SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|549484638|ref|YP_008618341.1| from Bacteroides sp. CF50

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|549484638|ref|YP_008618341.1|
Domain Number 1 Region: 277-502
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.76e-39
Family ABC transporter ATPase domain-like 0.0002
Further Details:      
 
Domain Number 2 Region: 54-272
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 6.41e-17
Family DNA repair protein MutS, domain III 0.0098
Further Details:      
 
Domain Number 3 Region: 738-812
Classification Level Classification E-value
Superfamily SMR domain-like 0.00000196
Family Smr domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|549484638|ref|YP_008618341.1|
Sequence length 814
Comment hypothetical protein BRDCF_10985 [Bacteroides sp. CF50]
Sequence
MTESRCSTSLAKERCGSDLFSTSYEEIEEELSRTDEMRLIVMFESGFPDSGFVDTYPFLK
HLEASSSFLDLNSVVRLRNSLDTIRQIVAFFKNTKDGQYLRLKKMAEPIVLYPEISRRID
TIVDKFGDMKDSASPELQTIRRAIKDKEGQISKRINSILRSAQSEGLVDEDASVSVRDGR
VLIPVLAANKRKIPGFVYDESASGKTAFVEPLEIVELNNLVRELHFAEQREIIKILAEFS
DFLRPYLPELLQSAMFMAEIDFIRAKALISMQMQAGKPIISKDQILMMNKGRHPLLESAL
KKEGKEIVPLSLNLEKEKHILLISGPNAGGKSVCLKTVGLLQYMFQCGFLIPASEISELG
VFNNIFIDIGDEQSIENDLSTYSSHLKNMRDIIQQADSRSLVLIDEFGAGTEPTAGGAIA
EAILTEIERRGAFGVITTHYSNLKFYASSSNGVLNGGMQFDVQNIKPLFKLEIGTPGSSF
AFELARKMGLPEQVVKLAEEKAGSDFVDLERHLRKIARNRRQWEEKLARIKSTDKALENI
TDKYQKELTDIQTLKKSIIEGAKKEAASIVAEANRKIELTIKEIKETQAEKEHTKLLRKE
LTEFSNDVQADRQTAEDERIAKKMEQLVKRKERSEERRVNSEKGRVNSEKWKVNSEETRE
LRAGDKVRIDQGEVMGEVIKIEGKDVSVAIGSIISRVAAKRLTKISGKEMKGSAGVRTKA
SIVQSESISERKLNFRPTIDVRGQRLEEAIESVTRFIDDAIMVDVGEVKILHGKGNGILR
EELRKYLKAMGVVQSAKDEDIQLGGAGITVVKLI
Download sequence
Identical sequences gi|549484638|ref|YP_008618341.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]