SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|549484387|ref|YP_008618089.1| from Bacteroides sp. CF50

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|549484387|ref|YP_008618089.1|
Domain Number 1 Region: 230-434
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.18e-30
Family ABC transporter ATPase domain-like 0.00043
Further Details:      
 
Domain Number 2 Region: 6-134
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.00000000157
Family DNA repair protein MutS, domain III 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|549484387|ref|YP_008618089.1|
Sequence length 442
Comment hypothetical protein BRDCF_09705 [Bacteroides sp. CF50]
Sequence
MIFRIDKQTTDDLGIFGKNNDRSVYGIFNKTVTNGGSQVLEEMFRYPLSEDEKINERGKI
IRFFQEKEIAFPFKSELFDPAESYLANTDNRTRLSAYQDNLERKFRSAIGSDTEYKQIAK
GVASIVEIICVLEKFLKSIPDSGPGCPYHTQASAMLDIINSDSLRASLQEKNPNKITYAR
TAEFDQTFRFNCRDTVKQLLQLIYQLDVYISVARCARDRNFAYAEAMPEGAGVFEIKGLY
HPLLKNAVPNSIKVDQKSNMIFLTGANMAGKSTFMKSFGIAVYLAHMGFPVPAESMRFSV
LNGMFTTINLPDNINKGYSHFYAEVVRVRKVAESIGNSKNLLVIFDELFRGTNVKDAYDA
TVAVSEAFAANKNCIFIISTHIIEAGETLKERCDNINFINLPTIMDGNTPRYTYRIEKGI
TSDRHGMIIVKNEGILDILDKK
Download sequence
Identical sequences U5Q7Q8
WP_022546595.1.75430 gi|549484387|ref|YP_008618089.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]