SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

TM1646-like alignments

These alignments are sequences aligned to the 0054465 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                           10        20        30        40        50        60     
                                            |         |         |         |         |         |     
d2p61a1                          ..EFFDILEDVKEDHFEKLLEEAVEEVIDSGNELVRSPTPSNLKRYKNAIKEFLKLIEKKIYKLAGS
99883.ENSTNIP00000005633:164-243 qa---------QSQSEAEKLQRLKERVETQEARLKKIRAMRGQVDYSKLINGNLSAEIEHVSSLFQE


                                    70        80        90       100       110            
                                     |         |         |         |         |            
d2p61a1                          FDMNSGRARLHLVVEEVNEKLMDLTEKIMKNEWQTINLAARIEEINGLILNLY-r..
99883.ENSTNIP00000005633:164-243 KQAE--LQSAVLRVDQLTQQL---------------------------------edl


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0054465 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Selenomonas sputigena ATCC 35185
NoYes   Selenomonas ruminantium subsp. lactilytica TAM6421
NoYes   Natranaerobius thermophilus JW/NM-WN-LF
NoYes   Symbiobacterium thermophilum IAM 14863
NoYes   Clostridium clariflavum DSM 19732
NoYes   Clostridium cellulolyticum H10
NoYes   Clostridium thermocellum ATCC 27405
NoYes   Sulfobacillus acidophilus DSM 10332
NoYes   Thermincola potens JR
NoYes   Desulfosporosinus acidiphilus SJ4
NoYes   Desulfosporosinus orientis DSM 765
NoYes   Dehalobacter sp. DCA
NoYes   Dehalobacter sp. CF
NoYes   Syntrophobotulus glycolicus DSM 8271
NoYes   Desulfitobacterium hafniense Y51
NoYes   Desulfitobacterium dehalogenans ATCC 51507
NoYes   Desulfotomaculum reducens MI-1
NoYes   Desulfotomaculum acetoxidans DSM 771
NoYes   Desulfotomaculum carboxydivorans CO-1-SRB
NoYes   Desulfotomaculum ruminis DSM 2154
NoYes   Eubacterium eligens ATCC 27750
NoYes   Clostridium difficile 630
NoYes   Clostridium sticklandii DSM 519
NoYes   Clostridium phytofermentans ISDg
NoYes   Clostridium lentocellum DSM 5427
NoYes   Eubacterium rectale M104/1
NoYes   Eubacterium rectale ATCC 33656
NoYes   Roseburia hominis A2-183
NoYes   Butyrivibrio proteoclasticus B316
NoYes   Butyrivibrio fibrisolvens
NoYes   Syntrophothermus lipocalidus DSM 12680
NoYes   Syntrophomonas wolfei subsp. wolfei str. Goettingen
NoYes   Heliobacterium modesticaldum Ice1
NoYes   Alkaliphilus oremlandii OhILAs
NoYes   Alkaliphilus metalliredigens QYMF
NoYes   Candidatus Arthromitus sp. SFB-mouse-Japan
NoYes   Clostridium sp. BNL1100
NoYes   Clostridium novyi NT
NoYes   Clostridium ljungdahlii DSM 13528
NoYes   Clostridium kluyveri DSM 555
NoYes   Clostridium beijerinckii NCIMB 8052
NoYes   Clostridium tetani E88
NoYes   Clostridium cellulovorans 743B
NoYes   Clostridium botulinum A str. ATCC 3502
NoYes   Clostridium acetobutylicum ATCC 824
NoYes   Mahella australiensis 50-1 BON
NoYes   Thermosediminibacter oceani DSM 16646
NoYes   Caldicellulosiruptor obsidiansis OB47
NoYes   Caldicellulosiruptor kronotskyensis 2002
NoYes   Caldicellulosiruptor hydrothermalis 108
NoYes   Caldicellulosiruptor owensensis OL
NoYes   Caldicellulosiruptor lactoaceticus 6A
NoYes   Caldicellulosiruptor kristjanssonii 177R1B
NoYes   Caldicellulosiruptor saccharolyticus DSM 8903
NoYes   Caldicellulosiruptor bescii DSM 6725
NoYes   Thermoanaerobacterium xylanolyticum LX-11
NoYes   Thermoanaerobacterium thermosaccharolyticum DSM 571
NoYes   Tepidanaerobacter acetatoxydans Re1
NoYes   Thermoanaerobacter tengcongensis MB4
NoYes   Thermoanaerobacter mathranii subsp. mathranii str. A3
NoYes   Thermoanaerobacter pseudethanolicus ATCC 33223
NoYes   Thermoanaerobacter sp. X514
NoYes   Thermoanaerobacter italicus Ab9
NoYes   Thermoanaerobacter wiegelii Rt8.B1
NoYes   Thermoanaerobacter brockii subsp. finnii Ako-1
NoYes   Acetohalobium arabaticum DSM 5501
NoYes   Halothermothrix orenii H 168
NoYes   Exiguobacterium sp. MH3
NoYes   Exiguobacterium sp. AT1b
NoYes   Exiguobacterium sibiricum 255-15
NoYes   Kyrpidia tusciae DSM 2912
NoYes   Brevibacillus brevis NBRC 100599
NoYes   Paenibacillus sp. JDR-2
NoYes   Paenibacillus terrae HPL-003
NoYes   Paenibacillus mucilaginosus 3016
NoYes   Paenibacillus polymyxa M1
NoYes   Bacillus selenitireducens MLS10
NoYes   Listeria welshimeri serovar 6b str. SLCC5334
NoYes   Listeria innocua Clip11262
NoYes   Listeria seeligeri serovar 1/2b str. SLCC3954
NoYes   Listeria monocytogenes serotype 4b str. CLIP 80459
NoYes   Listeria ivanovii subsp. ivanovii PAM 55
NoYes   Solibacillus silvestris StLB046
NoYes   Geobacillus thermoglucosidasius C56-YS93
NoYes   Lysinibacillus sphaericus C3-41
NoYes   Oceanobacillus iheyensis HTE831
NoYes   Anoxybacillus flavithermus WK1
NoYes   Geobacillus thermoleovorans CCB_US3_UF5
NoYes   Geobacillus kaustophilus HTA426
NoYes   Geobacillus sp. GHH01
NoYes   Geobacillus sp. WCH70
NoYes   Geobacillus thermodenitrificans NG80-2
NoYes   Halobacillus halophilus DSM 2266
NoYes   Bacillus sp. JS
NoYes   Bacillus sp. 1NLA3E
NoYes   Bacillus amyloliquefaciens FZB42
NoYes   Bacillus atrophaeus 1942
NoYes   Bacillus subtilis subsp. subtilis str. 168
NoYes   Bacillus licheniformis DSM 13 = ATCC 14580
NoYes   Bacillus halodurans C-125
NoYes   Bacillus weihenstephanensis KBAB4
NoYes   Bacillus thuringiensis str. Al Hakam
NoYes   Bacillus cereus 03BB102
NoYes   Bacillus anthracis str. A0248
NoYes   Bacillus pseudofirmus OF4
NoYes   Bacillus clausii KSM-K16
NoYes   Bacillus cellulosilyticus DSM 2522
NoYes   Bacillus pumilus SAFR-032
NoYes   Bacillus megaterium DSM 319
NoYes   Bacillus coagulans 2-6
NoYes   Thermovirga lienii DSM 17291
NoYes   Thermanaerovibrio acidaminovorans DSM 6589
NoYes   Anaerobaculum mobile DSM 13181
NoYes   Turneriella parva DSM 21527
NoYes   Leptospira borgpetersenii serovar Hardjo-bovis str. L550
NoYes   Leptospira interrogans serovar Lai str. IPAV
NoYes   Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'
NoYes   Brachyspira murdochii DSM 12563
NoYes   Brachyspira intermedia PWS/A
NoYes   Brachyspira pilosicoli 95/1000
NoYes   Brachyspira hyodysenteriae WA1
NoYes   Borrelia garinii PBi
NoYes   Borrelia bissettii DN127
NoYes   Borrelia afzelii PKo
NoYes   Borrelia burgdorferi B31
NoYes   Borrelia recurrentis A1
NoYes   Borrelia duttonii Ly
NoYes   Borrelia crocidurae str. Achema
NoYes   Borrelia turicatae 91E135
NoYes   Borrelia hermsii DAH
NoYes   Spirochaeta smaragdinae DSM 11293
NoYes   Spirochaeta caldaria DSM 7334
NoYes   Treponema azotonutricium ZAS-9
NoYes   Treponema primitia ZAS-2
NoYes   Treponema brennaborense DSM 12168
NoYes   Treponema paraluiscuniculi Cuniculi A
NoYes   Treponema succinifaciens DSM 2489
NoYes   Treponema pallidum subsp. pallidum SS14
NoYes   Geobacillus sp. JF8
NoYes   Treponema denticola ATCC 35405
NoYes   Spirochaeta africana DSM 8902
NoYes   Spirochaeta thermophila DSM 6192
NoYes   Marinitoga piezophila KA3
NoYes   Petrotoga mobilis SJ95
NoYes   Fervidobacterium pennivorans DSM 9078
NoYes   Fervidobacterium nodosum Rt17-B1
NoYes   Thermosipho melanesiensis BI429
NoYes   Thermosipho africanus TCF52B
NoYes   Thermotoga lettingae TMO
NoYes   Thermotoga thermarum DSM 5069
NoYes   Thermotoga sp. RQ2
NoYes   Thermotoga naphthophila RKU-10
NoYes   Thermotoga petrophila RKU-1
NoYes   Thermotoga neapolitana DSM 4359
NoYes   Thermotoga maritima MSB8
NoYes   Geobacter daltonii FRC-32
NoYes   Geobacter sp. M21
NoYes   Geobacter uraniireducens Rf4
NoYes   Geobacter lovleyi SZ
NoYes   Geobacter bemidjiensis Bem
NoYes   Geobacter sulfurreducens KN400
NoYes   Geobacter metallireducens GS-15
NoYes   Pelobacter propionicus DSM 2379
NoYes   Clostridium thermocellum DSM 1313
NoYes   [Clostridium] stercorarium Clostridiu subsp. stercorarium DSM 8532
NoYes   Sulfobacillus acidophilus TPY
NoYes   Clostridium acidurici 9a
NoYes   Desulfosporosinus meridiei DSM 13257
NoYes   Desulfitobacterium dichloroeliminans LMG P-21439
NoYes   Desulfitobacterium hafniense DCB-2
NoYes   Clostridium difficile BI1
NoYes   Clostridium difficile R20291
NoYes   Clostridium difficile CD196
NoYes   Candidatus Arthromitus sp. SFB-rat-Yit
NoYes   Candidatus Arthromitus sp. SFB-mouse-Yit
NoYes   Clostridium saccharobutylicum DSM 13864
NoYes   Clostridium autoethanogenum DSM 10061
NoYes   Clostridium saccharoperbutylacetonicum N1-4(HMT)
NoYes   Clostridium kluyveri NBRC 12016
NoYes   Clostridium tetani genome 12124569
NoYes   Clostridium pasteurianum BC1
NoYes   Clostridium botulinum H04402 065
NoYes   Clostridium botulinum BKT015925
NoYes   Clostridium botulinum F str. 230613
NoYes   Clostridium botulinum F str. Langeland
NoYes   Clostridium botulinum E3 str. Alaska E43
NoYes   Clostridium botulinum B1 str. Okra
NoYes   Clostridium botulinum Ba4 str. 657
NoYes   Clostridium botulinum A2 str. Kyoto
NoYes   Clostridium botulinum A3 str. Loch Maree
NoYes   Clostridium botulinum A str. Hall
NoYes   Clostridium botulinum A str. ATCC 19397
NoYes   Clostridium acetobutylicum DSM 1731
NoYes   Clostridium acetobutylicum EA 2018
NoYes   Thermoanaerobacterium saccharolyticum JW/SL-YS485
NoYes   Thermoanaerobacterium thermosaccharolyticum M0795
NoYes   Thermoanaerobacter sp. X513
NoYes   Halobacteroides halobius DSM 5150
NoYes   Clostridium botulinum B str. Eklund 17B
NoYes   Exiguobacterium antarcticum B7
NoYes   Thermobacillus composti KWC4
NoYes   Paenibacillus sp. Y412MC10
NoYes   Paenibacillus mucilaginosus KNP414
NoYes   Paenibacillus mucilaginosus K02
NoYes   Paenibacillus larvae subsp. larvae DSM 25430
NoYes   Paenibacillus polymyxa CR1
NoYes   Paenibacillus polymyxa SC2
NoYes   Paenibacillus polymyxa E681
NoYes   Listeria monocytogenes EGD sequence
NoYes   Listeria monocytogenes N53-1
NoYes   Listeria monocytogenes La111
NoYes   Listeria monocytogenes serotype 4b str. LL195
NoYes   Listeria monocytogenes 07PF0776
NoYes   Listeria monocytogenes M7
NoYes   Listeria monocytogenes J1-220
NoYes   Listeria monocytogenes J1816
NoYes   Listeria monocytogenes SLCC2376
NoYes   Listeria monocytogenes SLCC5850
NoYes   Listeria monocytogenes ATCC 19117
NoYes   Listeria monocytogenes L312
NoYes   Listeria monocytogenes SLCC2479
NoYes   Listeria monocytogenes SLCC7179
NoYes   Listeria monocytogenes SLCC2540
NoYes   Listeria monocytogenes SLCC2378
NoYes   Listeria monocytogenes serotype 1/2b str. SLCC2755
NoYes   Listeria monocytogenes serotype 1/2c str. SLCC2372
NoYes   Listeria monocytogenes serotype 7 str. SLCC2482
NoYes   Listeria monocytogenes 08-5578
NoYes   Listeria monocytogenes 08-5923
NoYes   Listeria monocytogenes L99
NoYes   Listeria monocytogenes HCC23
NoYes   Listeria monocytogenes 10403S
NoYes   Listeria monocytogenes J0161
NoYes   Listeria monocytogenes Finland 1998
NoYes   Listeria monocytogenes FSL R2-561
NoYes   Listeria monocytogenes serotype 4b str. F2365
NoYes   Listeria monocytogenes EGD-e
NoYes   Geobacillus sp. C56-T3
NoYes   Geobacillus sp. Y4.1MC1
NoYes   Geobacillus sp. Y412MC52
NoYes   Geobacillus sp. Y412MC61
NoYes   Amphibacillus xylanus NBRC 15112
NoYes   Bacillus amyloliquefaciens subsp. plantarum sequencing
NoYes   Bacillus amyloliquefaciens subsp. plantarum UCMB5033
NoYes   Bacillus amyloliquefaciens subsp. plantarum AS43.3
NoYes   Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2
NoYes   Bacillus amyloliquefaciens subsp. plantarum UCMB5113
NoYes   Bacillus amyloliquefaciens subsp. plantarum UCMB5036
NoYes   Bacillus amyloliquefaciens subsp. plantarum CAU B946
NoYes   Bacillus amyloliquefaciens LFB112
NoYes   Bacillus amyloliquefaciens CC178
NoYes   Bacillus amyloliquefaciens Y2
NoYes   Bacillus amyloliquefaciens IT-45
NoYes   Bacillus amyloliquefaciens XH7
NoYes   Bacillus amyloliquefaciens LL3
NoYes   Bacillus amyloliquefaciens TA208
NoYes   Bacillus amyloliquefaciens DSM 7
NoYes   Bacillus licheniformis 9945A
NoYes   Bacillus subtilis PY79
NoYes   Bacillus subtilis XF-1
NoYes   Bacillus subtilis QB928
NoYes   Bacillus subtilis BSn5
NoYes   Bacillus subtilis subsp. subtilis str. BAB-1
NoYes   Bacillus subtilis subsp. subtilis str. BSP1
NoYes   Bacillus subtilis subsp. subtilis str. RO-NN-1
NoYes   Bacillus subtilis subsp. subtilis 6051-HGW
NoYes   Bacillus subtilis subsp. spizizenii TU-B-10
NoYes   Bacillus subtilis subsp. spizizenii str. W23
NoYes   Bacillus subtilis subsp. natto BEST195
NoYes   Bacillus licheniformis DSM 13 = ATCC 14580
NoYes   Bacillus infantis NRRL B-14911
NoYes   Bacillus cereus subsp. cytotoxis NVH 391-98
NoYes   Bacillus toyonensis BCT-7112
NoYes   Bacillus thuringiensis HD-771
NoYes   Bacillus thuringiensis HD-789
NoYes   Bacillus thuringiensis MC28
NoYes   Bacillus thuringiensis serovar chinensis CT-43
NoYes   Bacillus thuringiensis YBT-1518
NoYes   Bacillus thuringiensis Bt407
NoYes   Bacillus thuringiensis serovar konkukian str. 97-27
NoYes   Bacillus thuringiensis serovar kurstaki str. HD73
NoYes   Bacillus thuringiensis BMB171
NoYes   Bacillus thuringiensis serovar finitimus YBT-020
NoYes   Bacillus thuringiensis serovar thuringiensis str. IS5056
NoYes   Bacillus cereus FRI-35
NoYes   Bacillus cereus biovar anthracis str. CI
NoYes   Bacillus cereus AH820
NoYes   Bacillus cereus AH187
NoYes   Bacillus cereus B4264
NoYes   Bacillus cereus G9842
NoYes   Bacillus cereus Q1
NoYes   Bacillus cereus F837/76
NoYes   Bacillus cereus NC7401
NoYes   Bacillus cereus E33L
NoYes   Bacillus cereus ATCC 14579
NoYes   Bacillus cereus ATCC 10987
NoYes   Bacillus anthracis str. H9401
NoYes   Bacillus anthracis str. CDC 684
NoYes   Bacillus anthracis str. 'Ames Ancestor'
NoYes   Bacillus anthracis str. Sterne
NoYes   Bacillus anthracis str. Ames
NoYes   Bacillus megaterium WSH-002
NoYes   Bacillus megaterium QM B1551
NoYes   Bacillus coagulans 36D1
NoYes   Leptospira borgpetersenii serovar Hardjo-bovis str. JB197
NoYes   Leptospira interrogans serovar Lai str. 56601
NoYes   Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130
NoYes   Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'
NoYes   Brachyspira pilosicoli WesB
NoYes   Brachyspira pilosicoli B2904
NoYes   Brachyspira pilosicoli P43/6/78
NoYes   Borrelia garinii NMJW1
NoYes   Borrelia garinii BgVir
NoYes   Borrelia afzelii HLJ01
NoYes   Borrelia afzelii PKo
NoYes   Borrelia burgdorferi CA382
NoYes   Borrelia burgdorferi JD1
NoYes   Borrelia burgdorferi N40
NoYes   Borrelia burgdorferi ZS7
NoYes   Borrelia miyamotoi LB-2001
NoYes   Treponema pedis str. T A4
NoYes   Treponema pallidum str. Fribourg-Blanc
NoYes   Treponema pallidum subsp. pertenue str. Gauthier
NoYes   Treponema pallidum subsp. pertenue str. CDC2
NoYes   Treponema pallidum subsp. pertenue str. SamoaD
NoYes   Treponema pallidum subsp. pallidum str. Mexico A
NoYes   Treponema pallidum subsp. pallidum str. Chicago
NoYes   Treponema pallidum subsp. pallidum DAL-1
NoYes   Treponema pallidum subsp. pallidum str. Nichols
NoYes   Spirochaeta thermophila DSM 6578
NoYes   Thermotoga maritima MSB8
NoYes   Geobacter sp. M18
NoYes   Geobacter sulfurreducens PCA
NoYes   3_050719R (meta-genome)
NoYes   Activated sludge plasmid pool Morges-2009 (Newbler) (meta-genome)
NoYes   Cyphomyrmex longiscapus fungus garden (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden bottom (Fungus garden bottom) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden top (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 05(O) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 06(P) (meta-genome)
NoYes   Hindgut microbiome of Nasutitermes sp. (Costa Rica), fosmids (meta-genome)
NoYes   Hindgut microbiome of Nasutitermes sp. (Costa Rica) (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP15 from Mushroom Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP17 from Obsidian Pool Prime (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP18 from Washburn Springs #1 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP7 from Chocolate Pots (meta-genome)
NoYes   Macropus eugenii forestomach microbiome from Canberra, Australia, sample Macropus_eugenii_combined (meta-genome)
NoYes   Mouse Gut Community lean3 (meta-genome)
NoYes   Mouse Gut Community ob1 (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   simHC - Simulated High Complexity Metagenome (meta-genome)
NoYes   simLC - Simulated Low Complexity Metagenome (meta-genome)
NoYes   Soil microbial community from bioreactor at Alameda Naval Air Station, CA, contaminated with Chloroethene, Sample 196 (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Uniprot 2018_03 genome
NoYes   Wastewater Terephthalate-degrading communities from Bioreactor (meta-genome)
NoYes   NCBI viral sequences (Viral)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]