SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from Please contact us if you experience any problems.

Integrin alpha N-terminal domain alignments

These alignments are sequences aligned to the 0053611 model.

Sophisticated options are available for refining alignments:

Jump to [ Top of page · Refine alignments · Add alignments from genomes ]


The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                   10        20        30        40        50        60        70   
                                    |         |         |         |         |         |         |   

                               80        90       100       110       120       130                 
                                |         |         |         |         |         |                 
ENSGGOP00000012325:20-619 AVNMSLGLSLASTTSPSQL------------LACGPTVHHACGRNMYL-----TGLCfllgptqltqrlpvsrq

d1tyea_                   ..........................................................................
ENSGGOP00000012325:20-619 ecprqeqdivflidgsgsissrnfatmmnfvravisqfqrpstqfslmqfsdkfqthftfeefrrssnplslla

d1tyea_                   ..........................................................................
ENSGGOP00000012325:20-619 svhqlqgftytataiqnvvhqlfhasygarrdaakilivitdgkkegdsldykdvipmadaagiiryaiggqvg

                                                        140       150       160          170       1
                                                          |         |         |            |        
d1tyea_                   .......................FLAQPESGRRAEYSPCRGNTLSRIYVENDF...SWDKRYCEAGFSSVVTQA

                          80       190       200       210       220       230       240       250  
                           |         |         |         |         |         |         |         |  

                               260       270          280       290       300        310       320  
                                 |         |            |         |         |          |         |  

                               330        340       350       360       370       380       390     
                                 |          |         |         |         |         |         |     

                             400       410         420       430       440       450  
                               |         |           |         |         |         |  

Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:

Model: 0053611 (list models)
Initial SAMT99 seed:

Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues

Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.

Select to display   Genome
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Podospora anserina
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Microsporum canis CBS 113480
NoYes   Aspergillus zonatus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus flavus NRRL3357
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Wickerhamomyces anomalus
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces bayanus MIT
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Bathycoccus prasinos
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Cyanidioschyzon merolae strain 10D 22
NoYes   Cyanidioschyzon merolae
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora infestans T30-4
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Ichthyophthirius multifiliis strain G5
NoYes   Cryptosporidium hominis
NoYes   Cryptosporidium muris
NoYes   Cryptosporidium parvum Iowa II
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Babesia bovis T2Bo
NoYes   Theileria parva
NoYes   Theileria annulata
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Plasmodium yoelii ssp. yoelii 1
NoYes   Plasmodium chabaudi
NoYes   Plasmodium berghei ANKA
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Thermobaculum terrenum ATCC BAA-798
NoYes   Leptolyngbya sp. PCC 7376
NoYes   Pseudanabaena sp. PCC 7367
NoYes   Acaryochloris marina MBIC11017
NoYes   Synechocystis sp. PCC 6803
NoYes   Synechococcus sp. PCC 6312
NoYes   Synechococcus elongatus PCC 7942
NoYes   Microcoleus sp. PCC 7113
NoYes   Trichodesmium erythraeum IMS101
NoYes   Geitlerinema sp. PCC 7407
NoYes   Cyanothece sp. PCC 8802
NoYes   Gloeocapsa sp. PCC 7428
NoYes   Microcystis aeruginosa NIES-843
NoYes   Gloeobacter violaceus PCC 7421
NoYes   Rivularia sp. PCC 7116
NoYes   Calothrix sp. PCC 7507
NoYes   Anabaena variabilis ATCC 29413
NoYes   'Nostoc azollae' 0708
NoYes   Nostoc sp. PCC 7107
NoYes   Nostoc punctiforme PCC 73102
NoYes   Nostoc sp. PCC 7120
NoYes   Nostoc sp. PCC 7524
NoYes   Anabaena sp. 90
NoYes   Conexibacter woesei DSM 14684
NoYes   Slackia heliotrinireducens DSM 20476
NoYes   Atopobium parvulum DSM 20469
NoYes   Coriobacterium glomerans PW2
NoYes   Ilumatobacter coccineus
NoYes   Thermobispora bispora DSM 43833
NoYes   Modestobacter marinus
NoYes   Catenulispora acidiphila DSM 44928
NoYes   Stackebrandtia nassauensis DSM 44728
NoYes   Frankia symbiont of Datisca glomerata
NoYes   Frankia sp. EAN1pec
NoYes   Frankia alni ACN14a
NoYes   Thermobifida fusca YX
NoYes   Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111
NoYes   Thermomonospora curvata DSM 43183
NoYes   Streptosporangium roseum DSM 43021
NoYes   Kitasatospora setae KM-6054
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces sp. PAMC26508
NoYes   Streptomyces flavogriseus ATCC 33331
NoYes   Streptomyces sp. SirexAA-E
NoYes   Streptomyces griseus subsp. griseus NBRC 13350
NoYes   Streptomyces bingchenggensis BCW-1
NoYes   Streptomyces violaceusniger Tu 4113
NoYes   Streptomyces avermitilis MA-4680
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces scabiei 87.22
NoYes   Streptomyces hygroscopicus subsp. jinggangensis 5008
NoYes   Actinosynnema mirum DSM 43827
NoYes   Saccharomonospora viridis DSM 43017
NoYes   Saccharopolyspora erythraea NRRL 2338
NoYes   Amycolatopsis mediterranei U32
NoYes   Kribbella flavida DSM 17836
NoYes   Nocardioides sp. JS614
NoYes   Microlunatus phosphovorus NM-1
NoYes   Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1
NoYes   Salinispora arenicola CNS-205
NoYes   Salinispora tropica CNB-440
NoYes   Verrucosispora maris AB-18-032
NoYes   Micromonospora sp. L5
NoYes   Micromonospora aurantiaca ATCC 27029
NoYes   Actinoplanes sp. N902-109
NoYes   Actinoplanes sp. SE50/110
NoYes   Actinoplanes missouriensis 431
NoYes   Gordonia sp. KTR9
NoYes   Gordonia polyisoprenivorans VH2
NoYes   Rhodococcus jostii RHA1
NoYes   Rhodococcus equi 103S
NoYes   Rhodococcus opacus B4
NoYes   Rhodococcus erythropolis PR4
NoYes   Mycobacterium abscessus ATCC 19977
NoYes   Mycobacterium rhodesiae NBB3
NoYes   Sanguibacter keddieii DSM 10542
NoYes   Beutenbergia cavernae DSM 12333
NoYes   Jonesia denitrificans DSM 20603
NoYes   Isoptericola variabilis 225
NoYes   Cellulomonas flavigena DSM 20109
NoYes   Cellulomonas fimi ATCC 484
NoYes   Arthrobacter phenanthrenivorans Sphe3
NoYes   Arthrobacter chlorophenolicus A6
NoYes   Arthrobacter aurescens TC1
NoYes   Arthrobacter sp. Rue61a
NoYes   Arthrobacter sp. FB24
NoYes   Bifidobacterium dentium Bd1
NoYes   Arcanobacterium haemolyticum DSM 20595
NoYes   Caldilinea aerophila DSM 14535 = NBRC 104270
NoYes   Dehalogenimonas lykanthroporepellens BL-DC-9
NoYes   Anaerolinea thermophila UNI-1
NoYes   Herpetosiphon aurantiacus DSM 785
NoYes   Roseiflexus sp. RS-1
NoYes   Roseiflexus castenholzii DSM 13941
NoYes   Chloroflexus sp. MS-G
NoYes   Chloroflexus sp. Y-400-fl
NoYes   Chloroflexus aggregans DSM 9485
NoYes   Chloroflexus aurantiacus J-10-fl
NoYes   Deinococcus gobiensis I-0
NoYes   Deinococcus radiodurans R1
NoYes   Marinithermus hydrothermalis DSM 14884
NoYes   Meiothermus silvanus DSM 9946
NoYes   Meiothermus ruber DSM 1279
NoYes   Acidaminococcus intestini RyC-MR95
NoYes   Acidaminococcus fermentans DSM 20731
NoYes   Symbiobacterium thermophilum IAM 14863
NoYes   Clostridium clariflavum DSM 19732
NoYes   Clostridium cellulolyticum H10
NoYes   Clostridium thermocellum ATCC 27405
NoYes   Faecalibacterium prausnitzii
NoYes   Ruminococcus albus 7
NoYes   Oscillibacter valericigenes Sjm18-20
NoYes   Thermincola potens JR
NoYes   Pelotomaculum thermopropionicum SI
NoYes   Desulfosporosinus orientis DSM 765
NoYes   Dehalobacter sp. DCA
NoYes   Dehalobacter sp. CF
NoYes   Desulfitobacterium dehalogenans ATCC 51507
NoYes   Desulfotomaculum reducens MI-1
NoYes   Desulfotomaculum acetoxidans DSM 771
NoYes   Desulfotomaculum kuznetsovii DSM 6115
NoYes   Desulfotomaculum ruminis DSM 2154
NoYes   Eubacterium eligens ATCC 27750
NoYes   Clostridium difficile 630
NoYes   Clostridium sticklandii DSM 519
NoYes   Filifactor alocis ATCC 35896
NoYes   Clostridium saccharolyticum WM1
NoYes   Clostridium phytofermentans ISDg
NoYes   Clostridium lentocellum DSM 5427
NoYes   Eubacterium rectale ATCC 33656
NoYes   Roseburia hominis A2-183
NoYes   Butyrivibrio proteoclasticus B316
NoYes   Syntrophothermus lipocalidus DSM 12680
NoYes   Syntrophomonas wolfei subsp. wolfei str. Goettingen
NoYes   Alkaliphilus metalliredigens QYMF
NoYes   Clostridium sp. BNL1100
NoYes   Clostridium novyi NT
NoYes   Clostridium ljungdahlii DSM 13528
NoYes   Clostridium kluyveri DSM 555
NoYes   Clostridium beijerinckii NCIMB 8052
NoYes   Clostridium tetani E88
NoYes   Clostridium cellulovorans 743B
NoYes   Clostridium botulinum A str. ATCC 3502
NoYes   Clostridium acetobutylicum ATCC 824
NoYes   Mahella australiensis 50-1 BON
NoYes   Thermosediminibacter oceani DSM 16646
NoYes   Caldicellulosiruptor kronotskyensis 2002
NoYes   Caldicellulosiruptor owensensis OL
NoYes   Caldicellulosiruptor lactoaceticus 6A
NoYes   Caldicellulosiruptor kristjanssonii 177R1B
NoYes   Caldicellulosiruptor bescii DSM 6725
NoYes   Thermoanaerobacterium xylanolyticum LX-11
NoYes   Tepidanaerobacter acetatoxydans Re1
NoYes   Acetohalobium arabaticum DSM 5501
NoYes   Brevibacillus brevis NBRC 100599
NoYes   Paenibacillus sp. JDR-2
NoYes   Paenibacillus terrae HPL-003
NoYes   Paenibacillus mucilaginosus 3016
NoYes   Paenibacillus polymyxa M1
NoYes   Solibacillus silvestris StLB046
NoYes   Lysinibacillus sphaericus C3-41
NoYes   Halobacillus halophilus DSM 2266
NoYes   Bacillus sp. JS
NoYes   Bacillus sp. 1NLA3E
NoYes   Bacillus atrophaeus 1942
NoYes   Bacillus subtilis subsp. subtilis str. 168
NoYes   Bacillus licheniformis DSM 13 = ATCC 14580
NoYes   Bacillus halodurans C-125
NoYes   Bacillus thuringiensis str. Al Hakam
NoYes   Bacillus cereus 03BB102
NoYes   Bacillus anthracis str. A0248
NoYes   Bacillus pseudofirmus OF4
NoYes   Bacillus clausii KSM-K16
NoYes   Candidatus Cloacamonas acidaminovorans
NoYes   Melioribacter roseus P3M
NoYes   Ignavibacterium album JCM 16511
NoYes   Chlorobium chlorochromatii CaD3
NoYes   Chlorobium phaeobacteroides DSM 266
NoYes   Chlorobium limicola DSM 245
NoYes   Chloroherpeton thalassium ATCC 35110
NoYes   Haliscomenobacter hydrossis DSM 1100
NoYes   Saprospira grandis str. Lewin
NoYes   Niastella koreensis GR20-10
NoYes   Chitinophaga pinensis DSM 2588
NoYes   Salinibacter ruber M8
NoYes   Rhodothermus marinus DSM 4252
NoYes   Flexibacter litoralis DSM 6794
NoYes   Candidatus Amoebophilus asiaticus 5a2
NoYes   Belliella baltica DSM 15883
NoYes   Cyclobacterium marinum DSM 745
NoYes   Marivirga tractuosa DSM 4126
NoYes   Fibrella aestuarina
NoYes   Leadbetterella byssophila DSM 17132
NoYes   Dyadobacter fermentans DSM 18053
NoYes   Cytophaga hutchinsonii ATCC 33406
NoYes   Spirosoma linguale DSM 74
NoYes   Runella slithyformis DSM 19594
NoYes   Parabacteroides distasonis ATCC 8503
NoYes   Tannerella forsythia ATCC 43037
NoYes   Prevotella melaninogenica ATCC 25845
NoYes   Prevotella denticola F0289
NoYes   Prevotella ruminicola 23
NoYes   Porphyromonas gingivalis ATCC 33277
NoYes   Bacteroides salanitronis DSM 18170
NoYes   Bacteroides vulgatus ATCC 8482
NoYes   Bacteroides thetaiotaomicron VPI-5482
NoYes   Pedobacter saltans DSM 12145
NoYes   Solitalea canadensis DSM 3403
NoYes   Pedobacter heparinus DSM 2366
NoYes   Sphingobacterium sp. 21
NoYes   Fluviicola taffensis DSM 16823
NoYes   Owenweeksia hongkongensis DSM 17368
NoYes   Zunongwangia profunda SM-A87
NoYes   Krokinobacter sp. 4H-3-7-5
NoYes   Gramella forsetii KT0803
NoYes   Maribacter sp. HTCC2170
NoYes   Robiginitalea biformata HTCC2501
NoYes   Croceibacter atlanticus HTCC2559
NoYes   Aequorivita sublithincola DSM 14238
NoYes   Zobellia galactanivorans
NoYes   Muricauda ruestringensis DSM 13258
NoYes   Cellulophaga algicola DSM 14237
NoYes   Cellulophaga lytica DSM 7489
NoYes   Polaribacter sp. MED152
NoYes   Riemerella anatipestifer ATCC 11845 = DSM 15868
NoYes   Capnocytophaga ochracea DSM 7271
NoYes   Weeksella virosa DSM 16922
NoYes   Flavobacterium branchiophilum FL-15
NoYes   Flavobacterium columnare ATCC 49512
NoYes   Flavobacterium johnsoniae UW101
NoYes   Fibrobacter succinogenes subsp. succinogenes S85
NoYes   Phycisphaera mikurensis NBRC 102666
NoYes   Isosphaera pallida ATCC 43644
NoYes   Planctomyces brasiliensis DSM 5305
NoYes   Planctomyces limnophilus DSM 3776
NoYes   Rhodopirellula baltica SH 1
NoYes   Pirellula staleyi DSM 6068
NoYes   Coraliomargarita akajimensis DSM 45221
NoYes   Opitutus terrae PB90-1
NoYes   Turneriella parva DSM 21527
NoYes   Leptospira interrogans serovar Lai str. IPAV
NoYes   Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'
NoYes   Spirochaeta smaragdinae DSM 11293
NoYes   Treponema primitia ZAS-2
NoYes   Treponema succinifaciens DSM 2489
NoYes   Treponema denticola ATCC 35405
NoYes   Spirochaeta africana DSM 8902
NoYes   Spirochaeta thermophila DSM 6192
NoYes   Thermodesulfatator indicus DSM 15286
NoYes   Thermodesulfobacterium sp. OPB45
NoYes   Desulfurispirillum indicum S5
NoYes   Calditerrivibrio nitroreducens DSM 19672
NoYes   Denitrovibrio acetiphilus DSM 12809
NoYes   Deferribacter desulfuricans SSM1
NoYes   Flexistipes sinusarabici DSM 4947
NoYes   Kosmotoga olearia TBF 19.5.1
NoYes   Fervidobacterium pennivorans DSM 9078
NoYes   Thermosipho melanesiensis BI429
NoYes   Thermosipho africanus TCF52B
NoYes   Thermotoga sp. RQ2
NoYes   Thermotoga petrophila RKU-1
NoYes   Desulfurobacterium thermolithotrophum DSM 11699
NoYes   Elusimicrobium minutum Pei191
NoYes   Candidatus Chloracidobacterium thermophilum B
NoYes   Candidatus Solibacter usitatus Ellin6076
NoYes   Granulicella tundricola MP5ACTX9
NoYes   Granulicella mallensis MP5ACTX8
NoYes   Candidatus Koribacter versatilis Ellin345
NoYes   Terriglobus saanensis SP1PR4
NoYes   Terriglobus roseus DSM 18391
NoYes   Acidobacterium capsulatum ATCC 51196
NoYes   Candidatus Nitrospira defluvii
NoYes   Streptobacillus moniliformis DSM 12112
NoYes   Sebaldella termitidis ATCC 33386
NoYes   Candidatus Methylomirabilis oxyfera
NoYes   candidate division SR1 bacterium RAAC1_SR1_1
NoYes   Candidatus Saccharimonas aalborgensis
NoYes   Bacteriovorax marinus SJ
NoYes   Bdellovibrio bacteriovorus HD100
NoYes   Nitratifractor salsuginis DSM 16511
NoYes   Wolinella succinogenes DSM 1740
NoYes   Desulfarculus baarsii DSM 2075
NoYes   Syntrophus aciditrophicus SB
NoYes   Desulfomonile tiedjei DSM 6799
NoYes   Syntrophobacter fumaroxidans MPOB
NoYes   Desulfurivibrio alkaliphilus AHT2
NoYes   Desulfotalea psychrophila LSv54
NoYes   Desulfobulbus propionicus DSM 2032
NoYes   Desulfatibacillum alkenivorans AK-01
NoYes   Desulfobacterium autotrophicum HRM2
NoYes   Desulfococcus oleovorans Hxd3
NoYes   Desulfohalobium retbaense DSM 5692
NoYes   Desulfomicrobium baculatum DSM 4028
NoYes   Desulfovibrio piezophilus
NoYes   Desulfovibrio aespoeensis Aspo-2
NoYes   Lawsonia intracellularis PHE/MN1-00
NoYes   Desulfovibrio magneticus RS-1
NoYes   Desulfovibrio alaskensis G20
NoYes   Desulfovibrio vulgaris subsp. vulgaris DP4
NoYes   Desulfovibrio salexigens DSM 2638
NoYes   Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774
NoYes   Desulfovibrio africanus str. Walvis Bay
NoYes   Geobacter daltonii FRC-32
NoYes   Geobacter sp. M21
NoYes   Geobacter uraniireducens Rf4
NoYes   Geobacter lovleyi SZ
NoYes   Geobacter bemidjiensis Bem
NoYes   Geobacter sulfurreducens KN400
NoYes   Geobacter metallireducens GS-15
NoYes   Pelobacter carbinolicus DSM 2380
NoYes   Babela massiliensis
NoYes   Haliangium ochraceum DSM 14365
NoYes   Sorangium cellulosum 'So ce 56'
NoYes   Anaeromyxobacter sp. Fw109-5
NoYes   Anaeromyxobacter dehalogenans 2CP-1
NoYes   Stigmatella aurantiaca DW4/3-1
NoYes   Corallococcus coralloides DSM 2259
NoYes   Myxococcus xanthus DK 1622
NoYes   Myxococcus fulvus HW-1
NoYes   Dechlorosoma suillum PS
NoYes   Methylibium petroleiphilum PM1
NoYes   Rubrivivax gelatinosus IL144
NoYes   Burkholderia rhizoxinica HKI 454
NoYes   Burkholderia phytofirmans PsJN
NoYes   Burkholderia phymatum STM815
NoYes   Burkholderia xenovorans LB400
NoYes   Cupriavidus taiwanensis LMG 19424
NoYes   Ralstonia eutropha H16
NoYes   Burkholderia sp. RPE64
NoYes   Burkholderia thailandensis E264
NoYes   Burkholderia pseudomallei 1106a
NoYes   Burkholderia mallei SAVP1
NoYes   Burkholderia ambifaria AMMD
NoYes   Verminephrobacter eiseniae EF01-2
NoYes   Ramlibacter tataouinensis TTB310
NoYes   Delftia sp. Cs1-4
NoYes   Herminiimonas arsenicoxydans
NoYes   Janthinobacterium sp. Marseille
NoYes   Thiobacillus denitrificans ATCC 25259
NoYes   Nitrosospira multiformis ATCC 25196
NoYes   Nitrosomonas sp. Is79A3
NoYes   Nitrosomonas europaea ATCC 19718
NoYes   Gallionella capsiferriformans ES-2
NoYes   Magnetococcus marinus MC-1
NoYes   Asticcacaulis excentricus CB 48
NoYes   Brevundimonas subvibrioides ATCC 15264
NoYes   Caulobacter sp. K31
NoYes   Caulobacter segnis ATCC 21756
NoYes   Novosphingobium sp. PP1Y
NoYes   Sphingobium chlorophenolicum L-1
NoYes   Sphingomonas wittichii RW1
NoYes   Zymomonas mobilis subsp. mobilis NCIMB 11163
NoYes   Maricaulis maris MCS10
NoYes   Hyphomonas neptunium ATCC 15444
NoYes   Dinoroseobacter shibae DFL 12
NoYes   Phaeobacter gallaeciensis 2.10
NoYes   Pseudovibrio sp. FO-BEG1
NoYes   Jannaschia sp. CCS1
NoYes   Ruegeria sp. TM1040
NoYes   Ruegeria pomeroyi DSS-3
NoYes   Roseobacter litoralis Och 149
NoYes   Roseobacter denitrificans OCh 114
NoYes   Rhodobacter capsulatus SB 1003
NoYes   Rhodospirillum centenum SW
NoYes   Azospirillum lipoferum 4B
NoYes   Azospirillum sp. B510
NoYes   Azospirillum brasilense Sp245
NoYes   Polymorphum gilvum SL003B-26A1
NoYes   Micavibrio aeruginosavorus ARL-13
NoYes   alpha proteobacterium HIMB59
NoYes   Candidatus Midichloria mitochondrii IricVA
NoYes   Wolbachia endosymbiont of Culex quinquefasciatus Pel
NoYes   Rickettsia bellii OSU 85-389
NoYes   Xanthobacter autotrophicus Py2
NoYes   Methylobacterium sp. 4-46
NoYes   Methylobacterium nodulans ORS 2060
NoYes   Sinorhizobium fredii NGR234
NoYes   Sinorhizobium medicae WSM419
NoYes   Agrobacterium vitis S4
NoYes   Mesorhizobium opportunistum WSM2075
NoYes   Mesorhizobium ciceri biovar biserrulae WSM1271
NoYes   Mesorhizobium loti MAFF303099
NoYes   Methylocella silvestris BL2
NoYes   Pelagibacterium halotolerans B2
NoYes   Methylocystis sp. SC2
NoYes   Saccharophagus degradans 2-40
NoYes   Teredinibacter turnerae T7901
NoYes   Cellvibrio japonicus Ueda107
NoYes   Aeromonas hydrophila subsp. hydrophila ATCC 7966
NoYes   Vibrio fischeri MJ11
NoYes   Vibrio sp. Ex25
NoYes   Vibrio harveyi ATCC BAA-1116
NoYes   Vibrio anguillarum 775
NoYes   Vibrio cholerae O395
NoYes   Psychromonas ingrahamii 37
NoYes   Ferrimonas balearica DSM 9799
NoYes   Shewanella piezotolerans WP3
NoYes   Shewanella loihica PV-4
NoYes   Shewanella halifaxensis HAW-EB4
NoYes   Shewanella sediminis HAW-EB3
NoYes   Shewanella denitrificans OS217
NoYes   Shewanella pealeana ATCC 700345
NoYes   Shewanella baltica OS185
NoYes   Shewanella woodyi ATCC 51908
NoYes   Shewanella violacea DSS12
NoYes   Shewanella putrefaciens CN-32
NoYes   Colwellia psychrerythraea 34H
NoYes   Pseudoalteromonas sp. SM9913
NoYes   Pseudoalteromonas atlantica T6c
NoYes   Glaciecola sp. 4H-3-7+YE-5
NoYes   Glaciecola nitratireducens FR1064
NoYes   Marinobacter adhaerens HP15
NoYes   Alteromonas sp. SN2
NoYes   Kangiella koreensis DSM 16069
NoYes   Hahella chejuensis KCTC 2396
NoYes   Marinomonas posidonica IVIA-Po-181
NoYes   Marinomonas mediterranea MMB-1
NoYes   Methylomicrobium alcaliphilum
NoYes   Methylomonas methanica MC09
NoYes   Methylococcus capsulatus str. Bath
NoYes   Stenotrophomonas maltophilia K279a
NoYes   Xanthomonas axonopodis pv. citri str. 306
NoYes   Xanthomonas campestris pv. campestris str. B100
NoYes   Thioalkalivibrio sulfidophilus HL-EbGr7
NoYes   Nitrosococcus watsonii C-113
NoYes   Nitrosococcus halophilus Nc4
NoYes   Nitrosococcus oceani ATCC 19707
NoYes   Legionella longbeachae NSW150
NoYes   gamma proteobacterium HdN1
NoYes   Photorhabdus asymbiotica
NoYes   Photorhabdus luminescens subsp. laumondii TTO1
NoYes   Xenorhabdus bovienii SS-2004
NoYes   Xenorhabdus nematophila ATCC 19061
NoYes   Rahnella aquatilis CIP 78.65 = ATCC 33071
NoYes   Yersinia pseudotuberculosis IP 31758
NoYes   Yersinia pestis Pestoides F
NoYes   Pantoea sp. At-9b
NoYes   Erwinia sp. Ejp617
NoYes   Erwinia pyrifoliae Ep1/96
NoYes   Escherichia blattae DSM 4481
NoYes   Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)
NoYes   Enterobacteriaceae bacterium strain FGI 57
NoYes   Shigella dysenteriae Sd197
NoYes   Escherichia fergusonii ATCC 35469
NoYes   Enterobacter sp. R4-368
NoYes   Enterobacter asburiae LF7a
NoYes   Enterobacter cloacae subsp. dissolvens SDM
NoYes   Pseudomonas sp. TKP
NoYes   Pseudomonas sp. UW4
NoYes   Pseudomonas brassicacearum subsp. brassicacearum NFM421
NoYes   Pseudomonas entomophila L48
NoYes   Pseudomonas syringae pv. tomato str. DC3000
NoYes   Pseudomonas fluorescens SBW25
NoYes   Pseudomonas aeruginosa UCBPP-PA14
NoYes   Candidatus Korarchaeum cryptofilum OPF8
NoYes   Ignisphaera aggregans DSM 17230
NoYes   Aeropyrum pernix K1
NoYes   Thermosphaera aggregans DSM 11486
NoYes   Staphylothermus hellenicus DSM 12710
NoYes   Staphylothermus marinus F1
NoYes   Desulfurococcus fermentans DSM 16532
NoYes   Desulfurococcus kamchatkensis 1221n
NoYes   Methanosaeta harundinacea 6Ac
NoYes   Methanohalobium evestigatum Z-7303
NoYes   Methanosarcina acetivorans C2A
NoYes   Methanosarcina barkeri str. Fusaro
NoYes   Methanospirillum hungatei JF-1
NoYes   Methanoplanus petrolearius DSM 11571
NoYes   Methanopyrus kandleri AV19
NoYes   Archaeoglobus fulgidus DSM 4304
NoYes   Thermococcus sp. 4557
NoYes   Thermococcus kodakarensis KOD1
NoYes   Thermococcus barophilus MP
NoYes   Salinarchaeum sp. Harcht-Bsk1
NoYes   Halopiger xanaduensis SH-6
NoYes   Haloterrigena turkmenica DSM 5511
NoYes   Halorubrum lacusprofundi ATCC 49239
NoYes   Halogeometricum borinquense DSM 11551
NoYes   Halomicrobium mukohataei DSM 12286
NoYes   Haloarcula hispanica ATCC 33960
NoYes   Haloarcula marismortui ATCC 43049
NoYes   Aciduliprofundum sp. MAR08-339
NoYes   Aciduliprofundum boonei T469
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Cryptococcus neoformans var. grubii H99
NoYes   Cryptococcus neoformans B-3501A
NoYes   Cryptococcus neoformans JEC21
NoYes   Aspergillus fumigatus A1163
NoYes   Batrachochytrium dendrobatidis JEL423
NoYes   Batrachochytrium dendrobatidis JAM81
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Trypanosoma brucei Lister 427 v4.1
NoYes   Neospora caninum Nc-Liverpool 6.2
NoYes   Plasmodium falciparum HB3
NoYes   Plasmodium falciparum Dd2
NoYes   Chamaesiphon minutus PCC 6605
NoYes   Synechocystis sp. PCC 6803 substr. PCC-P
NoYes   Synechocystis sp. PCC 6803 substr. PCC-N
NoYes   Synechocystis sp. PCC 6803 substr. GT-I
NoYes   Synechocystis sp. PCC 6803
NoYes   Dactylococcopsis salina PCC 8305
NoYes   Synechococcus sp. JA-2-3B'a(2-13)
NoYes   Synechococcus sp. JA-3-3Ab
NoYes   Synechococcus sp. CC9902
NoYes   Synechococcus sp. WH 8102
NoYes   Synechococcus sp. WH 7803
NoYes   Synechococcus sp. PCC 7002
NoYes   Synechococcus elongatus PCC 6301
NoYes   Prochlorococcus marinus str. MIT 9303
NoYes   Oscillatoria nigro-viridis PCC 7112
NoYes   Oscillatoria acuminata PCC 6304
NoYes   Arthrospira platensis NIES-39
NoYes   Cyanothece sp. PCC 7822
NoYes   Cyanothece sp. PCC 7424
NoYes   Cyanothece sp. ATCC 51142
NoYes   Cyanothece sp. PCC 8801
NoYes   Cyanobacterium aponinum PCC 10605
NoYes   Cyanobacterium stanieri PCC 7202
NoYes   Gloeobacter kilaueensis Gloeobacter sp. JS
NoYes   Pleurocapsa minor Pleurocapsa sp. PCC 7327
NoYes   Stanieria cyanosphaera PCC 7437
NoYes   Calothrix parietina Calothrix sp. PCC 6303
NoYes   Cylindrospermum stagnale PCC 7417
NoYes   Anabaena cylindrica PCC 7122
NoYes   Frankia sp. EuI1c
NoYes   Frankia sp. CcI3
NoYes   Nocardiopsis alba ATCC BAA-2165
NoYes   Streptomyces albus J1074
NoYes   Streptomyces rapamycinicus NRRL 5491
NoYes   Streptomyces davawensis JCM 4913
NoYes   Streptomyces fulvissimus DSM 40593
NoYes   Streptomyces venezuelae ATCC 10712
NoYes   Streptomyces collinus Tu 365
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces hygroscopicus subsp. jinggangensis TL01
NoYes   Saccharothrix espanaensis DSM 44229
NoYes   Amycolatopsis mediterranei RB
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis orientalis HCCB10007
NoYes   Actinoplanes friuliensis DSM 7358
NoYes   Rhodococcus erythropolis CCM2595
NoYes   Nocardia brasiliensis ATCC 700358
NoYes   Mycobacterium abscessus subsp. bolletii 50594
NoYes   Mycobacterium kansasii ATCC 12478
NoYes   Clavibacter michiganensis subsp. sepedonicus
NoYes   Actinomyces graevenitzii C83
NoYes   Chthonomonas calidirosea T49
NoYes   Clostridium thermocellum DSM 1313
NoYes   [Clostridium] stercorarium Clostridiu subsp. stercorarium DSM 8532
NoYes   Ruminococcus champanellensis 18P13
NoYes   Clostridium acidurici 9a
NoYes   Desulfosporosinus meridiei DSM 13257
NoYes   Desulfotomaculum gibsoniae DSM 7213
NoYes   Clostridium difficile BI1
NoYes   Clostridium difficile R20291
NoYes   Clostridium difficile CD196
NoYes   Clostridium autoethanogenum DSM 10061
NoYes   Clostridium saccharoperbutylacetonicum N1-4(HMT)
NoYes   Clostridium kluyveri NBRC 12016
NoYes   Clostridium tetani genome 12124569
NoYes   Clostridium pasteurianum BC1
NoYes   Clostridium botulinum H04402 065
NoYes   Clostridium botulinum BKT015925
NoYes   Clostridium botulinum F str. 230613
NoYes   Clostridium botulinum F str. Langeland
NoYes   Clostridium botulinum B1 str. Okra
NoYes   Clostridium botulinum Ba4 str. 657
NoYes   Clostridium botulinum A2 str. Kyoto
NoYes   Clostridium botulinum A3 str. Loch Maree
NoYes   Clostridium botulinum A str. Hall
NoYes   Clostridium botulinum A str. ATCC 19397
NoYes   Clostridium acetobutylicum DSM 1731
NoYes   Clostridium acetobutylicum EA 2018
NoYes   Thermoanaerobacterium thermosaccharolyticum M0795
NoYes   Halobacteroides halobius DSM 5150
NoYes   Thermobacillus composti KWC4
NoYes   Paenibacillus sp. Y412MC10
NoYes   Paenibacillus mucilaginosus KNP414
NoYes   Paenibacillus mucilaginosus K02
NoYes   Paenibacillus larvae subsp. larvae DSM 25430
NoYes   Paenibacillus polymyxa CR1
NoYes   Paenibacillus polymyxa SC2
NoYes   Paenibacillus polymyxa E681
NoYes   Bacillus licheniformis 9945A
NoYes   Bacillus subtilis PY79
NoYes   Bacillus subtilis XF-1
NoYes   Bacillus subtilis QB928
NoYes   Bacillus subtilis BSn5
NoYes   Bacillus subtilis subsp. subtilis str. BAB-1
NoYes   Bacillus subtilis subsp. subtilis str. BSP1
NoYes   Bacillus subtilis subsp. subtilis str. RO-NN-1
NoYes   Bacillus subtilis subsp. subtilis 6051-HGW
NoYes   Bacillus subtilis subsp. spizizenii TU-B-10
NoYes   Bacillus subtilis subsp. spizizenii str. W23
NoYes   Bacillus subtilis subsp. natto BEST195
NoYes   Bacillus licheniformis DSM 13 = ATCC 14580
NoYes   Bacillus infantis NRRL B-14911
NoYes   Bacillus thuringiensis MC28
NoYes   Bacillus thuringiensis serovar chinensis CT-43
NoYes   Bacillus thuringiensis YBT-1518
NoYes   Bacillus thuringiensis Bt407
NoYes   Bacillus thuringiensis serovar konkukian str. 97-27
NoYes   Bacillus thuringiensis serovar thuringiensis str. IS5056
NoYes   Bacillus cereus biovar anthracis str. CI
NoYes   Bacillus cereus AH820
NoYes   Bacillus cereus F837/76
NoYes   Bacillus cereus E33L
NoYes   Bacillus anthracis str. H9401
NoYes   Bacillus anthracis str. CDC 684
NoYes   Bacillus anthracis str. 'Ames Ancestor'
NoYes   Bacillus anthracis str. Sterne
NoYes   Bacillus anthracis str. Ames
NoYes   Salinibacter ruber DSM 13855
NoYes   Rhodothermus marinus SG0.5JP17-172
NoYes   Echinicola vietnamensis DSM 17526
NoYes   Emticicia oligotrophica DSM 17448
NoYes   Prevotella sp. oral taxon 299 str. F0039
NoYes   Prevotella dentalis DSM 3688
NoYes   Porphyromonas gingivalis TDC60
NoYes   Bacteroides xylanisolvens XB1A
NoYes   Nonlabens dokdonensis DSW-6
NoYes   Psychroflexus torquis ATCC 700755
NoYes   Riemerella anatipestifer RA-CH-2
NoYes   Riemerella anatipestifer RA-GD
NoYes   Riemerella anatipestifer ATCC 11845 = DSM 15868
NoYes   Fibrobacter succinogenes subsp. succinogenes S85
NoYes   Singulisphaera acidiphila DSM 18658
NoYes   Leptospira interrogans serovar Lai str. 56601
NoYes   Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130
NoYes   Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'
NoYes   Treponema pedis str. T A4
NoYes   Bdellovibrio bacteriovorus str. Tiberius
NoYes   Desulfocapsa sulfexigens DSM 10523
NoYes   Desulfobacula toluolica Tol2
NoYes   Lawsonia intracellularis N343
NoYes   Desulfovibrio hydrothermalis AM13 = DSM 14728
NoYes   Desulfovibrio vulgaris RCH1
NoYes   Desulfovibrio vulgaris str. 'Miyazaki F'
NoYes   Desulfovibrio vulgaris str. Hildenborough
NoYes   Desulfovibrio gigas DSM 1382 = ATCC 19364
NoYes   Desulfovibrio desulfuricans ND132
NoYes   Geobacter sp. M18
NoYes   Geobacter sulfurreducens PCA
NoYes   Sorangium cellulosum So0157-2
NoYes   Anaeromyxobacter sp. K
NoYes   Myxococcus stipitatus DSM 14675
NoYes   Burkholderia phenoliruptrix BR3459a
NoYes   Burkholderia sp. CCGE1003
NoYes   Burkholderia sp. CCGE1001
NoYes   Burkholderia pseudomallei MSHR305
NoYes   Burkholderia pseudomallei NCTC 13179
NoYes   Burkholderia pseudomallei BPC006
NoYes   Burkholderia pseudomallei 1026b
NoYes   Burkholderia pseudomallei MSHR346
NoYes   Burkholderia pseudomallei 668
NoYes   Burkholderia pseudomallei 1710b
NoYes   Burkholderia pseudomallei K96243
NoYes   Burkholderia mallei NCTC 10229
NoYes   Burkholderia mallei ATCC 23344
NoYes   Candidatus Symbiobacter mobilis Comamonadaceae bacterium CR
NoYes   Variovorax paradoxus EPS
NoYes   Nitrosomonas sp. AL212
NoYes   Sulfuricella denitrificans skB26
NoYes   Zymomonas mobilis subsp. mobilis CP4
NoYes   Zymomonas mobilis subsp. mobilis ATCC 10988
NoYes   Zymomonas mobilis subsp. mobilis ZM4
NoYes   Zymomonas mobilis subsp. pomaceae ATCC 29192
NoYes   Phaeobacter gallaeciensis DSM 17395
NoYes   Phaeobacter gallaeciensis DSM 26640
NoYes   Leisingera methylohalidivorans DSM 14336
NoYes   Octadecabacter antarcticus 307
NoYes   Octadecabacter arcticus 238
NoYes   Micavibrio aeruginosavorus EPB
NoYes   Wolbachia endosymbiont of Drosophila melanogaster
NoYes   Wolbachia endosymbiont of Drosophila simulans wNo
NoYes   Sinorhizobium fredii HH103
NoYes   Sinorhizobium meliloti 2011
NoYes   Sinorhizobium meliloti GR4
NoYes   Sinorhizobium meliloti BL225C
NoYes   Sinorhizobium meliloti 1021
NoYes   Rhizobium etli bv. mimosae str. Mim1
NoYes   Rhodopseudomonas palustris DX-1
NoYes   Bradyrhizobium sp. BTAi1
NoYes   Bradyrhizobium oligotrophicum S58
NoYes   Simiduia agarivorans SA1 = DSM 21679
NoYes   Vibrio fischeri ES114
NoYes   Vibrio sp. EJY3
NoYes   Vibrio alginolyticus NBRC 15630 = ATCC 17749
NoYes   Vibrio anguillarum Listonella anguillarum M3
NoYes   Vibrio nigripulchritudo VibrioScope
NoYes   Vibrio vulnificus CMCP6
NoYes   Vibrio cholerae LMA3984-4
NoYes   Vibrio cholerae M66-2
NoYes   Vibrio cholerae O395
NoYes   Vibrio cholerae IEC224
NoYes   Vibrio cholerae O1 str. 2010EL-1786
NoYes   Vibrio cholerae MJ-1236
NoYes   Vibrio cholerae O1 biovar El Tor str. N16961
NoYes   Shewanella sp. W3-18-1
NoYes   Shewanella baltica BA175
NoYes   Shewanella baltica OS678
NoYes   Shewanella baltica OS223
NoYes   Shewanella baltica OS195
NoYes   Shewanella sp. MR-7
NoYes   Glaciecola psychrophila 170
NoYes   Alteromonas macleodii str. 'Ionian Sea UM4b'
NoYes   Alteromonas macleodii str. 'Ionian Sea UM7'
NoYes   Alteromonas macleodii str. 'Aegean Sea MED64'
NoYes   Alteromonas macleodii AltDE1
NoYes   Alteromonas macleodii str. 'English Channel 673'
NoYes   Alteromonas macleodii str. 'Black Sea 11'
NoYes   Alteromonas macleodii ATCC 27126
NoYes   Alcanivorax dieselolei B5
NoYes   Thalassolituus oleivorans MIL-1
NoYes   Xanthomonas citri subsp. citri Aw12879
NoYes   Xanthomonas campestris pv. vesicatoria str. 85-10
NoYes   Xanthomonas axonopodis pv. citrumelo F1
NoYes   Xanthomonas axonopodis Xac29-1
NoYes   Xanthomonas campestris pv. raphani 756C
NoYes   Xanthomonas campestris pv. campestris str. 8004
NoYes   Xanthomonas campestris pv. campestris str. ATCC 33913
NoYes   Spiribacter salinus M19-40
NoYes   Thioalkalivibrio nitratireducens DSM 14787
NoYes   Proteus mirabilis BB2000
NoYes   Morganella morganii subsp. morganii KT
NoYes   Rahnella aquatilis HX2
NoYes   Yersinia pseudotuberculosis PB1/+
NoYes   Yersinia pseudotuberculosis YPIII
NoYes   Yersinia pseudotuberculosis IP 32953
NoYes   Yersinia pestis biovar Microtus str. 91001
NoYes   Yersinia pestis A1122
NoYes   Yersinia pestis Z176003
NoYes   Yersinia pestis D182038
NoYes   Yersinia pestis D106004
NoYes   Yersinia pestis biovar Medievalis str. Harbin 35
NoYes   Yersinia pestis Nepal516
NoYes   Yersinia pestis Antiqua
NoYes   Yersinia pestis Angola
NoYes   Yersinia pestis CO92
NoYes   Yersinia pestis KIM10+
NoYes   Yersinia enterocolitica subsp. palearctica 105.5R(r)
NoYes   Yersinia enterocolitica subsp. palearctica Y11
NoYes   Serratia plymuthica 4Rx13
NoYes   Erwinia pyrifoliae DSM 12163
NoYes   Shigella dysenteriae 1617
NoYes   Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980
NoYes   Escherichia coli O7:K1 str. CE10
NoYes   Escherichia coli Xuzhou21
NoYes   Escherichia coli UMN026
NoYes   Escherichia coli O55:H7 str. RM12579
NoYes   Escherichia coli O55:H7 str. CB9615
NoYes   Escherichia coli O157:H7 str. Sakai
NoYes   Escherichia coli O157:H7 str. EDL933
NoYes   Enterobacter cloacae SCF1
NoYes   Enterobacter cloacae EcWSU1
NoYes   Enterobacter cloacae subsp. cloacae ENHKU01
NoYes   Enterobacter cloacae subsp. cloacae ATCC 13047
NoYes   Pseudomonas syringae pv. syringae B728a
NoYes   Pseudomonas poae RE*1-1-14
NoYes   Pseudomonas fluorescens F113
NoYes   Pseudomonas fluorescens A506
NoYes   Pseudomonas fluorescens R124
NoYes   Pseudomonas fluorescens Pf0-1
NoYes   Pseudomonas resinovorans NBRC 106553
NoYes   Pseudomonas mendocina NK-01
NoYes   Pseudomonas aeruginosa RP73
NoYes   Pseudomonas aeruginosa B136-33
NoYes   Pseudomonas aeruginosa PA1R
NoYes   Pseudomonas aeruginosa PA1
NoYes   Acinetobacter johnsonii SH046
NoYes   Acinetobacter lwoffii SH145
NoYes   Methanomethylovorans hollandica DSM 15978
NoYes   Archaeoglobus sulfaticallidus PM70-1
NoYes   Thermococcus litoralis DSM 5473
NoYes   Halovivax ruber XH-70
NoYes   Haloarcula hispanica N601
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Caenorhabditis elegans 69_215 - Roundworm
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Heliconius numata
NoYes   Loa loa v3.3 - Eye worm
NoYes   Wuchereria bancrofti v1.0 - Agent of lymphatic filariasis
NoYes   Brugia malayi v1.0 - Agent of lymphatic filariasis
NoYes   Moniliophthora perniciosa FA553
NoYes   Encephalitozoon intestinalis
NoYes   Encephalitozoon cuniculi
NoYes   Lotus japonicus
NoYes   Malus x domestica - Apple
NoYes   Ricinus communis - Castor bean
NoYes   Nicotiana benthamiana 0.4.4
NoYes   Solanum pimpinellifolium A-1.0 - Currant tomato
NoYes   Solanum lycopersicum v2.3 - Tomato
NoYes   Phoenix dactylifera - Date palm
NoYes   Vibrio campbellii ATCC BAA-1116
NoYes   1_050719N (meta-genome)
NoYes   1_Upper_euphotic (meta-genome)
NoYes   2_050719S (meta-genome)
NoYes   2_Base_of_chrolophyll_max (meta-genome)
NoYes   3_050719R (meta-genome)
NoYes   3_Below_base_of_euphotic (meta-genome)
NoYes   4_050719Q (meta-genome)
NoYes   4_Deep_abyss (meta-genome)
NoYes   5_050719P (meta-genome)
NoYes   5_Below_upper_mesopelagic (meta-genome)
NoYes   6_Upper_euphotic (meta-genome)
NoYes   7_Oxygen_minimum_layer (meta-genome)
NoYes   Activated sludge plasmid pool Morges-2009 (Newbler) (meta-genome)
NoYes   Activated sludge plasmid pool Visp-2009 (Newbler) (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 1 (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 2 (meta-genome)
NoYes   Atta cephalotes fungus garden (ACEF) (meta-genome)
NoYes   Bath Hot Springs, planktonic community (meta-genome)
NoYes   Combined (meta-genome)
NoYes   Cyphomyrmex longiscapus fungus garden (meta-genome)
NoYes   Dendroctonus ponderosae beetle community (MPB hybrid beetle) (Lodgepole pine) (meta-genome)
NoYes   Dendroctonus ponderosae fungus gallery (Hybrid pine) (MPB hybrid gallery) (meta-genome)
NoYes   Dump bottom (Dump bottom) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #1 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #2 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #3 (meta-genome)
NoYes   Freshwater propionate enrichment of Brocadia fulgida (meta-genome)
NoYes   Fungus garden combined (combined) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden bottom (Fungus garden bottom) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden top (meta-genome)
NoYes   Groundwater dechlorinating community (KB-1) from synthetic mineral medium in Toronto, ON, sample from Site contaminated with chlorinated ethenes
NoYes   Guerrero Negro salt ponds hypersaline mat 01(G) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 02(H) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 03(I) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 04(N) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 05(O) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 06(P) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 07(S) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 08(T) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 09(Y) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 10(Z) (meta-genome)
NoYes   Hindgut microbiome of Nasutitermes sp. (Costa Rica) (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP11 from Octopus Springs (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP12 from Calcite Springs, Tower Falls Region (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP13 from Bechler Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP15 from Mushroom Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP16 from Fairy Spring Red Layer (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP17 from Obsidian Pool Prime (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP18 from Washburn Springs #1 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP20 from Bath Lake Vista Annex - Purple-Sulfur Mats (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP5 from Bath Lake Vista Annex (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP7 from Chocolate Pots (meta-genome)
NoYes   Human Gut Community Subject 7 (meta-genome)
NoYes   Human Gut Community Subject 8 (meta-genome)
NoYes   Macropus eugenii forestomach microbiome from Canberra, Australia, sample Macropus_eugenii_combined (meta-genome)
NoYes   Maize field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing corn (Zea may (meta-genome)
NoYes   Maize rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Soil sample from rhizosphere of corn (Zea mays))< (meta-genome)
NoYes   Marine anammox bioreactor enriched for Scalindua species (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formaldehyde enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formate enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methane enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methanol enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methylamine enrichment (meta-genome)
NoYes   Miscanthus field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing Miscanthu (meta-genome)
NoYes   Miscanthus rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample of Miscanthus x giga (meta-genome)
NoYes   Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine (MPB hybrid beetle) (meta-genome)
NoYes   Mouse Gut Community lean1 (meta-genome)
NoYes   Mouse Gut Community lean3 (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   Olavius algarvensis endosymbiont metagenome Delta1 (meta-genome)
NoYes   Olavius algarvensis endosymbiont metagenome Delta4 (meta-genome)
NoYes   Olavius algarvensis endosymbiont metagenome Gamma3 (meta-genome)
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   simHC - Simulated High Complexity Metagenome (meta-genome)
NoYes   simLC - Simulated Low Complexity Metagenome (meta-genome)
NoYes   simMC - Simulated Medium Complexity Metagenome (meta-genome)
NoYes   Sludge/Australian, Phrap Assembly (meta-genome)
NoYes   Sludge/US, Jazz Assembly (meta-genome)
NoYes   Sludge/US, Phrap Assembly (meta-genome)
NoYes   Soil microbial communities from Minnesota Farm (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- (Maryland Estuary ambient) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 4 Nevada Test Site Crust CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+ (Oak Ridge elevated CO2) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- (Oak Ridge ambient) (meta-genome)
NoYes   Soil microbial community from bioreactor at Alameda Naval Air Station, CA, contaminated with Chloroethene, Sample 196 (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing switchgr (meta-genome)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Switchgrass soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample from switchgrass (Panicum virg (meta-genome)
NoYes   Termite Protist Endosymbiont Community (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Wastewater Terephthalate-degrading communities from Bioreactor (meta-genome)
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   The Salmonella enterica Pan-genome (meta-genome)
NoYes   ALL (only advised for small superfamilies)

Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]