Number 1 Region: 604-859
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.1e-46
Family Prolyl oligopeptidase, C-terminal domain 0.058
Further Details:      
 
Domain Number 2 Region: 134-290,370-488
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 0.0000000615
Family Tricorn protease N-terminal domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|549484194|ref|YP_008617893.1|
Sequence length 869
Comment hypothetical protein BRDCF_08720 [Bacteroides sp. CF50]
Sequence
MKKSPTFAKMLLSAALLIPATFINNSNLKAQSKQLDSTVFDTWRTCESLAISDDASWSIA
TYKNKKDGTILVVKIDKLRLKKEIKGGKDIEMFDGQRSAIFFVKDSLYCINGINGKIDTL
GKTKNAVVDKKSPFITYIKGNTLYLKNTTDGRIDSVQHTRTRVFATSELLVAVTGQNGTT
TITGLNLKGKNGIERVTLYSGDLYIDGISCDKSGKRLVFYSGKDSLFSNPQISALDIKTK
SLTNFNIERSLLPQDRKFNVKKGVEFSSDGSYLKFEIELATDSLAKPKGKVAKPAFEYEL
WRWNDTLIPLKQKKGPTQFAKSLKCVYYPQTGKFIQLSKGKGVYLQVEDDSPYGFEFDET
PYMMTSDWEDPTPRDILCTDVKTGERKTLLRKFKGNFTVSPRTPHIFIFDSDAAAWFIID
IKSGERVCISDLLPYPVINEEFDQPQPAGSYGQGGLTNDNQYFIVYDKYDVWALPASGIG
EPIAITNGYGRKNNIRFKVLKLEDKGDKKIGVNLKEDILLESTNLGNMHSGFYKVSIGKD
PIKLLEEACKFSFNRNLGKSNYVIKRERFEEAPDFWLADKNFRLLMRLTDLNEQTRDFAI
GTSEVISWKDSADVEQRGVLYTPEGYDSSKRYPVIVYFYETMTQDAFKFYVPEPTESTIN
PIMFVSRGYVVFMPDIHYEIGWPGKSCVNAVVSGTEYIISKGIADPERIGVQGHSWGGYQ
VAYLITQSDIFKCACSEAAVSNMTSAYTGIRSTAGAPRMFMYECTQSRIGGTLWEKQENY
IKNSATFYLDQVTTPLLSRHCDADEAVPYSQGLELFLGLKRLGKQVWMFNYKGVGHNIRP
WEVKMDWSRRMDEYFDYYLMDKRKPSWMK
Download sequence
Identical sequences U5Q7A2
WP_022546399.1.75430 gi|549484194|ref|YP_008617893.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]