SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from Please contact us if you experience any problems.

DNA-binding pseudobarrel domain alignments in Aquilegia coerulea v195

These alignments are sequences aligned to the 0048310 model.

Sophisticated options are available for refining alignments:

Jump to [ Top of page · Refine alignments · Add alignments from genomes ]


The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

d1na6a1                              s..............................................................
Aquca_002_01425.3|PACid:22053109   yi.............................................................
Aquca_002_01425.4|PACid:22053110   yi.............................................................
Aquca_002_01425.2|PACid:22053108   yi.............................................................
Aquca_022_00246.3|PACid:22054926   l..............................................................
Aquca_002_01425.1|PACid:22053107   yi.............................................................
Aquca_022_00246.1|PACid:22054925   l..............................................................
Aquca_022_00246.2|PACid:22054924   l..............................................................
Aquca_007_00393.1|PACid:22047861   dfg............................................................
Aquca_027_00067.1|PACid:22045407   sk.............................................................
Aquca_018_00174.2|PACid:22040969   al.............................................................
Aquca_018_00174.1|PACid:22040968   al.............................................................
Aquca_008_00175.10|PACid:22061577  pe.............................................................
Aquca_008_00175.7|PACid:22061574   pe.............................................................
Aquca_008_00175.8|PACid:22061575   pe.............................................................
Aquca_008_00175.9|PACid:22061576   pe.............................................................
Aquca_008_00175.4|PACid:22061571   pe.............................................................
Aquca_008_00175.5|PACid:22061572   pe.............................................................
Aquca_008_00175.1|PACid:22061569   pe.............................................................
Aquca_008_00175.2|PACid:22061568   pe.............................................................
Aquca_008_00175.3|PACid:22061570   pe.............................................................
Aquca_051_00062.1|PACid:22046115   p..............................................................
Aquca_036_00025.6|PACid:22055309   p..............................................................
Aquca_036_00025.7|PACid:22055310   p..............................................................
Aquca_036_00025.3|PACid:22055306   p..............................................................
Aquca_036_00025.4|PACid:22055307   p..............................................................
Aquca_036_00025.5|PACid:22055308   p..............................................................
Aquca_036_00025.2|PACid:22055305   p..............................................................
Aquca_036_00025.1|PACid:22055304   p..............................................................
Aquca_036_00025.8|PACid:22055311   ...............................................................
Aquca_100_00036.4|PACid:22063733   pr.............................................................
Aquca_100_00036.1|PACid:22063730   pr.............................................................
Aquca_100_00036.2|PACid:22063731   pr.............................................................
Aquca_100_00036.3|PACid:22063732   pr.............................................................
Aquca_013_00067.6|PACid:22058795   elpr...........................................................
Aquca_013_00067.5|PACid:22058794   elpr...........................................................
Aquca_013_00067.2|PACid:22058791   elpr...........................................................
Aquca_013_00067.4|PACid:22058793   elpr...........................................................
Aquca_013_00067.3|PACid:22058792   elpr...........................................................
Aquca_013_00067.1|PACid:22058790   elpr...........................................................
Aquca_003_00899.1|PACid:22049393   l..............................................................
Aquca_008_00175.6|PACid:22061573   pe.............................................................
Aquca_072_00063.1|PACid:22041202   ...............................................................
Aquca_002_01106.1|PACid:22052086   n..............................................................
Aquca_017_00295.1|PACid:22031853   p..............................................................
Aquca_026_00225.1|PACid:22056011   k..............................................................
Aquca_037_00291.1|PACid:22040322   e..............................................................
Aquca_030_00152.2|PACid:22035640   dk.............................................................
Aquca_030_00152.3|PACid:22035641   dk.............................................................
Aquca_030_00152.1|PACid:22035639   dk.............................................................
Aquca_009_00894.1|PACid:22034885   ftstrpyfmrclypscvytsyvl........................................
Aquca_011_00122.1|PACid:22038526   q..............................................................
Aquca_016_00429.1|PACid:22062626   engspsfvksmlqshvtggfwlg........................................
Aquca_016_00429.2|PACid:22062627   engspsfvksmlqshvtggfwlg........................................
Aquca_142_00013.1|PACid:22063995   q..............................................................
Aquca_007_00469.1|PACid:22047618   akrrhffrvmiddfdrrlripqaflqsitkqssemvilespsgsrwrvrlkrtsd........
Aquca_007_00625.2|PACid:22048373   ldpefpsfvkvmlpshvsggfwmg.......................................
Aquca_007_00625.1|PACid:22048372   ldpefpsfvkvmlpshvsggfwmg.......................................
Aquca_007_00624.1|PACid:22047882   ldpgfpsfvkimlpshvsggfwlgl......................................
Aquca_010_00344.1|PACid:22046370   qffkvylpahssirlkiptafinsfngilpekimlkdsvgrvwhvevkevendfffq......
Aquca_007_00623.1|PACid:22048688   ldpefrsfvkimqpshvsdgfwlglpakfcsshlpke..........................
Aquca_015_00099.1|PACid:22041718   ldpkfpilvkymlpshvsscfwlglpldfcksylpkqdemitli...................
Aquca_095_00007.1|PACid:22042388   engfpsfvkpmlqshvtggfwlg........................................
Aquca_010_00343.5|PACid:22046470   rktsffkiihgniiadqqlvlptkfvtkhgnefsdnvtlkvpngsvwtiklnkddgkiclca.
Aquca_010_00343.6|PACid:22046469   rktsffkiihgniiadqqlvlptkfvtkhgnefsdnvtlkvpngsvwtiklnkddgkiclca.
Aquca_010_00343.7|PACid:22046468   rktsffkiihgniiadqqlvlptkfvtkhgnefsdnvtlkvpngsvwtiklnkddgkiclca.
Aquca_011_00002.1|PACid:22037837   snspsffkflihdsfnelriptayirhfngdvpkkfilrsptkrtwmvsakendngvflcd..
Aquca_007_00470.4|PACid:22048902   esrkshffkilvedfeqklqipkafmkniseksskmailkgpsgscwhvkltrk.........
Aquca_010_00343.4|PACid:22046467   rktsffkiihgniiadqqlvlptkfvtkhgnefsdnvtlkvpngsvwtiklnkddgkiclca.
Aquca_005_00544.1|PACid:22024146   ysffkvmlgdfthqlhippafvlhyndilpekllletflgecwdvklk...............
Aquca_010_00343.1|PACid:22046466   rktsffkiihgniiadqqlvlptkfvtkhgnefsdnvtlkvpngsvwtiklnkddgkiclca.
Aquca_010_00343.2|PACid:22046464   rktsffkiihgniiadqqlvlptkfvtkhgnefsdnvtlkvpngsvwtiklnkddgkiclca.
Aquca_010_00343.3|PACid:22046465   rktsffkiihgniiadqqlvlptkfvtkhgnefsdnvtlkvpngsvwtiklnkddgkiclca.
Aquca_088_00008.1|PACid:22058033   fksnypwfavpivkshkh.............................................
Aquca_007_00470.1|PACid:22048899   esrkshffkilvedfeqklqipkafmkniseksskmailkgpsgscwhvkltrk.........
Aquca_007_00470.2|PACid:22048900   esrkshffkilvedfeqklqipkafmkniseksskmailkgpsgscwhvkltrk.........
Aquca_007_00470.3|PACid:22048901   esrkshffkilvedfeqklqipkafmkniseksskmailkgpsgscwhvkltrk.........
Aquca_022_00155.1|PACid:22054675   gshffkiihssciqdrrltipkkfirifgkelanvvvlkvpsnkhwevelvedegqvwfqn..
Aquca_009_00894.1|PACid:22034885   kkpeffkiihpslctteqlrippdflkhisdedngiavlegps....................
Aquca_010_00341.1|PACid:22046423   gyhffkfilpscienrclaipkkfirifgkelsnivvlkdpssrewhvelgedegqiwf....
Aquca_001_00015.1|PACid:22042933   ypkfvaemkdsnvgypfqlnvpiafsrlnl.................................
Aquca_010_00339.4|PACid:22046365   sapsffkllihdfsqqlclptdyinnfngdvpkqfiltsstrrswevsvkkvdndlflcek..
Aquca_108_00003.1|PACid:22046285   ll.............................................................
Aquca_010_00339.3|PACid:22046364   sapsffkllihdfsqqlclptdyinnfngdvpkqfiltsstrrswevsvkkvdndlflcek..
Aquca_010_00339.2|PACid:22046363   sapsffkllihdfsqqlclptdyinnfngdvpkqfiltsstrrswevsvkkvdndlflcek..
Aquca_010_00338.1|PACid:22046925   tsnipnffkvmvgdfqkklslpkaltlcfkpkvpkmftlisptgsswmvsvkrvdkdff....
Aquca_086_00041.1|PACid:22054404   ldprfpsfvksmlrshvikgfwmgipgqfckahlpkhdvtiplvdenqeefvtnyllhkigls
Aquca_010_00339.1|PACid:22046362   sapsffkllihdfsqqlclptdyinnfngdvpkqfiltsstrrswevsvkkvdndlflcek..
Aquca_007_00469.1|PACid:22047618   rnpffkvvlrpsyihilpiptrfarryiktedeivtimvpdgrtwhircskatqgf.......
Aquca_007_00471.1|PACid:22048590   efckiihsniiqdqclilplkfiqkfgndvsnaailkvsdgkrwhvelrktdsqimfhng...
Aquca_007_00471.2|PACid:22048589   efckiihsniiqdqclilplkfiqkfgndvsnaailkvsdgkrwhvelrktdsqimfhng...
Aquca_009_00893.1|PACid:22033645   ftscfpyfirplyassvyisyvvnipadfartylptrktefvledhlsgrfwtlnfnpgtlns
Aquca_004_00296.1|PACid:22030709   ...............................................................
Aquca_014_00277.1|PACid:22029059   asnphfvvpimprepqeniaipksflrnyligekcarkatlrtrksrkswkvnlkglcfedg.
Aquca_004_00298.1|PACid:22029841   edlpsfckiissstiadeklgipkkfltrygkymsndvv........................
Aquca_009_00893.1|PACid:22033645   mkpeffkiihadlftteqlrippdflkhiskdesgiavidegpdatyswhvqfcrtedg....
Aquca_028_00035.1|PACid:22038686   ncftsfvkqmlqshvtggfwlgl........................................
Aquca_056_00103.1|PACid:22060723   vpsffkvlvdehekfmkf.............................................
Aquca_001_00536.1|PACid:22042974   sgypcfiksmvrtqvyscfwlgi........................................
Aquca_007_00471.1|PACid:22048590   dgvrsfrvvikasylgylripthftkryltdslrnltlevseghrwlvgcilyrghgirlsk.
Aquca_007_00471.2|PACid:22048589   dgvrsfrvvikasylgylripthftkryltdslrnltlevseghrwlvgcilyrghgirlsk.
Aquca_011_00002.2|PACid:22037838   snkpfcsvtlrstyvgskshnlvlpsrfakkymkrapr.........................
Aquca_045_00208.1|PACid:22027238   vp.............................................................
Aquca_011_00002.1|PACid:22037837   snkpfcsvtlrstyvgskshnlvlpsrfakkymkrapr.........................
Aquca_022_00154.1|PACid:22054782   fpscsvsllpsyvnrssylnvpmlfaktylkdahsvilrtpnggfwrvrfkepcrmgk.....
Aquca_011_00001.1|PACid:22037802   rfyffykiitasciqdrrik...........................................
Aquca_010_00340.1|PACid:22046572   snkpfcsvtmratyvgskshtlvlpspfakkymkraprnvtlrvinggtwhalykiga.....
Aquca_014_00275.1|PACid:22027716   iqpnnphffkfikcdslq.............................................
Aquca_004_00295.1|PACid:22029888   eippdflkhiqkeesvmavlkcpsgsrwdvklskrengtfiqdgw..................
Aquca_063_00016.5|PACid:22042613   tp.............................................................
Aquca_063_00016.4|PACid:22042612   tp.............................................................
Aquca_011_00002.2|PACid:22037838   sftvtfspakkyriiiprdlarenglkqkdnvvlldpcgrswpvtikh...............
Aquca_007_00471.1|PACid:22048590   klkhpsfravikssylhylripvrfsarhldnlrsltlevseghrws................
Aquca_007_00471.2|PACid:22048589   klkhpsfravikssylhylripvrfsarhldnlrsltlevseghrws................
Aquca_052_00041.1|PACid:22061969   llq............................................................
Aquca_011_00002.1|PACid:22037837   sftvtfspakkyriiiprdlarenglkqkdnvvlldpcgrswpvtikh...............
Aquca_063_00016.2|PACid:22042610   tp.............................................................
Aquca_063_00016.3|PACid:22042611   tp.............................................................
Aquca_063_00016.1|PACid:22042609   tp.............................................................
Aquca_010_00344.1|PACid:22046370   dqpkphfdvvvngngtaryfvhipkqvlidnnikiqpkiflrdpngkswpasvrfa.......
Aquca_014_00276.1|PACid:22028467   prnphffkfimpaafegisipkafmkdhlegercegrktmlrttksc................
Aquca_011_00001.1|PACid:22037802   skkqfcivtmrpsfvhkrfvlnlpiafskhl................................
Aquca_022_00154.1|PACid:22054782   qsrqpyfvkgmigdfrnklripmtfikdfngdvpdqfklrsligrswivsvkqvnddfflcn.
Aquca_022_00155.1|PACid:22054675   ftsenpicivimhssynlpvdfartylkenvqcvtlrvsdgkrwqvqcssvty..........
Aquca_035_00050.2|PACid:22061284   llv............................................................
Aquca_010_00338.1|PACid:22046925   sfnatfqpsrkykigipneivkekglsvkdkmllldpcgrswpvtiycwskgr..........
Aquca_035_00050.1|PACid:22061283   llv............................................................
Aquca_004_00155.3|PACid:22029726   kdcqlelpsefveehgnqlsdglvlkvrtgdtwniglrkfagr....................
Aquca_004_00155.2|PACid:22029725   kdcqlelpsefveehgnqlsdglvlkvrtgdtwniglrkfagr....................
Aquca_004_00155.1|PACid:22029724   kdcqlelpsefveehgnqlsdglvlkvrtgdtwniglrkfagr....................
Aquca_014_00282.1|PACid:22028670   nstkphfikvmkrthvymrffmtippkfirknfsevpemallrvtgkakawkvtiitkgldnl
Aquca_005_00159.1|PACid:22023896   cqlevpsefveehgnqlsdvgvlkvrtgdtwniglrrfagri.....................
Aquca_008_00005.1|PACid:22061768   tp.............................................................
Aquca_009_00848.1|PACid:22034367   vviqglekkl.....................................................
Aquca_010_00343.1|PACid:22046466   fksrypffkismnasylsrkfmnipvefcknylpkglesltlevsngrkkcrvrclpvcsqnr
Aquca_010_00343.2|PACid:22046464   fksrypffkismnasylsrkfmnipvefcknylpkglesltlevsngrkkcrvrclpvcsqnr
Aquca_010_00343.3|PACid:22046465   fksrypffkismnasylsrkfmnipvefcknylpkglesltlevsngrkkcrvrclpvcsqnr
Aquca_005_00157.1|PACid:22023821   dcqlevpsefveehgnqlsdvgvlkvrtgdtwniglrrfagrivf..................
Aquca_005_00157.2|PACid:22023820   dcqlevpsefveehgnqlsdvgvlkvrtgdtwniglrrfagrivf..................
Aquca_005_00533.1|PACid:22023793   ddkpyfhvvflksqvsgiyqlvlptkmssilpqavvpvvltrldkn.................
Aquca_019_00028.1|PACid:22055656   gipkkfltrygkymsndvvlkvcgcmawrvelrkadgfacfqng...................
Aquca_014_00275.1|PACid:22027716   vemkpshfkwrtfhvsapfgresglvriakla...............................
Aquca_014_00276.1|PACid:22028467   skhnmyakifttrwclcvqlvpanfrrkyg.................................
Aquca_007_00470.1|PACid:22048899   kpdhpfftigmqpsyalygpiprsfsrryfsegagnitlmlsdgrslnvgy............
Aquca_007_00470.2|PACid:22048900   kpdhpfftigmqpsyalygpiprsfsrryfsegagnitlmlsdgrslnvgy............
Aquca_007_00470.3|PACid:22048901   kpdhpfftigmqpsyalygpiprsfsrryfsegagnitlmlsdgrslnvgy............
Aquca_010_00338.1|PACid:22046925   skypmftttvpkgdltwyttliipklfakkylknnhlgltrdvtlrvttggt...........
Aquca_022_00154.1|PACid:22054782   sfiahlvssniyrmg................................................
Aquca_005_00543.1|PACid:22024412   fkskypsfivhlgrayvnggy..........................................
Aquca_010_00338.1|PACid:22046925   nclptdyiknfngdvpkqfiltsstrrfwevfvkkidnnlflseq..................
Aquca_010_00338.1|PACid:22046925   nvavlpsafakkhmkhaprgvilr.......................................
Aquca_001_00601.3|PACid:22044270   frviksrypqiefpsefveehgyklpdelvlkvrtgdf.........................
Aquca_005_00248.1|PACid:22024358   dprfpsfvksmfpshvskgfwmrlpvefcnahl..............................
Aquca_001_00601.1|PACid:22044268   fnskypffkitmgrsyin.............................................
Aquca_005_00157.1|PACid:22023821   nhpffklnvssayykhrhmff..........................................
Aquca_005_00157.2|PACid:22023820   nhpffklnvssayykhrhmff..........................................
Aquca_001_00601.1|PACid:22044268   frviksrypqiefpsefveehgyklpdelvlkvrtgdf.........................
Aquca_005_00544.1|PACid:22024146   qvhd...........................................................
Aquca_082_00029.1|PACid:22026036   dthwlwthiltksnvsevfnmqipkkfhpflpfysvdrvnli.....................
Aquca_014_00300.1|PACid:22028163   lsknfvskfgsklpetvvlkvltgkatnvgltrtkediffeh.....................
Aquca_049_00035.1|PACid:22044907   tr.............................................................
Aquca_019_00028.1|PACid:22055656   skypffkitmqpsyvnarywliprifsdkylpegleslshqvpngknkwvvgc..........
Aquca_030_00402.1|PACid:22035692   cysweknlkksdvdggqrrlmlsskdfavpsvnqllrdkddvtkgvevrvy............
Aquca_004_00299.1|PACid:22030696   awqvelkkidgsvylqngwle..........................................
Aquca_013_00263.1|PACid:22059509   sdkpyfhyiladyqvqnqfllvlpakihkvlpkaivpviltc.....................
Aquca_011_00002.2|PACid:22037838   endngvflcd.....................................................
Aquca_034_00215.1|PACid:22056829   kvpvvlncr......................................................
Aquca_001_00335.1|PACid:22043371   k..............................................................
Aquca_003_00642.1|PACid:22049220   sfftirkklkksdvnhlsrlmlskkmvynhitpylteeqnrevesgkgteilvmdldmkpcyr
Aquca_001_00900.1|PACid:22043661   wec............................................................
Aquca_003_00503.1|PACid:22050311   wec............................................................
Aquca_011_00094.1|PACid:22037794   wece...........................................................
Aquca_011_00095.1|PACid:22037765   wece...........................................................
Aquca_056_00103.1|PACid:22060723   rkrmdrkiilirdpsrrlwpvlylqssgfkvlgag............................
Aquca_014_00299.1|PACid:22028863   gsgcqvgigg.....................................................
Aquca_004_00299.1|PACid:22030696   fktkhhffkvfmrpsyvksryvpmpvr....................................
Aquca_035_00050.3|PACid:22061285   llv............................................................
Aquca_013_00315.1|PACid:22060143   pekfvmrkileqsdvnklsrlllkkglvevhinpflkeedlqdvksghg..............
Aquca_061_00064.1|PACid:22060840   lavgkrfgqtkkyfgd...............................................
Aquca_010_00343.4|PACid:22046467   fksrypffkismnasylsrkfmnip......................................
Aquca_021_00197.3|PACid:22039430   ldprfpsfvksmlhshvik............................................
Aquca_021_00197.1|PACid:22039429   ldprfpsfvksmlhshvik............................................
Aquca_021_00197.2|PACid:22039428   ldprfpsfvksmlhshvik............................................
Aquca_038_00055.1|PACid:22026856   ldprfpsfvksmlhshvikg...........................................

                                                            10        20        30        40        
                                                             |         |         |         |        
d1na6a1                              ...............-VFHNWLLEIACENYFVYIKRLSANDTGATGGHQVGLYIPSGIVEKLF
Aquca_002_01425.3|PACid:22053109   ...............---PAELGIPSKQPTNYFCKTLTASDTSTHG----GFSVPRRAAEKVF
Aquca_002_01425.4|PACid:22053110   ...............---PAELGIPSKQPTNYFCKTLTASDTSTHG----GFSVPRRAAEKVF
Aquca_002_01425.2|PACid:22053108   ...............---PAELGIPSKQPTNYFCKTLTASDTSTHG----GFSVPRRAAEKVF
Aquca_022_00246.3|PACid:22054926   ...............---PAELGVPSKQPTNYFCKTLTASDTSTHG----GFSVPRRAAEKVF
Aquca_002_01425.1|PACid:22053107   ...............---PAELGIPSKQPTNYFCKTLTASDTSTHG----GFSVPRRAAEKVF
Aquca_022_00246.1|PACid:22054925   ...............---PAELGVPSKQPTNYFCKTLTASDTSTHG----GFSVPRRAAEKVF
Aquca_022_00246.2|PACid:22054924   ...............---PAELGVPSKQPTNYFCKTLTASDTSTHG----GFSVPRRAAEKVF
Aquca_007_00393.1|PACid:22047861   ...............-------LKSSKHPSEFFCKTLTASDTSTHG----GFSVPRRAAEKLF
Aquca_027_00067.1|PACid:22045407   ...............-------------TPHMFCKTLTASDTSTHG----GFSVPRRAAEDCF
Aquca_018_00174.2|PACid:22040969   ...............--------KSNKPQTEFFCKTLTASDTSTHG----GFSVPRRAAEKIF
Aquca_018_00174.1|PACid:22040968   ...............--------KSNKPQTEFFCKTLTASDTSTHG----GFSVPRRAAEKIF
Aquca_008_00175.10|PACid:22061577  ...............---------PERCMAHSFCKTLTASDTSTHG----GFSVLRRHADDCL
Aquca_008_00175.7|PACid:22061574   ...............---------PERCMAHSFCKTLTASDTSTHG----GFSVLRRHADDCL
Aquca_008_00175.8|PACid:22061575   ...............---------PERCMAHSFCKTLTASDTSTHG----GFSVLRRHADDCL
Aquca_008_00175.9|PACid:22061576   ...............---------PERCMAHSFCKTLTASDTSTHG----GFSVLRRHADDCL
Aquca_008_00175.4|PACid:22061571   ...............---------PERCMAHSFCKTLTASDTSTHG----GFSVLRRHADDCL
Aquca_008_00175.5|PACid:22061572   ...............---------PERCMAHSFCKTLTASDTSTHG----GFSVLRRHADDCL
Aquca_008_00175.1|PACid:22061569   ...............---------PERCMAHSFCKTLTASDTSTHG----GFSVLRRHADDCL
Aquca_008_00175.2|PACid:22061568   ...............---------PERCMAHSFCKTLTASDTSTHG----GFSVLRRHADDCL
Aquca_008_00175.3|PACid:22061570   ...............---------PERCMAHSFCKTLTASDTSTHG----GFSVLRRHADDCL
Aquca_051_00062.1|PACid:22046115   ...............---------------HMFCKTLTASDTSTHG----GFSVPRRAAEDCF
Aquca_036_00025.6|PACid:22055309   ...............---------------HMFCKTLTASDTSTHG----GFSVPRRAAEDCF
Aquca_036_00025.7|PACid:22055310   ...............---------------HMFCKTLTASDTSTHG----GFSVPRRAAEDCF
Aquca_036_00025.3|PACid:22055306   ...............---------------HMFCKTLTASDTSTHG----GFSVPRRAAEDCF
Aquca_036_00025.4|PACid:22055307   ...............---------------HMFCKTLTASDTSTHG----GFSVPRRAAEDCF
Aquca_036_00025.5|PACid:22055308   ...............---------------HMFCKTLTASDTSTHG----GFSVPRRAAEDCF
Aquca_036_00025.2|PACid:22055305   ...............---------------HMFCKTLTASDTSTHG----GFSVPRRAAEDCF
Aquca_036_00025.1|PACid:22055304   ...............---------------HMFCKTLTASDTSTHG----GFSVPRRAAEDCF
Aquca_036_00025.8|PACid:22055311   ...............----------------MFCKTLTASDTSTHG----GFSVPRRAAEDCF
Aquca_100_00036.4|PACid:22063733   ...............------------PHVHSFCKTLTASDTSTHG----GFSVLRRHADECL
Aquca_100_00036.1|PACid:22063730   ...............------------PHVHSFCKTLTASDTSTHG----GFSVLRRHADECL
Aquca_100_00036.2|PACid:22063731   ...............------------PHVHSFCKTLTASDTSTHG----GFSVLRRHADECL
Aquca_100_00036.3|PACid:22063732   ...............------------PHVHSFCKTLTASDTSTHG----GFSVLRRHADECL
Aquca_013_00067.6|PACid:22058795   ...............------------PVVHSFCKILTASDTSTHG----GFSVLRKHANESL
Aquca_013_00067.5|PACid:22058794   ...............------------PVVHSFCKILTASDTSTHG----GFSVLRKHANESL
Aquca_013_00067.2|PACid:22058791   ...............------------PVVHSFCKILTASDTSTHG----GFSVLRKHANESL
Aquca_013_00067.4|PACid:22058793   ...............------------PVVHSFCKILTASDTSTHG----GFSVLRKHANESL
Aquca_013_00067.3|PACid:22058792   ...............------------PVVHSFCKILTASDTSTHG----GFSVLRKHANESL
Aquca_013_00067.1|PACid:22058790   ...............------------PVVHSFCKILTASDTSTHG----GFSVLRKHANESL
Aquca_003_00899.1|PACid:22049393   ...............--------QPQKSRIYTFSKALTASDTSTHG----GFSVLKKHADDCL
Aquca_008_00175.6|PACid:22061573   ...............---------PERCMAHSFCKTLTASDTSTHG----GFSVLRRHADDCL
Aquca_072_00063.1|PACid:22041202   ...............---------------HMFEKPLTPSDVGKLN----RLVIPKQHAEKYF
Aquca_002_01106.1|PACid:22052086   ...............----------------LFEKTVTPSDVGKLN----RLVIPKQHAEKNF
Aquca_017_00295.1|PACid:22031853   ...............----------------HFCKAVTASDTSTHG----GFSVHRRHAEQCF
Aquca_026_00225.1|PACid:22056011   ...............---------------HLFEKTVTPSDVGKLN----RLVIPKQHAEKHF
Aquca_037_00291.1|PACid:22040322   ...............---------------HMFDKVVTPSDVGKLN----RLVIPKQHAEKYF
Aquca_030_00152.2|PACid:22035640   ...............--------------LASFAKTLTQSDANNGG----GFSVPRYCAETIF
Aquca_030_00152.3|PACid:22035641   ...............--------------LASFAKTLTQSDANNGG----GFSVPRYCAETIF
Aquca_030_00152.1|PACid:22035639   ...............--------------LASFAKTLTQSDANNGG----GFSVPRYCAETIF
Aquca_009_00894.1|PACid:22034885   ...............-------------------------------------NIPTDFAEAYL
Aquca_011_00122.1|PACid:22038526   ...............----------------LFQKELTPSDVGKLN----RLVIPKKHAVKYF
Aquca_016_00429.1|PACid:22062626   ...............--------------------------------------LPSHFCRDFL
Aquca_016_00429.2|PACid:22062627   ...............--------------------------------------LPSHFCRDFL
Aquca_142_00013.1|PACid:22063995   ...............----------------LFQKELTPSDVGKLN----RIVIPKKYALKYF
Aquca_007_00469.1|PACid:22047618   ...............------------------------------------------------
Aquca_007_00625.2|PACid:22048373   ...............-----------------------------------------------F
Aquca_007_00625.1|PACid:22048372   ...............-----------------------------------------------F
Aquca_007_00624.1|PACid:22047882   ...............------------------------------------------------
Aquca_010_00344.1|PACid:22046370   ...............------------------------------------------------
Aquca_007_00623.1|PACid:22048688   ...............------------------------------------------------
Aquca_015_00099.1|PACid:22041718   ...............------------------------------------------------
Aquca_095_00007.1|PACid:22042388   ...............--------------------------------------LPRSFCRKHL
Aquca_010_00343.5|PACid:22046470   ...............------------------------------------------------
Aquca_010_00343.6|PACid:22046469   ...............------------------------------------------------
Aquca_010_00343.7|PACid:22046468   ...............------------------------------------------------
Aquca_011_00002.1|PACid:22037837   ...............------------------------------------------------
Aquca_007_00470.4|PACid:22048902   ...............------------------------------------------------
Aquca_010_00343.4|PACid:22046467   ...............------------------------------------------------
Aquca_005_00544.1|PACid:22024146   ...............------------------------------------------------
Aquca_010_00343.1|PACid:22046466   ...............------------------------------------------------
Aquca_010_00343.2|PACid:22046464   ...............------------------------------------------------
Aquca_010_00343.3|PACid:22046465   ...............------------------------------------------------
Aquca_088_00008.1|PACid:22058033   ...............--------------------------------------------QLIL
Aquca_007_00470.1|PACid:22048899   ...............------------------------------------------------
Aquca_007_00470.2|PACid:22048900   ...............------------------------------------------------
Aquca_007_00470.3|PACid:22048901   ...............------------------------------------------------
Aquca_022_00155.1|PACid:22054675   ...............------------------------------------------------
Aquca_009_00894.1|PACid:22034885   ...............------------------------------------------------
Aquca_010_00341.1|PACid:22046423   ...............------------------------------------------------
Aquca_001_00015.1|PACid:22042933   ...............------------------------------------------------
Aquca_010_00339.4|PACid:22046365   ...............------------------------------------------------
Aquca_108_00003.1|PACid:22046285   ...............------------------QKVLKQSDVGNLG----RIVLPKKEAETYL
Aquca_010_00339.3|PACid:22046364   ...............------------------------------------------------
Aquca_010_00339.2|PACid:22046363   ...............------------------------------------------------
Aquca_010_00338.1|PACid:22046925   ...............------------------------------------------------
Aquca_086_00041.1|PACid:22054404   ..............g------------------------------------------------
Aquca_010_00339.1|PACid:22046362   ...............------------------------------------------------
Aquca_007_00469.1|PACid:22047618   ...............------------------------------------------------
Aquca_007_00471.1|PACid:22048590   ...............------------------------------------------------
Aquca_007_00471.2|PACid:22048589   ...............------------------------------------------------
Aquca_009_00893.1|PACid:22033645   ............fsg------------------------------------------------
Aquca_004_00296.1|PACid:22030709   ...............-------------------------------------YIPAVFTKAHF
Aquca_014_00277.1|PACid:22029059   ...............------------------------------------------------
Aquca_004_00298.1|PACid:22029841   ...............------------------------------------------------
Aquca_009_00893.1|PACid:22033645   ...............------------------------------------------------
Aquca_028_00035.1|PACid:22038686   ...............---------------------------------------PSPFCKKHL
Aquca_056_00103.1|PACid:22060723   ...............---------------------LT---------------IPPKFSPAIV
Aquca_001_00536.1|PACid:22042974   ...............---------------------------------------PTEFCQNHL
Aquca_007_00471.1|PACid:22048590   ...............------------------------------------------------
Aquca_007_00471.2|PACid:22048589   ...............------------------------------------------------
Aquca_011_00002.2|PACid:22037838   ...............------------------------------------------------
Aquca_045_00208.1|PACid:22027238   ...............----------------LFEKVLSASDAGRIG----RLVLPKACAEAYF
Aquca_011_00002.1|PACid:22037837   ...............------------------------------------------------
Aquca_022_00154.1|PACid:22054782   ...............------------------------------------------------
Aquca_011_00001.1|PACid:22037802   ...............--------------------------------------I---------
Aquca_010_00340.1|PACid:22046572   ...............------------------------------------------------
Aquca_014_00275.1|PACid:22027716   ...............-----------------------------------GISIPRAFVKDY-
Aquca_004_00295.1|PACid:22029888   ...............------------------------------------------------
Aquca_063_00016.5|PACid:22042613   ...............----------------LFEKTLSASDAGRIG----RLVLPKKCAEAYF
Aquca_063_00016.4|PACid:22042612   ...............----------------LFEKTLSASDAGRIG----RLVLPKKCAEAYF
Aquca_011_00002.2|PACid:22037838   ...............------------------------------------------------
Aquca_007_00471.1|PACid:22048590   ...............------------------------------------------------
Aquca_007_00471.2|PACid:22048589   ...............------------------------------------------------
Aquca_052_00041.1|PACid:22061969   ...............-------------------KELRHSDVGNLG----RVVLPKRASEAFL
Aquca_011_00002.1|PACid:22037837   ...............------------------------------------------------
Aquca_063_00016.2|PACid:22042610   ...............----------------LFEKTLSASDAGRIG----RLVLPKKCAEAYF
Aquca_063_00016.3|PACid:22042611   ...............----------------LFEKTLSASDAGRIG----RLVLPKKCAEAYF
Aquca_063_00016.1|PACid:22042609   ...............----------------LFEKTLSASDAGRIG----RLVLPKKCAEAYF
Aquca_010_00344.1|PACid:22046370   ...............------------------------------------------------
Aquca_014_00276.1|PACid:22028467   ...............------------------------------------------------
Aquca_011_00001.1|PACid:22037802   ...............------------------------------------------------
Aquca_022_00154.1|PACid:22054782   ...............------------------------------------------------
Aquca_022_00155.1|PACid:22054675   ...............------------------------------------------------
Aquca_035_00050.2|PACid:22061284   ...............------------------QKELRNTDVGNLG----RIVLPKKEAEANL
Aquca_010_00338.1|PACid:22046925   ...............------------------------------------------------
Aquca_035_00050.1|PACid:22061283   ...............------------------QKELRNTDVGNLG----RIVLPKKEAEANL
Aquca_004_00155.3|PACid:22029726   ...............------------------------------------------------
Aquca_004_00155.2|PACid:22029725   ...............------------------------------------------------
Aquca_004_00155.1|PACid:22029724   ...............------------------------------------------------
Aquca_014_00282.1|PACid:22028670   ........qpgisgg------------------------------------------------
Aquca_005_00159.1|PACid:22023896   ...............------------------------------------------------
Aquca_008_00005.1|PACid:22061768   ...............----------------LFEKMLSASDAGRIG----RLVLPKRCAEAYF
Aquca_009_00848.1|PACid:22034367   ...............-------------------------------------LIPQNFARQIA
Aquca_010_00343.1|PACid:22046466   .......glrmskgl------------------------------------------------
Aquca_010_00343.2|PACid:22046464   .......glrmskgl------------------------------------------------
Aquca_010_00343.3|PACid:22046465   .......glrmskgl------------------------------------------------
Aquca_005_00157.1|PACid:22023821   ...............------------------------------------------------
Aquca_005_00157.2|PACid:22023820   ...............------------------------------------------------
Aquca_005_00533.1|PACid:22023793   ...............------------------------------------------------
Aquca_019_00028.1|PACid:22055656   ...............------------------------------------------------
Aquca_014_00275.1|PACid:22027716   ...............------------------------------------------------
Aquca_014_00276.1|PACid:22028467   ...............------------------------------------------------
Aquca_007_00470.1|PACid:22048899   ...............------------------------------------------------
Aquca_007_00470.2|PACid:22048900   ...............------------------------------------------------
Aquca_007_00470.3|PACid:22048901   ...............------------------------------------------------
Aquca_010_00338.1|PACid:22046925   ...............------------------------------------------------
Aquca_022_00154.1|PACid:22054782   ...............--------------------------------------IPRWLATKCF
Aquca_005_00543.1|PACid:22024412   ...............------------------------------------LYIQMDFADKYL
Aquca_010_00338.1|PACid:22046925   ...............------------------------------------------------
Aquca_010_00338.1|PACid:22046925   ...............------------------------------------------------
Aquca_001_00601.3|PACid:22044270   ...............------------------------------------------------
Aquca_005_00248.1|PACid:22024358   ...............------------------------------------------------
Aquca_001_00601.1|PACid:22044268   ...............---------------------------------QASVSIPKSFTVSHL
Aquca_005_00157.1|PACid:22023821   ...............---------------------------------------PRQFLESHM
Aquca_005_00157.2|PACid:22023820   ...............---------------------------------------PRQFLESHM
Aquca_001_00601.1|PACid:22044268   ...............------------------------------------------------
Aquca_005_00544.1|PACid:22024146   ...............------------------------------------LYIPMDFADTYL
Aquca_082_00029.1|PACid:22026036   ...............------------------------------------------------
Aquca_014_00300.1|PACid:22028163   ...............------------------------------------------------
Aquca_049_00035.1|PACid:22044907   ...............----------------SFRKILTESDVRDN---QARLIIHAKFAKEAI
Aquca_019_00028.1|PACid:22055656   ...............------------------------------------------------
Aquca_030_00402.1|PACid:22035692   ...............------------------------------------------------
Aquca_004_00299.1|PACid:22030696   ...............------------------------------------------------
Aquca_013_00263.1|PACid:22059509   ...............------------------------------------------------
Aquca_011_00002.2|PACid:22037838   ...............------------------------------------------------
Aquca_034_00215.1|PACid:22056829   ...............------------------------------------------------
Aquca_001_00335.1|PACid:22043371   ...............----------------CFIKLLTESDTKKTQG----------------
Aquca_003_00642.1|PACid:22049220   lilkrslkansyimk------------------------------------------------
Aquca_001_00900.1|PACid:22043661   ...............------------------RKIMTASDVGHLGALVLGI-----------
Aquca_003_00503.1|PACid:22050311   ...............------------------RKIMTASDVGHLGALVLGI-----------
Aquca_011_00094.1|PACid:22037794   ...............-------------------KVMTASDVSHYG----AVVLGREHIQ---
Aquca_011_00095.1|PACid:22037765   ...............-------------------KVMTASDVSHYG----AVVLGREHIQRHW
Aquca_056_00103.1|PACid:22060723   ...............------------------------------------------------
Aquca_014_00299.1|PACid:22028863   ...............------------------------------------------------
Aquca_004_00299.1|PACid:22030696   ...............------------------------------------------FYDSHL
Aquca_035_00050.3|PACid:22061285   ...............------------------QKELRNTDVGNLG----RIVLPKKEAEANL
Aquca_013_00315.1|PACid:22060143   ...............------------------------------------------------
Aquca_061_00064.1|PACid:22060840   ...............------------------------------------------------
Aquca_010_00343.4|PACid:22046467   ...............----------------------------------------V-------
Aquca_021_00197.3|PACid:22039430   ...............------------------------------------------------
Aquca_021_00197.1|PACid:22039429   ...............------------------------------------------------
Aquca_021_00197.2|PACid:22039428   ...............------------------------------------------------
Aquca_038_00055.1|PACid:22026856   ...............------------------------------------------------

                                     50                 60           70           80            90  
                                      |                  |            |            |             |  
d1na6a1                              PSINH...TRELNP......SVFLTAHV..SS.H.D.CP.DSEARAIYYNSAHF....GKTR.
Aquca_002_01425.3|PACid:22053109   PPL-D...FSQQPP......AQELIAR-..-D.L.H.DV.EWKFRHIFRGQ---....--PK.
Aquca_002_01425.4|PACid:22053110   PPL-D...FSQQPP......AQELIAR-..-D.L.H.DV.EWKFRHIFRGQ---....--PK.
Aquca_002_01425.2|PACid:22053108   PPL-D...FSQQPP......AQELIAR-..-D.L.H.DV.EWKFRHIFRGQ---....--PK.
Aquca_022_00246.3|PACid:22054926   PPL-D...FSQQPP......AQELIAR-..-D.L.H.GT.EWKFRHIFRGQ---....--PK.
Aquca_002_01425.1|PACid:22053107   PPL-D...FSQQPP......AQELIAR-..-D.L.H.DV.EWKFRHIFRGQ---....--PK.
Aquca_022_00246.1|PACid:22054925   PPL-D...FSQQPP......AQELIAR-..-D.L.H.GT.EWKFRHIFRGQ---....--PK.
Aquca_022_00246.2|PACid:22054924   PPL-D...FSQQPP......AQELIAR-..-D.L.H.GT.EWKFRHIFRGQ---....--PK.
Aquca_007_00393.1|PACid:22047861   PQL-D...YTVQPP......TQELVVR-..-D.L.H.NN.TWTFRHIYRGQ---....--PK.
Aquca_027_00067.1|PACid:22045407   PPL-D...YKQQRP......SQELIAK-..-D.L.H.GV.EWRFRHIYRGQ---....--PR.
Aquca_018_00174.2|PACid:22040969   PPL-D...FSMQPP......AQELTAR-..-D.L.H.DN.AWTFRHIYRGQ---....--PK.
Aquca_018_00174.1|PACid:22040968   PPL-D...FSMQPP......AQELTAR-..-D.L.H.DN.AWTFRHIYRGQ---....--PK.
Aquca_008_00175.10|PACid:22061577  PPL-D...MSQNPP......WQELVAT-..-D.L.H.GN.EWHFRHIFRGQ---....--PR.
Aquca_008_00175.7|PACid:22061574   PPL-D...MSQNPP......WQELVAT-..-D.L.H.GN.EWHFRHIFRGQ---....--PR.
Aquca_008_00175.8|PACid:22061575   PPL-D...MSQNPP......WQELVAT-..-D.L.H.GN.EWHFRHIFRGQ---....--PR.
Aquca_008_00175.9|PACid:22061576   PPL-D...MSQNPP......WQELVAT-..-D.L.H.GN.EWHFRHIFRGQ---....--PR.
Aquca_008_00175.4|PACid:22061571   PPL-D...MSQNPP......WQELVAT-..-D.L.H.GN.EWHFRHIFRGQ---....--PR.
Aquca_008_00175.5|PACid:22061572   PPL-D...MSQNPP......WQELVAT-..-D.L.H.GN.EWHFRHIFRGQ---....--PR.
Aquca_008_00175.1|PACid:22061569   PPL-D...MSQNPP......WQELVAT-..-D.L.H.GN.EWHFRHIFRGQ---....--PR.
Aquca_008_00175.2|PACid:22061568   PPL-D...MSQNPP......WQELVAT-..-D.L.H.GN.EWHFRHIFRGQ---....--PR.
Aquca_008_00175.3|PACid:22061570   PPL-D...MSQNPP......WQELVAT-..-D.L.H.GN.EWHFRHIFRGQ---....--PR.
Aquca_051_00062.1|PACid:22046115   PPL-D...YTQQRP......SQELVAK-..-D.L.H.GV.EWKFRHIYRGQ---....--PR.
Aquca_036_00025.6|PACid:22055309   PPL-D...YKQQRP......WQELSAK-..-D.L.H.GV.EWKFRHIYRGQ---....--PR.
Aquca_036_00025.7|PACid:22055310   PPL-D...YKQQRP......WQELSAK-..-D.L.H.GV.EWKFRHIYRGQ---....--PR.
Aquca_036_00025.3|PACid:22055306   PPL-D...YKQQRP......WQELSAK-..-D.L.H.GV.EWKFRHIYRGQ---....--PR.
Aquca_036_00025.4|PACid:22055307   PPL-D...YKQQRP......WQELSAK-..-D.L.H.GV.EWKFRHIYRGQ---....--PR.
Aquca_036_00025.5|PACid:22055308   PPL-D...YKQQRP......WQELSAK-..-D.L.H.GV.EWKFRHIYRGQ---....--PR.
Aquca_036_00025.2|PACid:22055305   PPL-D...YKQQRP......WQELSAK-..-D.L.H.GV.EWKFRHIYRGQ---....--PR.
Aquca_036_00025.1|PACid:22055304   PPL-D...YKQQRP......WQELSAK-..-D.L.H.GV.EWKFRHIYRGQ---....--PR.
Aquca_036_00025.8|PACid:22055311   PPL-D...YKQQRP......WQELSAK-..-D.L.H.GV.EWKFRHIYRGQ---....--PR.
Aquca_100_00036.4|PACid:22063733   PPL-D...MCRQPP......TQELVAK-..-D.L.H.GI.EWKFRHIFRGQ---....--PR.
Aquca_100_00036.1|PACid:22063730   PPL-D...MCRQPP......TQELVAK-..-D.L.H.GI.EWKFRHIFRGQ---....--PR.
Aquca_100_00036.2|PACid:22063731   PPL-D...MCRQPP......TQELVAK-..-D.L.H.GI.EWKFRHIFRGQ---....--PR.
Aquca_100_00036.3|PACid:22063732   PPL-D...MCRQPP......TQELVAK-..-D.L.H.GI.EWKFRHIFRGQ---....--PR.
Aquca_013_00067.6|PACid:22058795   PPL-D...MTQSTP......TQDLIAK-..-D.L.H.GY.EWRFKHIFRGQ---....--PR.
Aquca_013_00067.5|PACid:22058794   PPL-D...MTQSTP......TQDLIAK-..-D.L.H.GY.EWRFKHIFRGQ---....--PR.
Aquca_013_00067.2|PACid:22058791   PPL-D...MTQSTP......TQDLIAK-..-D.L.H.GY.EWRFKHIFRGQ---....--PR.
Aquca_013_00067.4|PACid:22058793   PPL-D...MTQSTP......TQDLIAK-..-D.L.H.GY.EWRFKHIFRGQ---....--PR.
Aquca_013_00067.3|PACid:22058792   PPL-D...MTQSTP......TQDLIAK-..-D.L.H.GY.EWRFKHIFRGQ---....--PR.
Aquca_013_00067.1|PACid:22058790   PPL-D...MTQSTP......TQDLIAK-..-D.L.H.GY.EWRFKHIFRGQ---....--PR.
Aquca_003_00899.1|PACid:22049393   PPL-D...LSQQPP......TQELIAK-..-D.L.H.GI.EWRFRHIYRGQ---....--PK.
Aquca_008_00175.6|PACid:22061573   PPL--...------......--ELVAT-..-D.L.H.GN.EWHFRHIFRGQ---....--PR.
Aquca_072_00063.1|PACid:22041202   PLSQR...VDSVEK......GLLLSFE-..-D.E.A.GK.LWRFRYSYWNS---....--SQ.
Aquca_002_01106.1|PACid:22052086   PL--Q...IGSISK......GMLLNFE-..-D.N.S.GK.VWRFRYSYWNS---....--SQ.
Aquca_017_00295.1|PACid:22031853   PRL-D...MTQETP......AQELVTK-..-D.L.H.GV.EWRFRHVFRGA---....--PK.
Aquca_026_00225.1|PACid:22056011   PL--Q...IGDTCK......GMLLNFE-..-D.K.G.GK.VWRFRYSYWNS---....--SQ.
Aquca_037_00291.1|PACid:22040322   PL--D...STANEK......GLLLNFE-..-D.R.C.GK.SWRFRYSYWNS---....--SQ.
Aquca_030_00152.2|PACid:22035640   PRL-D...YSADPP......VQTVLAK-..-D.V.H.GE.IWKFRHIYRGT---....--PR.
Aquca_030_00152.3|PACid:22035641   PRL-D...YSADPP......VQTVLAK-..-D.V.H.GE.IWKFRHIYRGT---....--PR.
Aquca_030_00152.1|PACid:22035639   PRL-D...YSADPP......VQTVLAK-..-D.V.H.GE.IWKFRHIYRGT---....--PR.
Aquca_009_00894.1|PACid:22034885   PKS--...------......KKEIVLQ-..-D.R.S.GK.SWFVT-------CN....PGRR.
Aquca_011_00122.1|PACid:22038526   PQVSE...GKEGEEedggd.VDDLQLPF..VD.R.Q.MK.TWKFRYCYWKS---....--SQ.
Aquca_016_00429.1|PACid:22062626   PKS-D...E-----......----TVTL..VD.E.S.GE.EWPT--VYLAR---....----.
Aquca_016_00429.2|PACid:22062627   PKS-D...E-----......----TVTL..VD.E.S.GE.EWPT--VYLAR---....----.
Aquca_142_00013.1|PACid:22063995   PQIYEeseNENENKdeggidD--LQLVF..FD.R.H.MR.SWEFRYCYWKS---....--SQ.
Aquca_007_00469.1|PACid:22047618   -----...------......--------..--.-.-.--.--------------....----.
Aquca_007_00625.2|PACid:22048373   PAKFC...SSHLPKe.....DVMMTLV-..-D.E.N.QE.EFLARFL-------....--PR.
Aquca_007_00625.1|PACid:22048372   PAKFC...SSHLPKe.....DVMMTLV-..-D.E.N.QE.EFLARFL-------....--PR.
Aquca_007_00624.1|PACid:22047882   PTKFC...ISHLPKe.....DVMMTLI-..-D.E.N.QE.ELLAKFLPRKNGLS....G---.
Aquca_010_00344.1|PACid:22046370   -----...------......--------..--.-.-.--.--------------....----.
Aquca_007_00623.1|PACid:22048688   -----...------......DVMLTLV-..-D.E.N.QE.EFSAKYLTSKTGLS....G---.
Aquca_015_00099.1|PACid:22041718   -----...------......--------..-S.E.N.GD.EYPVKYLAHKTGLS....GG--.
Aquca_095_00007.1|PACid:22042388   PRS--...------......DKEFTLI-..-D.E.D.GG.EWYTLFLAAKNGLS....GG--.
Aquca_010_00343.5|PACid:22046470   -----...------......--------..--.-.-.--.--------------....----.
Aquca_010_00343.6|PACid:22046469   -----...------......--------..--.-.-.--.--------------....----.
Aquca_010_00343.7|PACid:22046468   -----...------......--------..--.-.-.--.--------------....----.
Aquca_011_00002.1|PACid:22037837   -----...------......--------..--.-.-.--.--------------....----.
Aquca_007_00470.4|PACid:22048902   -----...------......--------..--.-.-.--.--------------....--TT.
Aquca_010_00343.4|PACid:22046467   -----...------......--------..--.-.-.--.--------------....----.
Aquca_005_00544.1|PACid:22024146   -----...------......--------..--.-.-.--.--------------....-KEK.
Aquca_010_00343.1|PACid:22046466   -----...------......--------..--.-.-.--.--------------....----.
Aquca_010_00343.2|PACid:22046464   -----...------......--------..--.-.-.--.--------------....----.
Aquca_010_00343.3|PACid:22046465   -----...------......--------..--.-.-.--.--------------....----.
Aquca_088_00008.1|PACid:22058033   PFK-F...VKQHLP......KESMNARI..VD.S.F.ER.TWTVWYKYKKG---....----.
Aquca_007_00470.1|PACid:22048899   -----...------......--------..--.-.-.--.--------------....--TT.
Aquca_007_00470.2|PACid:22048900   -----...------......--------..--.-.-.--.--------------....--TT.
Aquca_007_00470.3|PACid:22048901   -----...------......--------..--.-.-.--.--------------....--TT.
Aquca_022_00155.1|PACid:22054675   -----...------......--------..--.-.-.--.--------------....----.
Aquca_009_00894.1|PACid:22034885   -----...------......--------..--.-.A.TF.DWHVRFCKK-----....--EG.
Aquca_010_00341.1|PACid:22046423   -----...------......--------..--.-.-.--.---------Q----....----.
Aquca_001_00015.1|PACid:22042933   -----...-----P......CFSTDITI..QN.L.K.GN.IWKIR--FYCD---....--SG.
Aquca_010_00339.4|PACid:22046365   -----...------......--------..--.-.-.--.--------------....----.
Aquca_108_00003.1|PACid:22046285   PGL-D...AR---D......GISIAME-..-DiG.S.SR.IWNMRYRFWPN---....-NKS.
Aquca_010_00339.3|PACid:22046364   -----...------......--------..--.-.-.--.--------------....----.
Aquca_010_00339.2|PACid:22046363   -----...------......--------..--.-.-.--.--------------....----.
Aquca_010_00338.1|PACid:22046925   -----...------......--------..--.-.-.--.--------------....----.
Aquca_086_00041.1|PACid:22054404   -----...------......--------..--.-.-.--.--------------....----.
Aquca_010_00339.1|PACid:22046362   -----...------......--------..--.-.-.--.--------------....----.
Aquca_007_00469.1|PACid:22047618   -----...------......--------..--.-.-.--.--------------....----.
Aquca_007_00471.1|PACid:22048590   -----...------......--------..--.-.-.--.--------------....----.
Aquca_007_00471.2|PACid:22048589   -----...------......--------..--.-.-.--.--------------....----.
Aquca_009_00893.1|PACid:22033645   -----...------......--------..--.-.-.--.--------------....----.
Aquca_004_00296.1|PACid:22030709   PKR--...------......KTEVILK-..-D.R.K.GK.AWTVKF--------....SPGK.
Aquca_014_00277.1|PACid:22029059   -----...------......--------..--.-.-.--.--------------....----.
Aquca_004_00298.1|PACid:22029841   -----...------......--------..--.-.-.--.--------------....----.
Aquca_009_00893.1|PACid:22033645   -----...------......--------..--.-.-.--.--------------....----.
Aquca_028_00035.1|PACid:22038686   PDT-D...VP----......----GFTL..ID.E.D.GD.KWSTKYLAEKTSLS....GG--.
Aquca_056_00103.1|PACid:22060723   PLV--...------......DQKIDLE-..-D.S.K.GQ.RWSVQVSRLGERLV....----.
Aquca_001_00536.1|PACid:22042974   PSD--...------......DVTIVLE-..-D.E.D.GL.EY--NSVYLADRK-....----.
Aquca_007_00471.1|PACid:22048590   -----...------......--------..--.-.-.--.--------------....----.
Aquca_007_00471.2|PACid:22048589   -----...------......--------..--.-.-.--.--------------....----.
Aquca_011_00002.2|PACid:22037838   -----...------......----NVTL..RD.I.D.GG.TWHALYIIGAH---....----.
Aquca_045_00208.1|PACid:22027238   PPINQ...PEG---......---LPLRI..QD.I.K.GK.EWLFQFRFWPN---....-NNS.
Aquca_011_00002.1|PACid:22037837   -----...------......----NVTL..RD.I.D.GG.TWHALYIIGAH---....----.
Aquca_022_00154.1|PACid:22054782   -----...------......--------..--.-.-.--.--------------....----.
Aquca_011_00001.1|PACid:22037802   -----...------......--------..--.-.-.--.--------------....----.
Aquca_010_00340.1|PACid:22046572   -----...------......--------..--.-.-.--.--------------....----.
Aquca_014_00275.1|PACid:22027716   --LVG...EKCEGK......KARLRTKK..SK.K.-.--.SWIV----------....-STK.
Aquca_004_00295.1|PACid:22029888   -----...------......--------..--.-.-.--.--------------....----.
Aquca_063_00016.5|PACid:22042613   PTIS-...---QPE......GVPLKVQ-..-D.A.K.GS.EWVFQFRFWPN---....-NNS.
Aquca_063_00016.4|PACid:22042612   PTIS-...---QPE......GVPLKVQ-..-D.A.K.GS.EWVFQFRFWPN---....-NNS.
Aquca_011_00002.2|PACid:22037838   -----...------......--------..--.-.-.--.--------------....QRDR.
Aquca_007_00471.1|PACid:22048590   -----...------......--------..--.-.-.--.---VSGFVYNSTIK....GKYIs
Aquca_007_00471.2|PACid:22048589   -----...------......--------..--.-.-.--.---VSGFVYNSTIK....GKYIs
Aquca_052_00041.1|PACid:22061969   PSLAS...KE----......GVLISMD-..-D.M.D.GLrVWNFKYRYWPN---....-NNS.
Aquca_011_00002.1|PACid:22037837   -----...------......--------..--.-.-.--.--------------....QRDR.
Aquca_063_00016.2|PACid:22042610   PTIS-...---QPE......GVPLKVQ-..-D.A.K.GS.EWVFQFRFWPN---....-NNS.
Aquca_063_00016.3|PACid:22042611   PTIS-...---QPE......GVPLKVQ-..-D.A.K.GS.EWVFQFRFWPN---....-NNS.
Aquca_063_00016.1|PACid:22042609   PTIS-...---QPE......GVPLKVQ-..-D.A.K.GS.EWVFQFRFWPN---....-NNS.
Aquca_010_00344.1|PACid:22046370   -----...------......--------..--.-.-.--.--------------....----.
Aquca_014_00276.1|PACid:22028467   -----...------......--------..--.-.-.-K.PWVIH---------....--TK.
Aquca_011_00001.1|PACid:22037802   -----...---QNG......DYDVTLR-..-G.S.D.RQ.MWKVRGA-------....--GQ.
Aquca_022_00154.1|PACid:22054782   -----...------......--------..--.-.-.--.--------------....----.
Aquca_022_00155.1|PACid:22054675   -----...------......--------..--.-.-.--.---------R----....----.
Aquca_035_00050.2|PACid:22061284   PQLVA...KDG---......---LILQM..ED.MiF.SI.KWKFKYRYWPN---....--NK.
Aquca_010_00338.1|PACid:22046925   -----...------......--------..--.-.-.--.--------------....----.
Aquca_035_00050.1|PACid:22061283   PQLVA...KDG---......---LILQM..ED.MiF.SI.KWKFKYRYWPN---....--NK.
Aquca_004_00155.3|PACid:22029726   -----...------......--------..--.-.-.--.-----I--------....----.
Aquca_004_00155.2|PACid:22029725   -----...------......--------..--.-.-.--.-----I--------....----.
Aquca_004_00155.1|PACid:22029724   -----...------......--------..--.-.-.--.-----I--------....----.
Aquca_014_00282.1|PACid:22028670   -----...------......--------..--.-.-.--.--------------....----.
Aquca_005_00159.1|PACid:22023896   -----...------......--------..--.-.-.--.--------------....----.
Aquca_008_00005.1|PACid:22061768   PAI-S...QSE---......--GIPLKV..QD.A.K.GQ.EWVLHFRFWPN---....-NNS.
Aquca_009_00848.1|PACid:22034367   DNLSE...------......----VALL..VD.P.S.GS.TWHVKF----NRT-....--TD.
Aquca_010_00343.1|PACid:22046466   -----...------......--------..--.-.-.--.--------------....----.
Aquca_010_00343.2|PACid:22046464   -----...------......--------..--.-.-.--.--------------....----.
Aquca_010_00343.3|PACid:22046465   -----...------......--------..--.-.-.--.--------------....----.
Aquca_005_00157.1|PACid:22023821   -----...------......--------..--.-.-.--.--------------....----.
Aquca_005_00157.2|PACid:22023820   -----...------......--------..--.-.-.--.--------------....----.
Aquca_005_00533.1|PACid:22023793   -----...------......--------..--.-.-.--.-WKMN--YIGE---....--GL.
Aquca_019_00028.1|PACid:22055656   -----...------......--------..--.-.-.--.--------------....----.
Aquca_014_00275.1|PACid:22027716   -----...-KDTNK......SYMITIK-..-D.P.N.GK.SWKLRLNYKPS---....----.
Aquca_014_00276.1|PACid:22028467   -----...---LNK......PCMIMLK-..-D.P.E.GE.YWEVGLRHKRDCQ-....----.
Aquca_007_00470.1|PACid:22048899   -----...------......--------..--.-.-.--.------I-------....----.
Aquca_007_00470.2|PACid:22048900   -----...------......--------..--.-.-.--.------I-------....----.
Aquca_007_00470.3|PACid:22048901   -----...------......--------..--.-.-.--.------I-------....----.
Aquca_010_00338.1|PACid:22046925   -----...------......--------..--.-.-.--.--------------....----.
Aquca_022_00154.1|PACid:22054782   MEKDS...TMLLNP......--------..--.-.-.--.--------------....----.
Aquca_005_00543.1|PACid:22024412   PKR--...------......--STNACI..LD.S.S.ER.TWSVGYNYKKHRTYfskhLEGR.
Aquca_010_00338.1|PACid:22046925   -----...------......--------..--.-.-.--.--------------....----.
Aquca_010_00338.1|PACid:22046925   -----...------......--------..-D.S.N.GG.TWHAQY--KI----....--GS.
Aquca_001_00601.3|PACid:22044270   -----...------......--------..--.-.-.--.--------------....----.
Aquca_005_00248.1|PACid:22024358   -----...-----P......KHDVKMTL..ID.E.N.QE.EFVINYLW------....----.
Aquca_001_00601.1|PACid:22044268   PHVQG...LG----......SLSFTLQL..-S.D.Q.GK.KWHVECN-------....HCHR.
Aquca_005_00157.1|PACid:22023821   PEF--...----NS......SVTVTLQVanME.K.K.WL.VGCYSTCYKNS---....---R.
Aquca_005_00157.2|PACid:22023820   PEF--...----NS......SVTVTLQVanME.K.K.WL.VGCYSTCYKNS---....---R.
Aquca_001_00601.1|PACid:22044268   -----...------......--------..--.-.-.--.--------------....----.
Aquca_005_00544.1|PACid:22024146   PKE--...------......--STNVCI..MD.S.S.ER.AWPAQYSYKRYLSN....RWQRc
Aquca_082_00029.1|PACid:22026036   -----...------......--------..--.-.-.--.--HNKQIFKTE-TQ....NDRH.
Aquca_014_00300.1|PACid:22028163   -----...------......--------..--.-.-.--.--------------....----.
Aquca_049_00035.1|PACid:22044907   KPL--...------......--------..--.-.-.--.--------------....----.
Aquca_019_00028.1|PACid:22055656   -----...------......--------..--.-.-.--.-----YLYRGTD--....----.
Aquca_030_00402.1|PACid:22035692   -----...------......--------..-D.N.Y.GE.KYKME--YKRW---....-GTK.
Aquca_004_00299.1|PACid:22030696   -----...------......-----FV-..-D.H.H.SI.CAGHVLVFRYNR--....----.
Aquca_013_00263.1|PACid:22059509   -----...------......--------..--.-.-.-R.NKNWKMQYYGV---....-GYA.
Aquca_011_00002.2|PACid:22037838   -----...------......--------..--.-.-.--.--------------....----.
Aquca_034_00215.1|PACid:22056829   -----...------......--------..--.-.-.--.KKNWHMLYYGDK--....EGRS.
Aquca_001_00335.1|PACid:22043371   -----...------......--------..--.-.-.--.--------------....----.
Aquca_003_00642.1|PACid:22049220   -----...------......--------..--.-.-.--.--------------....----.
Aquca_001_00900.1|PACid:22043661   -----...------......--------..--.-.-.--.--------------....----.
Aquca_003_00503.1|PACid:22050311   -----...------......--------..--.-.-.--.--------------....----.
Aquca_011_00094.1|PACid:22037794   -----...------......--------..--.-.-.--.--------------....----.
Aquca_011_00095.1|PACid:22037765   -GL-D...WTALNR......GTQVAVT-..--.-.-.--.--------------....----.
Aquca_056_00103.1|PACid:22060723   -----...------......--------..--.-.-.--.--------------....----.
Aquca_014_00299.1|PACid:22028863   -----...------......--------..--.-.-.--.--------------....----.
Aquca_004_00299.1|PACid:22030696   KGLNH...LTLQA-......--------..-S.N.G.IA.KWHVRCLS------....--GS.
Aquca_035_00050.3|PACid:22061285   PQLVA...KDG---......---LILQM..ED.MiF.SI.KWKFKYRYWPN---....----.
Aquca_013_00315.1|PACid:22060143   -----...------......---IRVRI..WD.D.DtKD.EHELTYKYQPS---....--MT.
Aquca_061_00064.1|PACid:22060840   -----...------......--------..--.-.-.--.--------------....----.
Aquca_010_00343.4|PACid:22046467   -----...------......--------..--.-.-.--.--------------....----.
Aquca_021_00197.3|PACid:22039430   -----...------......--------..--.-.-.--.--------------....----.
Aquca_021_00197.1|PACid:22039429   -----...------......--------..--.-.-.--.--------------....----.
Aquca_021_00197.2|PACid:22039428   -----...------......--------..--.-.-.--.--------------....----.
Aquca_038_00055.1|PACid:22026856   -----...------......--------..--.-.-.--.--------------....----.

                                               100          110       120       130       140       
                                                 |            |         |         |         |       
Aquca_002_01425.3|PACid:22053109   .RHL.LT.T.GW-SV...FVSAKRLVAGDSVLFIWNEKNQL-LLGIRRASRPQT---------
Aquca_002_01425.4|PACid:22053110   .RHL.LT.T.GW-SV...FVSAKRLVAGDSVLFIWNEKNQL-LLGIRRASRPQT---------
Aquca_002_01425.2|PACid:22053108   .RHL.LT.T.GW-SV...FVSAKRLVAGDSVLFIWNEKNQL-LLGIRRASRPQT---------
Aquca_022_00246.3|PACid:22054926   .RHL.LT.T.GW-SV...FVSAKRLVAGDSVIFIWNEKNQL-HLGIRHANRPQT---------
Aquca_002_01425.1|PACid:22053107   .RHL.LT.T.GW-SV...FVSAKRLVAGDSVLFIWNEKNQL-LLGIRRASRPQT---------
Aquca_022_00246.1|PACid:22054925   .RHL.LT.T.GW-SV...FVSAKRLVAGDSVIFIWNEKNQL-HLGIRHANRPQT---------
Aquca_022_00246.2|PACid:22054924   .RHL.LT.T.GW-SV...FVSAKRLVAGDSVIFIWNEKNQL-HLGIRHANRPQT---------
Aquca_007_00393.1|PACid:22047861   .RHL.LT.T.GW-SV...FVGSKRLRAGDAVLFIRDEKSQL-LLGVRRANHQQT---------
Aquca_027_00067.1|PACid:22045407   .RHL.LT.T.GW-SI...FVSQKNLTSGDAVLFLRGEDGEL-RLGIRRTGRPRN---------
Aquca_018_00174.2|PACid:22040969   .RHL.LT.T.GW-SL...FVSGKRLFAGDSVLFIRDEKQQL-LLGIRRANRQPT---------
Aquca_018_00174.1|PACid:22040968   .RHL.LT.T.GW-SL...FVSGKRLFAGDSVLFIRDEKQQL-LLGIRRANRQPT---------
Aquca_008_00175.10|PACid:22061577  .RHL.LT.T.GW-SV...FVSSKRLVAGDAFIFLRGESGEL-RVGVRRLLRQLS---------
Aquca_008_00175.7|PACid:22061574   .RHL.LT.T.GW-SV...FVSSKRLVAGDAFIFLRGESGEL-RVGVRRLLRQLS---------
Aquca_008_00175.8|PACid:22061575   .RHL.LT.T.GW-SV...FVSSKRLVAGDAFIFLRGESGEL-RVGVRRLLRQLS---------
Aquca_008_00175.9|PACid:22061576   .RHL.LT.T.GW-SV...FVSSKRLVAGDAFIFLRGESGEL-RVGVRRLLRQLS---------
Aquca_008_00175.4|PACid:22061571   .RHL.LT.T.GW-SV...FVSSKRLVAGDAFIFLRGESGEL-RVGVRRLLRQLS---------
Aquca_008_00175.5|PACid:22061572   .RHL.LT.T.GW-SV...FVSSKRLVAGDAFIFLRGESGEL-RVGVRRLLRQLS---------
Aquca_008_00175.1|PACid:22061569   .RHL.LT.T.GW-SV...FVSSKRLVAGDAFIFLRGESGEL-RVGVRRLLRQLS---------
Aquca_008_00175.2|PACid:22061568   .RHL.LT.T.GW-SV...FVSSKRLVAGDAFIFLRGESGEL-RVGVRRLLRQLS---------
Aquca_008_00175.3|PACid:22061570   .RHL.LT.T.GW-SV...FVSSKRLVAGDAFIFLRGESGEL-RVGVRRLLRQLS---------
Aquca_051_00062.1|PACid:22046115   .RHL.LT.T.GW-SA...FVNRKKLVSGDAVLFLRGEDGEL-RLGIRRA--------------
Aquca_036_00025.6|PACid:22055309   .RHL.LT.T.GW-SA...FVNKKKLVSGDAVLFLRGDNGDL-KLGIRR---------------
Aquca_036_00025.7|PACid:22055310   .RHL.LT.T.GW-SA...FVNKKKLVSGDAVLFLRGDNGDL-KLGIRR---------------
Aquca_036_00025.3|PACid:22055306   .RHL.LT.T.GW-SA...FVNKKKLVSGDAVLFLRGDNGDL-KLGIRR---------------
Aquca_036_00025.4|PACid:22055307   .RHL.LT.T.GW-SA...FVNKKKLVSGDAVLFLRGDNGDL-KLGIRR---------------
Aquca_036_00025.5|PACid:22055308   .RHL.LT.T.GW-SA...FVNKKKLVSGDAVLFLRGDNGDL-KLGIRR---------------
Aquca_036_00025.2|PACid:22055305   .RHL.LT.T.GW-SA...FVNKKKLVSGDAVLFLRGDNGDL-KLGIRR---------------
Aquca_036_00025.1|PACid:22055304   .RHL.LT.T.GW-SA...FVNKKKLVSGDAVLFLRGDNGDL-KLGIRR---------------
Aquca_036_00025.8|PACid:22055311   .RHL.LT.T.GW-SA...FVNKKKLVSGDAVLFLRGDNGDL-KLGIRR---------------
Aquca_100_00036.4|PACid:22063733   .RHL.LQ.S.GW-SV...FVSSKRLVAGDAFIFLRGENGEL-RVGVRRALRQQS---------
Aquca_100_00036.1|PACid:22063730   .RHL.LQ.S.GW-SV...FVSSKRLVAGDAFIFLRGENGEL-RVGVRRALRQQS---------
Aquca_100_00036.2|PACid:22063731   .RHL.LQ.S.GW-SV...FVSSKRLVAGDAFIFLRGENGEL-RVGVRRALRQQS---------
Aquca_100_00036.3|PACid:22063732   .RHL.LQ.S.GW-SV...FVSSKRLVAGDAFIFLRGENGEL-RVGVRRALRQQS---------
Aquca_013_00067.6|PACid:22058795   .RHL.LT.T.GW-ST...FVTSKRLVAGDAFVFLRGENGDL-RVGVRRLARQPS---------
Aquca_013_00067.5|PACid:22058794   .RHL.LT.T.GW-ST...FVTSKRLVAGDAFVFLRGENGDL-RVGVRRLARQPS---------
Aquca_013_00067.2|PACid:22058791   .RHL.LT.T.GW-ST...FVTSKRLVAGDAFVFLRGENGDL-RVGVRRLARQPS---------
Aquca_013_00067.4|PACid:22058793   .RHL.LT.T.GW-ST...FVTSKRLVAGDAFVFLRGENGDL-RVGVRRLARQPS---------
Aquca_013_00067.3|PACid:22058792   .RHL.LT.T.GW-ST...FVTSKRLVAGDAFVFLRGENGDL-RVGVRRLARQPS---------
Aquca_013_00067.1|PACid:22058790   .RHL.LT.T.GW-ST...FVTSKRLVAGDAFVFLRGENGDL-RVGVRRLARQPS---------
Aquca_003_00899.1|PACid:22049393   .RHL.LT.S.GW-ST...FVSAKKLVTGDAFIFLRGENGEL-RVGVRRAMKPNN---------
Aquca_008_00175.6|PACid:22061573   .RHL.LT.T.GW-SV...FVSSKRLVAGDAFIFLRGESGEL-RVGVRRLLRQLS---------
Aquca_072_00063.1|PACid:22041202   .SYV.LT.K.GW-SR...FVKEKQLDAGDVVSFERRRHDGQQ---------------------
Aquca_002_01106.1|PACid:22052086   .SYV.LT.K.GW-SR...FVKEKCLKAGDVISFQRSSGQDK----------------------
Aquca_026_00225.1|PACid:22056011   .SYV.LT.K.GW-SR...FVKEKRLQAGDVVSFLRSI--------------------------
Aquca_037_00291.1|PACid:22040322   .SYV.MT.K.GW-SR...FVKEKKLYAGDIVSFERGA--------------------------
Aquca_030_00152.2|PACid:22035640   .RHL.LT.T.GW-ST...FVNQKKLIAGDSIVFLRTENGDL-CVGIRRA--------------
Aquca_030_00152.3|PACid:22035641   .RHL.LT.T.GW-ST...FVNQKKLIAGDSIVFLRTENGDL-CVGIRRA--------------
Aquca_030_00152.1|PACid:22035639   .RHL.LT.T.GW-ST...FVNQKKLIAGDSIVFLRTENGDL-CVGIRRA--------------
Aquca_009_00894.1|PACid:22034885   .QYT.FC.G.GW-TC...FVNENQLNAGDVCVFELI---------------------------
Aquca_011_00122.1|PACid:22038526   .SYV.FT.R.GW-NR...FVKEKELKAKDVITFYLCEHR------------------------
Aquca_016_00429.1|PACid:22062626   .KTG.LS.G.GW-MG...FSRDHKLVDGDALVFELVKP-------------------------
Aquca_016_00429.2|PACid:22062627   .KTG.LS.G.GW-MG...FSRDHKLVDGDALVFELVKP-------------------------
Aquca_142_00013.1|PACid:22063995   .SYV.FT.K.GW-NR...FVKEKELKTKDVVTFY-----------------------------
Aquca_007_00469.1|PACid:22047618   .GMY.LE.D.GW-GK...FARAHSLEKGEFLVFRYDGNT------------------------
Aquca_007_00625.2|PACid:22048373   .KTG.LS.S.GW-KG...FSIAHKLVEGDVLVFHLIKD-------------------------
Aquca_007_00625.1|PACid:22048372   .KTG.LS.S.GW-KG...FSIAHKLVEGDVLVFHLIKD-------------------------
Aquca_007_00624.1|PACid:22047882   .---.--.-.GW-KG...FSIAHKLVEGDVLVFHLIKDT------------------------
Aquca_010_00344.1|PACid:22046370   .---.--.S.GW-QE...FVKMHSLVVGEFLVFRYDGNS------------------------
Aquca_007_00623.1|PACid:22048688   .---.--.-.GW-RG...FSLAHRLVEGDALVFHLIKD-------------------------
Aquca_015_00099.1|PACid:22041718   .---.--.-.-W-RG...FSILHKLVEGDVLVFHIIKS-------------------------
Aquca_095_00007.1|PACid:22042388   .---.--.-.-W-RG...FSIAHELVDGDALVFELVEP-------------------------
Aquca_010_00343.5|PACid:22046470   .---.--.-.GW-KD...FVEYHSIHAGHVLIFR-----------------------------
Aquca_010_00343.6|PACid:22046469   .---.--.-.GW-KD...FVEYHSIHAGHVLIFR-----------------------------
Aquca_010_00343.7|PACid:22046468   .---.--.-.GW-KD...FVEYHSIHAGHVLIFR-----------------------------
Aquca_011_00002.1|PACid:22037837   .---.--.-.EW-RS...FVKDNTLEFGDFLVFTYNGKSEF----------------------
Aquca_007_00470.4|PACid:22048902   .GMY.LE.D.GW-GS...FSRAHSLSVGKFLVFGYD---------------------------
Aquca_010_00343.4|PACid:22046467   .---.--.-.GW-KD...FVEYHSIHAGHVLIFR-----------------------------
Aquca_005_00544.1|PACid:22024146   .NEF.FL.CeGW-TI...FVKDNSLEFGDFLVFRSL---------------------------
Aquca_010_00343.1|PACid:22046466   .---.--.-.GW-KD...FVEYHSIHAGHVLIFR-----------------------------
Aquca_010_00343.2|PACid:22046464   .---.--.-.GW-KD...FVEYHSIHAGHVLIFR-----------------------------
Aquca_010_00343.3|PACid:22046465   .---.--.-.GW-KD...FVEYHSIHAGHVLIFR-----------------------------
Aquca_088_00008.1|PACid:22058033   .RSL.LY.T.GW-NS...FWLGNELKEGDVCAFELIDKE------------------------
Aquca_007_00470.1|PACid:22048899   .GMY.LE.D.GW-GS...FSRAHSLSVGKFLVFGYD---------------------------
Aquca_007_00470.2|PACid:22048900   .GMY.LE.D.GW-GS...FSRAHSLSVGKFLVFGYD---------------------------
Aquca_007_00470.3|PACid:22048901   .GMY.LE.D.GW-GS...FSRAHSLSVGKFLVFGYD---------------------------
Aquca_022_00155.1|PACid:22054675   .---.--.-.GW-HR...FMEYHSISVGHFLVFRYDGNSQ-----------------------
Aquca_009_00894.1|PACid:22034885   .GTY.LT.E.GW-KE...FVRDNA---------------------------------------
Aquca_010_00341.1|PACid:22046423   .---.--.-.-----...---------------------------------------------
Aquca_001_00015.1|PACid:22042933   .MHM.FT.N.GW-KV...FALDNALRKGDHCEFELVDE-------------------------
Aquca_010_00339.4|PACid:22046365   .---.--.-.-W-PN...FAKDNALEFGDLLVFIYNGNSEF----------------------
Aquca_108_00003.1|PACid:22046285   .RMY.LL.E.NT-GE...FVRSNGLQEGDFIVIYSDT--------------------------
Aquca_010_00339.3|PACid:22046364   .---.--.-.-W-PN...FAKDNALEFGDLLVFIYNGNSEF----------------------
Aquca_010_00339.2|PACid:22046363   .---.--.-.-W-PN...FAKDNALEFGDLLVFIYNGNSEF----------------------
Aquca_010_00338.1|PACid:22046925   .---.LA.N.GW-KT...FAEDYALELGEFVVFR-----------------------------
Aquca_086_00041.1|PACid:22054404   .---.--.-.GW-KG...FAVAHKLVERDALVF------------------------------
Aquca_010_00339.1|PACid:22046362   .---.--.-.-W-PN...FAKDNALEFGDLLVFIYNGNSEF----------------------
Aquca_007_00469.1|PACid:22047618   .--Y.--.-.-----...---------------------------------------------
Aquca_007_00471.1|PACid:22048590   .---.--.-.-W-QE...FVDYYSISTGHFLVF------------------------------
Aquca_007_00471.2|PACid:22048589   .---.--.-.-W-QE...FVDYYSISTGHFLVF------------------------------
Aquca_009_00893.1|PACid:22033645   .---.--.-.GW-PT...FVLDNQLEAGDICIFEL----------------------------
Aquca_004_00296.1|PACid:22030709   .ENY.FF.G.GW-PA...FVHDNKLKAGDTCIFELV---------------------------
Aquca_014_00277.1|PACid:22029059   .---.--.-.-W-DD...FSTAHDLQDGDFLVFK-----------------------------
Aquca_004_00298.1|PACid:22029841   .---.--.-.-----...-------------L-------------------------------
Aquca_009_00893.1|PACid:22033645   .--M.FL.T.D--GW...KDFVRDHSLGKYDFLVF----------------------------
Aquca_028_00035.1|PACid:22038686   .---.--.-.-W-RG...FAIAHKLVHGDALIFEL----------------------------
Aquca_056_00103.1|PACid:22060723   .---.FQ.N.GW-DQ...FASDHFLETGDFLVFSYFIGSHF----------------------
Aquca_001_00536.1|PACid:22042974   .--G.LS.G.GW-RA...FALAHKLDDGDALVFELTEPR------------------------
Aquca_007_00471.1|PACid:22048590   .---.--.-.GW-KM...FVKENSLKVGDVCVFEMIK--------------------------
Aquca_007_00471.2|PACid:22048589   .---.--.-.GW-KM...FVKENSLKVGDVCVFEMIK--------------------------
Aquca_011_00002.2|PACid:22037838   .-HK.LV.R.GW-NA...FVLDNHLKEDDVC--------------------------------
Aquca_045_00208.1|PACid:22027238   .RMY.VL.E.GV-TP...CIQSMQLQAGDTVTFSRLDPEGKLVMGFR----------------
Aquca_011_00002.1|PACid:22037837   .-HK.LV.R.GW-NA...FVLDNHLKEDDVC--------------------------------
Aquca_022_00154.1|PACid:22054782   .---.--.-.GW-KE...FVVANHLKEGDVCKFELVDSNHM----------------------
Aquca_011_00001.1|PACid:22037802   .---.--.-.-----...---------------------------------------------
Aquca_010_00340.1|PACid:22046572   .HHK.LV.R.GW-NA...FV-------------------------------------------
Aquca_014_00275.1|PACid:22027716   .GCC.FT.D.GW-EN...FHNENDLHAGDFLLFEH----------------------------
Aquca_004_00295.1|PACid:22029888   .---.--.-.-----...QNFLRDHSLGNYEVLVFRYNGDM----------------------
Aquca_063_00016.5|PACid:22042613   .RMY.VL.E.GV-TP...CIQNMSLQAGDIVTFSRLDPDG-----------------------
Aquca_063_00016.4|PACid:22042612   .RMY.VL.E.GV-TP...CIQNMSLQAGDIVTFSRLDPDG-----------------------
Aquca_011_00002.2|PACid:22037838   .ETT.LT.S.GW-AN...FRVANKINIGDTCLFEFIE--------------------------
Aquca_007_00471.1|PACid:22048590   tNVH.LS.K.GW-QK...FVRENNLREGDVCVFEM----------------------------
Aquca_007_00471.2|PACid:22048589   tNVH.LS.K.GW-QK...FVRENNLREGDVCVFEM----------------------------
Aquca_052_00041.1|PACid:22061969   .RMY.VL.E.NT-GD...FIRTHELQTGDYLMLYKDDRNQKYV--------------------
Aquca_011_00002.1|PACid:22037837   .ETT.LT.S.GW-AN...FRVANKINIGDTCLFEFIE--------------------------
Aquca_063_00016.2|PACid:22042610   .RMY.VL.E.GV-TP...CIQNMSLQAGDIVTFSRLDPDG-----------------------
Aquca_063_00016.3|PACid:22042611   .RMY.VL.E.GV-TP...CIQNMSLQAGDIVTFSRLDPDG-----------------------
Aquca_063_00016.1|PACid:22042609   .RMY.VL.E.GV-TP...CIQNMSLQAGDIVTFSRLDPDG-----------------------
Aquca_010_00344.1|PACid:22046370   .---.--.-.-----...---------------------------------------------
Aquca_014_00276.1|PACid:22028467   .GCC.FT.D.GW-ED...FAREHDLRVGDLLLFRHE---------------------------
Aquca_011_00001.1|PACid:22037802   .PQFrLR.A.GW-KE...FVLDNGLEEDDICIFEIVSM-------------------------
Aquca_022_00154.1|PACid:22054782   .---.--.-.E----...---------------------------------------------
Aquca_022_00155.1|PACid:22054675   .---.--.-.-----...---------------------------------------------
Aquca_035_00050.2|PACid:22061284   .SRM.YV.M.ENTGD...FVRTHNLQTGDFFIVYK----------------------------
Aquca_010_00338.1|PACid:22046925   .-TF.LT.A.GW-PA...FCKANRLNTNDTCHFQF----------------------------
Aquca_035_00050.1|PACid:22061283   .SRM.YV.M.ENTGD...FVRTHNLQTGDFFIVYK----------------------------
Aquca_004_00155.3|PACid:22029726   .---.--.-.-----...---------------------------------------------
Aquca_004_00155.2|PACid:22029725   .---.--.-.-----...---------------------------------------------
Aquca_004_00155.1|PACid:22029724   .---.--.-.-----...---------------------------------------------
Aquca_014_00282.1|PACid:22028670   .---.--.-.-W-AD...FVMENNLEKGDACLFE-----------------------------
Aquca_005_00159.1|PACid:22023896   .---.--.-.-----...-------------V-------------------------------
Aquca_008_00005.1|PACid:22061768   .RMY.VL.E.GV-TP...CIQSMQLQAGDTVTFSRIDP-------------------------
Aquca_009_00848.1|PACid:22034367   .GTY.LE.D.GW-EI...FSIDHSLSRGECLLFEY----------------------------
Aquca_010_00343.1|PACid:22046466   .---.--.-.---SS...FIAENKIQIGDICVF------------------------------
Aquca_010_00343.2|PACid:22046464   .---.--.-.---SS...FIAENKIQIGDICVF------------------------------
Aquca_010_00343.3|PACid:22046465   .---.--.-.---SS...FIAENKIQIGDICVF------------------------------
Aquca_005_00157.1|PACid:22023821   .---.--.-.-N---...---------------------------------------------
Aquca_005_00157.2|PACid:22023820   .---.--.-.-N---...---------------------------------------------
Aquca_005_00533.1|PACid:22023793   .SHK.RFdS.GW-KN...FVIDNNLKVGDGCVFELSEC-------------------------
Aquca_019_00028.1|PACid:22055656   .---.--.-.-W-KE...FVEHYSICAGHYLVFRYNRKS------------------------
Aquca_014_00275.1|PACid:22027716   .--A.NV.A.CFGSGwpeFRKANKLKVGDVCTFMVV---------------------------
Aquca_014_00276.1|PACid:22028467   .-AY.IG.R.GW-ST...FLYANRMKVGDVCT-------------------------------
Aquca_007_00470.1|PACid:22048899   .---.--.-.-----...---------------------------------------------
Aquca_007_00470.2|PACid:22048900   .---.--.-.-----...---------------------------------------------
Aquca_007_00470.3|PACid:22048901   .---.--.-.-----...---------------------------------------------
Aquca_010_00338.1|PACid:22046925   .---.--.-.----W...---------------------------------------------
Aquca_022_00154.1|PACid:22054782   .---.--.-.-----...---------------------------------------------
Aquca_005_00543.1|PACid:22024412   .RAC.FN.R.GW-KE...VVVANELKEGYVCAFEL----------------------------
Aquca_010_00338.1|PACid:22046925   .---.--.-.-W-PI...FAKDNALEFGDLLVFIYNGN-------------------------
Aquca_010_00338.1|PACid:22046925   .HHK.LN.M.GW-KT...FVFDNHLKECDVCIFELVDE-------------------------
Aquca_001_00601.3|PACid:22044270   .---.--.-.-----...------------W--------------------------------
Aquca_005_00248.1|PACid:22024358   .---.--.-.-----...---------------------------------------------
Aquca_001_00601.1|PACid:22044268   .GVW.RI.T.K--GF...FP-------------------------------------------
Aquca_005_00157.1|PACid:22023821   .SWR.MS.K.GL-GK...FLRENSIKIGDSCVFELIDKENVV---------------------
Aquca_005_00157.2|PACid:22023820   .SWR.MS.K.GL-GK...FLRENSIKIGDSCVFELIDKENVV---------------------
Aquca_001_00601.1|PACid:22044268   .---.--.-.-----...------------W--------------------------------
Aquca_005_00544.1|PACid:22024146   .RAC.LS.K.GW-KA...LVVANKLREGYVCAFELIEVEN-----------------------
Aquca_082_00029.1|PACid:22026036   .DHL.KF.T.KGWRD...FVRALNLKEGDSCVFE-----------------------------
Aquca_014_00300.1|PACid:22028163   .---.--.-.GW-AL...FVVENSLEENDLLVFTFNESTSCFD--------------------
Aquca_049_00035.1|PACid:22044907   .---.--.-.-----...---------------------------------------------
Aquca_019_00028.1|PACid:22055656   .--L.RM.S.KGLSL...FMLENNIQIGDVCYFELIKK-------------------------
Aquca_030_00402.1|PACid:22035692   .AHV.LH.-.-----...---------------------------------------------
Aquca_004_00299.1|PACid:22030696   .---.--.-.-----...---------------------------------------------
Aquca_013_00263.1|PACid:22059509   .HQK.FD.S.GW-KN...FSIDNKLNVGDGCVFELTE--------------------------
Aquca_011_00002.2|PACid:22037838   .---.--.-.EW-RS...FVKDNTLEFGDFLVFTYNGKSEF-S--------------------
Aquca_034_00215.1|PACid:22056829   .RYF.DS.V.GW-RK...FVTDNELKIGDGCTFELI---------------------------
Aquca_001_00335.1|PACid:22043371   .---.--.-.-----...---------------------------------------------
Aquca_003_00642.1|PACid:22049220   .---.--.S.NWIKS...FVQRRKLKEGDEIGMFWDPSE------------------------
Aquca_001_00900.1|PACid:22043661   .---.--.-.-----...---------------------------------------------
Aquca_003_00503.1|PACid:22050311   .---.--.-.-----...---------------------------------------------
Aquca_011_00094.1|PACid:22037794   .---.--.-.-----...---------------------------------------------
Aquca_011_00095.1|PACid:22037765   .---.--.-.-----...---------------------------------------------
Aquca_056_00103.1|PACid:22060723   .---.--.-.-W-AL...VAKANNIREGDQCIFAID---------------------------
Aquca_014_00299.1|PACid:22028863   .---.--.-.GW-RD...FVMDNNLEAGDACLFEL----------------------------
Aquca_004_00299.1|PACid:22030696   .GHM.RM.T.GV-AA...FIVESNIKVGNICFFQLINKEK-----------------------
Aquca_035_00050.3|PACid:22061285   .---.--.-.-----...---------------------------------------------
Aquca_013_00315.1|PACid:22060143   .EYV.FI.S.NWQHS...FVRRRQLQVGEEIGMFWDPKDEV----------------------
Aquca_061_00064.1|PACid:22060840   .---.--.-.-----...-----------KKILRS----------------------------
Aquca_010_00343.4|PACid:22046467   .---.--.-.-----...---------------------------------------------
Aquca_021_00197.3|PACid:22039430   .---.--.-.-----...---------------------------------------------
Aquca_021_00197.1|PACid:22039429   .---.--.-.-----...---------------------------------------------
Aquca_021_00197.2|PACid:22039428   .---.--.-.-----...---------------------------------------------
Aquca_038_00055.1|PACid:22026856   .---.--.-.-----...---------------------------------------------

                                     150       160       170                                        
                                       |         |         |                                        
d1na6a1                              AIGEVIPGALISGPAGQILGGLSLQQ--ap.................................
Aquca_002_01425.3|PACid:22053109   ----VMPSSVLSSDSMHIGLLAAAAH--a..................................
Aquca_002_01425.4|PACid:22053110   ----VMPSSVLSSDSMHIGLLAAAAH--a..................................
Aquca_002_01425.2|PACid:22053108   ----VMPSSVLSSDSMHIGLLAAAAH--a..................................
Aquca_022_00246.3|PACid:22054926   ----MMPSSVLSSDSMHIGLLAAAAH--a..................................
Aquca_002_01425.1|PACid:22053107   ----VMPSSVLSSDSMHIGLLAAAAH--a..................................
Aquca_022_00246.1|PACid:22054925   ----MMPSSVLSSDSMHIGLLAAAAH--a..................................
Aquca_022_00246.2|PACid:22054924   ----MMPSSVLSSDSMHIGLLAAAAH--a..................................
Aquca_007_00393.1|PACid:22047861   ----TLPSSVLSADSMHIGVLAAAAH--a..................................
Aquca_027_00067.1|PACid:22045407   ----SLPNSILSSQNVHL----------ni.................................
Aquca_018_00174.2|PACid:22040969   ----NISSSVLSSDSMHIGILAAAAH--a..................................
Aquca_018_00174.1|PACid:22040968   ----NISSSVLSSDSMHIGILAAAAH--a..................................
Aquca_008_00175.10|PACid:22061577  ----NMPSSVISSHSMHLGVLATASH--a..................................
Aquca_008_00175.7|PACid:22061574   ----NMPSSVISSHSMHLGVLATASH--a..................................
Aquca_008_00175.8|PACid:22061575   ----NMPSSVISSHSMHLGVLATASH--a..................................
Aquca_008_00175.9|PACid:22061576   ----NMPSSVISSHSMHLGVLATASH--a..................................
Aquca_008_00175.4|PACid:22061571   ----NMPSSVISSHSMHLGVLATASH--a..................................
Aquca_008_00175.5|PACid:22061572   ----NMPSSVISSHSMHLGVLATASH--a..................................
Aquca_008_00175.1|PACid:22061569   ----NMPSSVISSHSMHLGVLATASH--a..................................
Aquca_008_00175.2|PACid:22061568   ----NMPSSVISSHSMHLGVLATASH--a..................................
Aquca_008_00175.3|PACid:22061570   ----NMPSSVISSHSMHLGVLATASH--a..................................
Aquca_051_00062.1|PACid:22046115   ----------------------------pqykg..............................
Aquca_036_00025.6|PACid:22055309   ----------------------------aaqv...............................
Aquca_036_00025.7|PACid:22055310   ----------------------------aaqv...............................
Aquca_036_00025.3|PACid:22055306   ----------------------------aaqv...............................
Aquca_036_00025.4|PACid:22055307   ----------------------------aaqv...............................
Aquca_036_00025.5|PACid:22055308   ----------------------------aaqv...............................
Aquca_036_00025.2|PACid:22055305   ----------------------------aaqv...............................
Aquca_036_00025.1|PACid:22055304   ----------------------------aaqv...............................
Aquca_036_00025.8|PACid:22055311   ----------------------------aaqv...............................
Aquca_100_00036.4|PACid:22063733   ----NVPSSVISSHSMHLGVLATAWH--a..................................
Aquca_100_00036.1|PACid:22063730   ----NVPSSVISSHSMHLGVLATAWH--a..................................
Aquca_100_00036.2|PACid:22063731   ----NVPSSVISSHSMHLGVLATAWH--a..................................
Aquca_100_00036.3|PACid:22063732   ----NVPSSVISSHSMHLGVLATAWH--a..................................
Aquca_013_00067.6|PACid:22058795   ----CMPSSVISSQSMHLGVLATASH--a..................................
Aquca_013_00067.5|PACid:22058794   ----CMPSSVISSQSMHLGVLATASH--a..................................
Aquca_013_00067.2|PACid:22058791   ----CMPSSVISSQSMHLGVLATASH--a..................................
Aquca_013_00067.4|PACid:22058793   ----CMPSSVISSQSMHLGVLATASH--a..................................
Aquca_013_00067.3|PACid:22058792   ----CMPSSVISSQSMHLGVLATASH--a..................................
Aquca_013_00067.1|PACid:22058790   ----CMPSSVISSQSMHLGVLATASH--a..................................
Aquca_003_00899.1|PACid:22049393   ----NASPSVLSNHSMQLGVLA------sash...............................
Aquca_008_00175.6|PACid:22061573   ----NMPSSVISSHSMHLGVLATASH--a..................................
Aquca_072_00063.1|PACid:22041202   ----------------------------lyirwrrr...........................
Aquca_002_01106.1|PACid:22052086   ----------------------------qlyidwkar..........................
Aquca_017_00295.1|PACid:22031853   -------MSVLTSHSMQIGV--------vatayh.............................
Aquca_026_00225.1|PACid:22056011   ----------------------------gg.................................
Aquca_037_00291.1|PACid:22040322   ----------------------------ges................................
Aquca_030_00152.2|PACid:22035640   ----------------------------kr.................................
Aquca_030_00152.3|PACid:22035641   ----------------------------kr.................................
Aquca_030_00152.1|PACid:22035639   ----------------------------kr.................................
Aquca_009_00894.1|PACid:22034885   ----------------------------gymklrvyifrvn......................
Aquca_011_00122.1|PACid:22038526   ----------------------------ehp................................
Aquca_016_00429.1|PACid:22062626   ----------------------------tefkvyiikv.........................
Aquca_016_00429.2|PACid:22062627   ----------------------------tefkvyiikv.........................
Aquca_142_00013.1|PACid:22063995   ----------------------------kceq...............................
Aquca_007_00469.1|PACid:22047618   ----------------------------kftvqifdss.........................
Aquca_007_00625.2|PACid:22048373   ----------------------------tkfqvyilra.........................
Aquca_007_00625.1|PACid:22048372   ----------------------------tkfqvyilra.........................
Aquca_007_00624.1|PACid:22047882   ----------------------------kfqvyiira..........................
Aquca_010_00344.1|PACid:22046370   ----------------------------tfevklydhsgc.......................
Aquca_007_00623.1|PACid:22048688   ----------------------------tkfqvyivr..........................
Aquca_015_00099.1|PACid:22041718   ----------------------------tsfkvyiiren........................
Aquca_095_00007.1|PACid:22042388   ----------------------------tkfkvipkc..........................
Aquca_010_00343.5|PACid:22046470   ----------------------------ydgkscfyviicd......................
Aquca_010_00343.6|PACid:22046469   ----------------------------ydgkscfyviicd......................
Aquca_010_00343.7|PACid:22046468   ----------------------------ydgkscfyviicd......................
Aquca_011_00002.1|PACid:22037837   ----------------------------svtifgsdacekv......................
Aquca_007_00470.4|PACid:22048902   ----------------------------gnmtftvqifdss......................
Aquca_010_00343.4|PACid:22046467   ----------------------------ydgkscfyviicd......................
Aquca_005_00544.1|PACid:22024146   ----------------------------ggskfnvriygkhcc....................
Aquca_010_00343.1|PACid:22046466   ----------------------------ydgkscfyviicd......................
Aquca_010_00343.2|PACid:22046464   ----------------------------ydgkscfyviicd......................
Aquca_010_00343.3|PACid:22046465   ----------------------------ydgkscfyviicd......................
Aquca_088_00008.1|PACid:22058033   ----------------------------kiklrvs............................
Aquca_007_00470.1|PACid:22048899   ----------------------------gnmtftvqifdss......................
Aquca_007_00470.2|PACid:22048900   ----------------------------gnmtftvqifdss......................
Aquca_007_00470.3|PACid:22048901   ----------------------------gnmtftvqifdss......................
Aquca_022_00155.1|PACid:22054675   ----------------------------fsvvildtraseieyp...................
Aquca_009_00894.1|PACid:22034885   ----------------------------lgkyefvvfrhrgnmcfhveiyaksgc........
Aquca_010_00341.1|PACid:22046423   ----------------------------ngwhefmkyhsitywhllvfkydgnshfnvvifdk
Aquca_001_00015.1|PACid:22042933   ----------------------------ckmlcqifrv.........................
Aquca_010_00339.4|PACid:22046365   ----------------------------dvkifgsnac.........................
Aquca_108_00003.1|PACid:22046285   ----------------------------kcgky..............................
Aquca_010_00339.3|PACid:22046364   ----------------------------dvkifgsnac.........................
Aquca_010_00339.2|PACid:22046363   ----------------------------dvkifgsnac.........................
Aquca_010_00338.1|PACid:22046925   ----------------------------ykgdnafsvkvfgknac..................
Aquca_086_00041.1|PACid:22054404   ----------------------------qlikattfqvhiir.....................
Aquca_010_00339.1|PACid:22046362   ----------------------------dvkifgsnac.........................
Aquca_007_00469.1|PACid:22047618   ----------------------------qlcegwkhfkeeinlnvgnicvfemirartfllk.
Aquca_007_00471.1|PACid:22048590   ----------------------------kyignstfrvfifdttcseigyp............
Aquca_007_00471.2|PACid:22048589   ----------------------------kyignstfrvfifdttcseigyp............
Aquca_009_00893.1|PACid:22033645   ----------------------------tgkwrmrihifr.......................
Aquca_004_00296.1|PACid:22030709   ----------------------------gklklrvhtir........................
Aquca_014_00277.1|PACid:22029059   ----------------------------hegdltfyvtvfdpsec..................
Aquca_004_00298.1|PACid:22029841   ----------------------------kvrgcmawrvelrkvdgfacfqngwkefvehysic
Aquca_009_00893.1|PACid:22033645   ----------------------------ryegnmyftvaifdqtgc.................
Aquca_028_00035.1|PACid:22038686   ----------------------------vkrttfkvtvi........................
Aquca_056_00103.1|PACid:22060723   ----------------------------ivqiycrsgc.........................
Aquca_001_00536.1|PACid:22042974   ----------------------------rleiyifk...........................
Aquca_007_00471.1|PACid:22048590   ----------------------------halwkvhisrk........................
Aquca_007_00471.2|PACid:22048589   ----------------------------halwkvhisrk........................
Aquca_011_00002.2|PACid:22037838   ----------------------------nfelvdgnrn.........................
Aquca_045_00208.1|PACid:22027238   ----------------------------ksas...............................
Aquca_011_00002.1|PACid:22037837   ----------------------------nfelvdgnrn.........................
Aquca_022_00154.1|PACid:22054782   ----------------------------elmvs..............................
Aquca_011_00001.1|PACid:22037802   ----------------------------pnkfirifgkelsdiallkvpssskewrvdvkkde
Aquca_010_00340.1|PACid:22046572   ----------------------------ldnhlkeddvcnfelvdgnrn..............
Aquca_014_00275.1|PACid:22027716   ----------------------------kggftfdvlvfddsmc...................
Aquca_004_00295.1|PACid:22029888   ----------------------------cfdvqifdkt.........................
Aquca_063_00016.5|PACid:22042613   ----------------------------klvm...............................
Aquca_063_00016.4|PACid:22042612   ----------------------------klvm...............................
Aquca_011_00002.2|PACid:22037838   ----------------------------glgdalrvyifrts.....................
Aquca_007_00471.1|PACid:22048590   ----------------------------ikgtlwkvhisrks.....................
Aquca_007_00471.2|PACid:22048589   ----------------------------ikgtlwkvhisrks.....................
Aquca_052_00041.1|PACid:22061969   ----------------------------irgr...............................
Aquca_011_00002.1|PACid:22037837   ----------------------------glgdalrvyifrts.....................
Aquca_063_00016.2|PACid:22042610   ----------------------------klvm...............................
Aquca_063_00016.3|PACid:22042611   ----------------------------klvm...............................
Aquca_063_00016.1|PACid:22042609   ----------------------------klvm...............................
Aquca_010_00344.1|PACid:22046370   -------------K--------------dgrtqicsgwydfckgnnlkendkckfeflqtrsr
Aquca_014_00276.1|PACid:22028467   ----------------------------ggfnfnvivfdatmcervy................
Aquca_011_00001.1|PACid:22037802   ----------------------------khkqlkvsifr........................
Aquca_022_00154.1|PACid:22054782   ----------------------------wkafakdnslefgefiiciqngnsdftvkicskns
Aquca_022_00155.1|PACid:22054675   ----------------------------frlmkgwkefvfdndleqddicrfelvdwkrtemk
Aquca_035_00050.2|PACid:22061284   ----------------------------ekssgky............................
Aquca_010_00338.1|PACid:22046925   ----------------------------idgvdnairveifr.....................
Aquca_035_00050.1|PACid:22061283   ----------------------------ekssgky............................
Aquca_004_00155.3|PACid:22029726   ----------------------------vfnggwkefahhysldagyclfftysgnsrfdvvi
Aquca_004_00155.2|PACid:22029725   ----------------------------vfnggwkefahhysldagyclfftysgnsrfdvvi
Aquca_004_00155.1|PACid:22029724   ----------------------------vfnggwkefahhysldagyclfftysgnsrfdvvi
Aquca_014_00282.1|PACid:22028670   ----------------------------ldninp.............................
Aquca_005_00159.1|PACid:22023896   ----------------------------fnrgwkefadhysldagyclfftysgnsrfdvvic
Aquca_008_00005.1|PACid:22061768   ----------------------------ggkl...............................
Aquca_009_00848.1|PACid:22034367   ----------------------------fgnlkftvmiyap......................
Aquca_010_00343.1|PACid:22046466   ----------------------------elinktdvalkvhifs...................
Aquca_010_00343.2|PACid:22046464   ----------------------------elinktdvalkvhifs...................
Aquca_010_00343.3|PACid:22046465   ----------------------------elinktdvalkvhifs...................
Aquca_005_00157.1|PACid:22023821   ----------------------------ggwkefadhysldagyclfftysgnsrfdvvicdp
Aquca_005_00157.2|PACid:22023820   ----------------------------ggwkefadhysldagyclfftysgnsrfdvvicdp
Aquca_005_00533.1|PACid:22023793   ----------------------------skdclkfrvqil.......................
Aquca_019_00028.1|PACid:22055656   ----------------------------qfgviifglsgneidys..................
Aquca_014_00275.1|PACid:22027716   ----------------------------smt................................
Aquca_014_00276.1|PACid:22028467   ----------------------------lnkm...............................
Aquca_007_00470.1|PACid:22048899   ----------------------------nyytnickmsrgwkhllevfdikvgnlcvfelirs
Aquca_007_00470.2|PACid:22048900   ----------------------------nyytnickmsrgwkhllevfdikvgnlcvfelirs
Aquca_007_00470.3|PACid:22048901   ----------------------------nyytnickmsrgwkhllevfdikvgnlcvfelirs
Aquca_010_00338.1|PACid:22046925   ----------------------------nlrysvgvhrrliggwktfvvgnnlkardilvfel
Aquca_022_00154.1|PACid:22054782   -CGM------------------------awpvkiahekdgrtclsagwreffrsndlstddtc
Aquca_005_00543.1|PACid:22024412   ----------------------------ideknvkl...........................
Aquca_010_00338.1|PACid:22046925   ----------------------------lefrvkifgsnac......................
Aquca_010_00338.1|PACid:22046925   ----------------------------nlthyelkvtiir......................
Aquca_001_00601.3|PACid:22044270   ----------------------------nikvkkfgerirtlrgwqgfvehysigvgyclfft
Aquca_005_00248.1|PACid:22024358   ----------------------------dkialsggwkcfalahklvv...............
Aquca_001_00601.1|PACid:22044268   ----------------------------firesnikivdicvfelinkenilfnvhil.....
Aquca_005_00157.1|PACid:22023821   ----------------------------fnvivfs............................
Aquca_005_00157.2|PACid:22023820   ----------------------------fnvivfs............................
Aquca_001_00601.1|PACid:22044268   ----------------------------nikvkkfgerirtlrgwqgfvehysigvgyclfft
Aquca_005_00544.1|PACid:22024146   ----------------------------mklklsilkk.........................
Aquca_082_00029.1|PACid:22026036   ----------------------------iikp...............................
Aquca_014_00300.1|PACid:22028163   ----------------------------lllfdktac..........................
Aquca_049_00035.1|PACid:22044907   ----------------------------lrpneklsegitaimydhrgkvynmkykqwtdkph
Aquca_019_00028.1|PACid:22055656   ----------------------------knvvlkvsvi.........................
Aquca_030_00402.1|PACid:22035692   ----------------------------rgwnefrknhglvehkaitlwafrrk.........
Aquca_004_00299.1|PACid:22030696   ----------------------------ksrfdvlifdmscseidy.................
Aquca_013_00263.1|PACid:22059509   ----------------------------cstecikfrvqi.......................
Aquca_011_00002.2|PACid:22037838   ----------------------------vtifgsdacekv.......................
Aquca_034_00215.1|PACid:22056829   ----------------------------ecssksiefrvqild....................
Aquca_001_00335.1|PACid:22043371   ----------------------------rlairrkfvvsqilpilklkegdklltrgievlvy
Aquca_003_00642.1|PACid:22049220   ----------------------------ccfgfsvlqr.........................
Aquca_001_00900.1|PACid:22043661   ----------------------------ehiqrhwgldwtainrgtqvaviirdvetrtdhnl
Aquca_003_00503.1|PACid:22050311   ----------------------------ehiqrhwgldwtainrgtqvaviirdvetrtdhnl
Aquca_011_00094.1|PACid:22037794   ----------------------------rhwgldwtalnrgtqvavtirdvetrtdhnlllrk
Aquca_011_00095.1|PACid:22037765   ----------------------------irdvetrtdhnlllgktledvfllhnnwlkdfvfr
Aquca_056_00103.1|PACid:22060723   ----------------------------ngse...............................
Aquca_014_00299.1|PACid:22028863   ----------------------------dnik...............................
Aquca_004_00299.1|PACid:22030696   ----------------------------gvlkvni............................
Aquca_035_00050.3|PACid:22061285   ----------------------------nksrmyv............................
Aquca_013_00315.1|PACid:22060143   ----------------------------prla...............................
Aquca_061_00064.1|PACid:22060840   ----------------------------gwihfakehkldngdvlffelt.............
Aquca_010_00343.4|PACid:22046467   ----------------------------efcknylpkglesltlevsngrkkcrvr.......
Aquca_021_00197.3|PACid:22039430   --------------------G-------fwmripgqfckatfqnmm.................
Aquca_021_00197.1|PACid:22039429   --------------------G-------fwmripgqfckatfqnmm.................
Aquca_021_00197.2|PACid:22039428   --------------------G-------fwmripgqfckatfqnmm.................
Aquca_038_00055.1|PACid:22026856   ---------------------F------wmripgqfckttfqnmm..................

d1na6a1                              ...................................................
Aquca_002_01425.3|PACid:22053109   ...................................................
Aquca_002_01425.4|PACid:22053110   ...................................................
Aquca_002_01425.2|PACid:22053108   ...................................................
Aquca_022_00246.3|PACid:22054926   ...................................................
Aquca_002_01425.1|PACid:22053107   ...................................................
Aquca_022_00246.1|PACid:22054925   ...................................................
Aquca_022_00246.2|PACid:22054924   ...................................................
Aquca_007_00393.1|PACid:22047861   ...................................................
Aquca_027_00067.1|PACid:22045407   ...................................................
Aquca_018_00174.2|PACid:22040969   ...................................................
Aquca_018_00174.1|PACid:22040968   ...................................................
Aquca_008_00175.10|PACid:22061577  ...................................................
Aquca_008_00175.7|PACid:22061574   ...................................................
Aquca_008_00175.8|PACid:22061575   ...................................................
Aquca_008_00175.9|PACid:22061576   ...................................................
Aquca_008_00175.4|PACid:22061571   ...................................................
Aquca_008_00175.5|PACid:22061572   ...................................................
Aquca_008_00175.1|PACid:22061569   ...................................................
Aquca_008_00175.2|PACid:22061568   ...................................................
Aquca_008_00175.3|PACid:22061570   ...................................................
Aquca_051_00062.1|PACid:22046115   ...................................................
Aquca_036_00025.6|PACid:22055309   ...................................................
Aquca_036_00025.7|PACid:22055310   ...................................................
Aquca_036_00025.3|PACid:22055306   ...................................................
Aquca_036_00025.4|PACid:22055307   ...................................................
Aquca_036_00025.5|PACid:22055308   ...................................................
Aquca_036_00025.2|PACid:22055305   ...................................................
Aquca_036_00025.1|PACid:22055304   ...................................................
Aquca_036_00025.8|PACid:22055311   ...................................................
Aquca_100_00036.4|PACid:22063733   ...................................................
Aquca_100_00036.1|PACid:22063730   ...................................................
Aquca_100_00036.2|PACid:22063731   ...................................................
Aquca_100_00036.3|PACid:22063732   ...................................................
Aquca_013_00067.6|PACid:22058795   ...................................................
Aquca_013_00067.5|PACid:22058794   ...................................................
Aquca_013_00067.2|PACid:22058791   ...................................................
Aquca_013_00067.4|PACid:22058793   ...................................................
Aquca_013_00067.3|PACid:22058792   ...................................................
Aquca_013_00067.1|PACid:22058790   ...................................................
Aquca_003_00899.1|PACid:22049393   ...................................................
Aquca_008_00175.6|PACid:22061573   ...................................................
Aquca_072_00063.1|PACid:22041202   ...................................................
Aquca_002_01106.1|PACid:22052086   ...................................................
Aquca_017_00295.1|PACid:22031853   ...................................................
Aquca_026_00225.1|PACid:22056011   ...................................................
Aquca_037_00291.1|PACid:22040322   ...................................................
Aquca_030_00152.2|PACid:22035640   ...................................................
Aquca_030_00152.3|PACid:22035641   ...................................................
Aquca_030_00152.1|PACid:22035639   ...................................................
Aquca_009_00894.1|PACid:22034885   ...................................................
Aquca_011_00122.1|PACid:22038526   ...................................................
Aquca_016_00429.1|PACid:22062626   ...................................................
Aquca_016_00429.2|PACid:22062627   ...................................................
Aquca_142_00013.1|PACid:22063995   ...................................................
Aquca_007_00469.1|PACid:22047618   ...................................................
Aquca_007_00625.2|PACid:22048373   ...................................................
Aquca_007_00625.1|PACid:22048372   ...................................................
Aquca_007_00624.1|PACid:22047882   ...................................................
Aquca_010_00344.1|PACid:22046370   ...................................................
Aquca_007_00623.1|PACid:22048688   ...................................................
Aquca_015_00099.1|PACid:22041718   ...................................................
Aquca_095_00007.1|PACid:22042388   ...................................................
Aquca_010_00343.5|PACid:22046470   ...................................................
Aquca_010_00343.6|PACid:22046469   ...................................................
Aquca_010_00343.7|PACid:22046468   ...................................................
Aquca_011_00002.1|PACid:22037837   ...................................................
Aquca_007_00470.4|PACid:22048902   ...................................................
Aquca_010_00343.4|PACid:22046467   ...................................................
Aquca_005_00544.1|PACid:22024146   ...................................................
Aquca_010_00343.1|PACid:22046466   ...................................................
Aquca_010_00343.2|PACid:22046464   ...................................................
Aquca_010_00343.3|PACid:22046465   ...................................................
Aquca_088_00008.1|PACid:22058033   ...................................................
Aquca_007_00470.1|PACid:22048899   ...................................................
Aquca_007_00470.2|PACid:22048900   ...................................................
Aquca_007_00470.3|PACid:22048901   ...................................................
Aquca_022_00155.1|PACid:22054675   ...................................................
Aquca_009_00894.1|PACid:22034885   ...................................................
Aquca_010_00341.1|PACid:22046423   t..................................................
Aquca_001_00015.1|PACid:22042933   ...................................................
Aquca_010_00339.4|PACid:22046365   ...................................................
Aquca_108_00003.1|PACid:22046285   ...................................................
Aquca_010_00339.3|PACid:22046364   ...................................................
Aquca_010_00339.2|PACid:22046363   ...................................................
Aquca_010_00338.1|PACid:22046925   ...................................................
Aquca_086_00041.1|PACid:22054404   ...................................................
Aquca_010_00339.1|PACid:22046362   ...................................................
Aquca_007_00469.1|PACid:22047618   ...................................................
Aquca_007_00471.1|PACid:22048590   ...................................................
Aquca_007_00471.2|PACid:22048589   ...................................................
Aquca_009_00893.1|PACid:22033645   ...................................................
Aquca_004_00296.1|PACid:22030709   ...................................................
Aquca_014_00277.1|PACid:22029059   ...................................................
Aquca_004_00298.1|PACid:22029841   aghylvfrynkksqfgviifgls............................
Aquca_009_00893.1|PACid:22033645   ...................................................
Aquca_028_00035.1|PACid:22038686   ...................................................
Aquca_056_00103.1|PACid:22060723   ...................................................
Aquca_001_00536.1|PACid:22042974   ...................................................
Aquca_007_00471.1|PACid:22048590   ...................................................
Aquca_007_00471.2|PACid:22048589   ...................................................
Aquca_011_00002.2|PACid:22037838   ...................................................
Aquca_045_00208.1|PACid:22027238   ...................................................
Aquca_011_00002.1|PACid:22037837   ...................................................
Aquca_022_00154.1|PACid:22054782   ...................................................
Aquca_011_00001.1|PACid:22037802   ghiwfqsgwhefvkyhnisvshllvfrydrnssfgvvifd...........
Aquca_010_00340.1|PACid:22046572   ...................................................
Aquca_014_00275.1|PACid:22027716   ...................................................
Aquca_004_00295.1|PACid:22029888   ...................................................
Aquca_063_00016.5|PACid:22042613   ...................................................
Aquca_063_00016.4|PACid:22042612   ...................................................
Aquca_011_00002.2|PACid:22037838   ...................................................
Aquca_007_00471.1|PACid:22048590   ...................................................
Aquca_007_00471.2|PACid:22048589   ...................................................
Aquca_052_00041.1|PACid:22061969   ...................................................
Aquca_011_00002.1|PACid:22037837   ...................................................
Aquca_063_00016.2|PACid:22042610   ...................................................
Aquca_063_00016.3|PACid:22042611   ...................................................
Aquca_063_00016.1|PACid:22042609   ...................................................
Aquca_010_00344.1|PACid:22046370   gkfiidvhip.........................................
Aquca_014_00276.1|PACid:22028467   ...................................................
Aquca_011_00001.1|PACid:22037802   ...................................................
Aquca_022_00154.1|PACid:22054782   c..................................................
Aquca_022_00155.1|PACid:22054675   vtifr..............................................
Aquca_035_00050.2|PACid:22061284   ...................................................
Aquca_010_00338.1|PACid:22046925   ...................................................
Aquca_035_00050.1|PACid:22061283   ...................................................
Aquca_004_00155.3|PACid:22029726   mdp................................................
Aquca_004_00155.2|PACid:22029725   mdp................................................
Aquca_004_00155.1|PACid:22029724   mdp................................................
Aquca_014_00282.1|PACid:22028670   ...................................................
Aquca_005_00159.1|PACid:22023896   dp.................................................
Aquca_008_00005.1|PACid:22061768   ...................................................
Aquca_009_00848.1|PACid:22034367   ...................................................
Aquca_010_00343.1|PACid:22046466   ...................................................
Aquca_010_00343.2|PACid:22046464   ...................................................
Aquca_010_00343.3|PACid:22046465   ...................................................
Aquca_005_00157.1|PACid:22023821   ...................................................
Aquca_005_00157.2|PACid:22023820   ...................................................
Aquca_005_00533.1|PACid:22023793   ...................................................
Aquca_019_00028.1|PACid:22055656   ...................................................
Aquca_014_00275.1|PACid:22027716   ...................................................
Aquca_014_00276.1|PACid:22028467   ...................................................
Aquca_007_00470.1|PACid:22048899   dnllfkvhilr........................................
Aquca_007_00470.2|PACid:22048900   dnllfkvhilr........................................
Aquca_007_00470.3|PACid:22048901   dnllfkvhilr........................................
Aquca_010_00338.1|PACid:22046925   vdrn...............................................
Aquca_022_00154.1|PACid:22054782   cfevikdmdnairv.....................................
Aquca_005_00543.1|PACid:22024412   ...................................................
Aquca_010_00338.1|PACid:22046925   ...................................................
Aquca_010_00338.1|PACid:22046925   ...................................................
Aquca_001_00601.3|PACid:22044270   ydgissfdvvicda.....................................
Aquca_005_00248.1|PACid:22024358   ...................................................
Aquca_001_00601.1|PACid:22044268   ...................................................
Aquca_005_00157.1|PACid:22023821   ...................................................
Aquca_005_00157.2|PACid:22023820   ...................................................
Aquca_001_00601.1|PACid:22044268   ydgissfdvvicda.....................................
Aquca_005_00544.1|PACid:22024146   ...................................................
Aquca_082_00029.1|PACid:22026036   ...................................................
Aquca_014_00300.1|PACid:22028163   ...................................................
Aquca_049_00035.1|PACid:22044907   vifgdwlkfckehklia..................................
Aquca_019_00028.1|PACid:22055656   ...................................................
Aquca_030_00402.1|PACid:22035692   ...................................................
Aquca_004_00299.1|PACid:22030696   ...................................................
Aquca_013_00263.1|PACid:22059509   ...................................................
Aquca_011_00002.2|PACid:22037838   ...................................................
Aquca_034_00215.1|PACid:22056829   ...................................................
Aquca_001_00335.1|PACid:22043371   dirgnksskmkfskwkkvfvlisgwrkfyqehdlkanedevhlwacrdvrt
Aquca_003_00642.1|PACid:22049220   ...................................................
Aquca_001_00900.1|PACid:22043661   llrkthddafllhnnwlrdfvfrrnlkegdtigmywnrtsssicfsvlkra
Aquca_003_00503.1|PACid:22050311   llrkthddafllhnnwlrdfvfrrnlkegdtigmywnrtsssicfsvlkra
Aquca_011_00094.1|PACid:22037794   tledvfllhnnwlkdfvfrrnlkegdtigmywnrtsssicfsvlkra....
Aquca_011_00095.1|PACid:22037765   rnlkegdtigmywnrtsssicfsvlkra.......................
Aquca_056_00103.1|PACid:22060723   ...................................................
Aquca_014_00299.1|PACid:22028863   ...................................................
Aquca_004_00299.1|PACid:22030696   ...................................................
Aquca_035_00050.3|PACid:22061285   ...................................................
Aquca_013_00315.1|PACid:22060143   ...................................................
Aquca_061_00064.1|PACid:22060840   ...................................................
Aquca_010_00343.4|PACid:22046467   ...................................................
Aquca_021_00197.3|PACid:22039430   ...................................................
Aquca_021_00197.1|PACid:22039429   ...................................................
Aquca_021_00197.2|PACid:22039428   ...................................................
Aquca_038_00055.1|PACid:22026856   ...................................................

Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:

Model: 0048310 (list models)
Initial SAMT99 seed:

Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues

Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.

Select to display   Genome
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Eubacterium rectale ATCC 33656
NoYes   Bacteroides fragilis YCH46
NoYes   Treponema succinifaciens DSM 2489
NoYes   Geobacter lovleyi SZ
NoYes   Thauera sp. MZ1T
NoYes   Acidiphilium cryptum JF-5
NoYes   Edwardsiella ictaluri 93-146
NoYes   Rahnella aquatilis CIP 78.65 = ATCC 33071
NoYes   Serratia proteamaculans 568
NoYes   Erwinia pyrifoliae Ep1/96
NoYes   Citrobacter koseri ATCC BAA-895
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Leptospirillum ferriphilum ML-04
NoYes   Neisseria meningitidis WUE 2594
NoYes   Neisseria meningitidis M04-240196
NoYes   Neisseria meningitidis M01-240149
NoYes   Neisseria meningitidis NZ-05/33
NoYes   Neisseria meningitidis 053442
NoYes   Neisseria meningitidis Z2491
NoYes   Neisseria meningitidis H44/76
NoYes   Neisseria meningitidis alpha710
NoYes   Neisseria meningitidis MC58
NoYes   Taylorella equigenitalis 14/56
NoYes   Erwinia pyrifoliae DSM 12163
NoYes   Cronobacter sakazakii CMCC 45402
NoYes   Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980
NoYes   Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7
NoYes   Salmonella enterica subsp. enterica serovar Heidelberg str. 41578
NoYes   Escherichia coli O7:K1 str. CE10
NoYes   Escherichia coli IAI39
NoYes   Pseudomonas putida GB-1
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Lotus japonicus
NoYes   Malus x domestica - Apple
NoYes   Ricinus communis - Castor bean
NoYes   Nicotiana benthamiana 0.4.4
NoYes   Solanum pimpinellifolium A-1.0 - Currant tomato
NoYes   Solanum lycopersicum v2.3 - Tomato
NoYes   Phoenix dactylifera - Date palm
NoYes   4_050719Q (meta-genome)
NoYes   Activated sludge plasmid pool Visp-2009 (Newbler) (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 1 (meta-genome)
NoYes   Combined (meta-genome)
NoYes   Cyphomyrmex longiscapus fungus garden (meta-genome)
NoYes   Dendroctonus ponderosae fungus gallery (Hybrid pine) (MPB hybrid gallery) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Fungus garden combined (combined) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden bottom (Fungus garden bottom) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden top (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 03(I) (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP15 from Mushroom Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP16 from Fairy Spring Red Layer (meta-genome)
NoYes   Macropus eugenii forestomach microbiome from Canberra, Australia, sample Macropus_eugenii_combined (meta-genome)
NoYes   Maize field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing corn (Zea may (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formaldehyde enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methane enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methylamine enrichment (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Wastewater Terephthalate-degrading communities from Bioreactor (meta-genome)
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   The Salmonella enterica Pan-genome (meta-genome)
NoYes   ALL (only advised for small superfamilies)

Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]