SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|549484201|ref|YP_008617900.1| from Bacteroides sp. CF50

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|549484201|ref|YP_008617900.1|
Domain Number 1 Region: 142-383
Classification Level Classification E-value
Superfamily Nqo1 FMN-binding domain-like 1.19e-85
Family Nqo1 FMN-binding domain-like 0.000000518
Further Details:      
 
Domain Number 2 Region: 671-912
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 6.47e-64
Family N-terminal domain of adrenodoxin reductase-like 0.0011
Further Details:      
 
Domain Number 3 Region: 468-569
Classification Level Classification E-value
Superfamily Nqo1C-terminal domain-like 4.32e-34
Family Nqo1C-terminal domain-like 0.00042
Further Details:      
 
Domain Number 4 Region: 384-467
Classification Level Classification E-value
Superfamily Nqo1 middle domain-like 9.29e-21
Family Nqo1 middle domain-like 0.00069
Further Details:      
 
Domain Number 5 Region: 542-682
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 0.00000000000000192
Family Dihydropyrimidine dehydrogenase, N-terminal domain 0.0073
Further Details:      
 
Domain Number 6 Region: 24-102
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000403
Family Thioredoxin-like 2Fe-2S ferredoxin 0.039
Further Details:      
 
Domain Number 7 Region: 994-1044
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 0.0000115
Family Dihydropyrimidine dehydrogenase, N-terminal domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|549484201|ref|YP_008617900.1|
Sequence length 1054
Comment hypothetical protein BRDCF_08755 [Bacteroides sp. CF50]
Sequence
MKISDFASLDGIRKKAAAKILPDKPYIAIGMGTCGIGRGAEVLYDSFERIIKERGLDIIL
KKTGCFGFCAEEPLVNVYIPGKPLVILHRVSEVDVIPVISGIQKGIMPFRNVLCRIEEWD
FITGKFEFGKGLPEHPLWNEIPFFKWQKKIVLRNCGLIVPDDIEEYIAVGGYFPLYSVLT
GKSPKDVIEEVKISKLRGRGGAGFPTGQKWELMAKVNAEQKYVICNADEGDPGAFMNRNE
IESDPFMLLEGMTIGAYAMGASKGVVYIRAEYPLAVKRLKGAIDQAKSLGLLGHNIMGTG
FNFEIDIVEGAGAFVCGEETALIRSIEGRAGRPTPRPPYPAAKGVFGFPTNINNVETWCN
IPVVMSKGGAWFTETGTEKSAGTKVFSLVGKVKNTGLVELPLGSTLETIVFRIGEGTGSQ
KRVKAVQSGGPSGGCIPIDYLKTPVDYESLNALGAIMGSGGMVVMDQDNCMVDVARYFTE
FSNSESCGKCTPCREGLAQTLEILKKFTNGTAVAQDISTLEELGKVIKATALCGLGQTAP
NPVLTTLRYFKDEYDHHMIEKKCEPGICQDLFTALCENSCPMHMNIPQYLQLLKEDKLEE
AFESTLRDNPLPSTIGRICHFHCQMKCRREGIDAPVSQGEIHRYISDTIYAEGKTRKIYD
RIISEKMPPTYKKIAVIGGGPAGLTAAYYLVRLGHDVTVYDSETEAGGILRWGIPKYRLP
LDVLQREIEFIRELGVNFVFNTAVGKDISMEQLEHDNHAVIIAVGANKDTELQIPGCKLS
GVISGMEFLKDVSLGKKPELGHHVVIVGAGNVAIDAARTAQRFGAEVTVVYRRLKADMPA
NKDEIKEAENEGVNFLFLCNPDEILADANDKVRGISLMKMACGEIDLSNRRKPVPTGESF
TISCDTVIMAIGEEVEAGFAKDHGIKTLSNGNVYVDHFTQETSRPKFYAIGDATTGPATA
AEAMGLAKKAAEVIDYKLMDKRRFHRLFREFEYSDEVPLKPEGGNRHYSVKRPLEERIGN
FNEISLGYTPAQAYAEAARCLRCDVRTTVKTEEE
Download sequence
Identical sequences WP_022546406.1.75430 gi|549484201|ref|YP_008617900.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]