SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.


Oligoxyloglucan reducing end-specific cellobiohydrolase alignments

These alignments are sequences aligned to the 0043715 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1sqja1 ............................................................................................
d1sqja2 wapswylqidgieenailslrspksgaallsgigdisgmkhddltkpqkmfgapqfsnldsidaagnfpnvvvragssgheydsacargaya


                           10        20        30            40        50        60        70       
                            |         |         |             |         |         |         |       
d1sqja1 ...........YEFKNVAIGGGGYITGIVAHPKTKDLLYART....DIGGAYRWDAGTSKWIPLNDFIEAQDMNIMGTESIALDPNNPDRLY
d1sqja2 tdggdawtifp--TCPPGMNASHYQGSTIAVDASGSQIVWSTkldeQASGPWYSHDYGKTWSVPAGDLK------AQTANVLSDKVQDGTFY


         80        90       100       110       120       130       140       150       160       17
          |         |         |         |         |         |         |         |         |         
d1sqja1 LAQGRYVGDEWAAFYVSEDRGQSFTIYESPFPMGANDMGRNNGERLAVNPFNSNEVWMGTRTEGIWKSSDRAKTWTNVTSIPDAFTNGIGYT
d1sqja2 A-------TDGGKFFVSTDGGKSYAA-------KGAGLVTGTSLMPAVNPWVAGDVWVPVPEGGLFHSTDFGASFTRVGTANATL------V


        0               180       190           200       210       220       230       240       25
        |                 |         |             |         |         |         |         |         
d1sqja1 SVIFDPERNG........TIYASATAPQG....MYVTHDGGVSWEPVAGQPSSWLNRTTGAFPDKKPASIAPQPMKVALTPNFLYVTYADYP
d1sqja2 SVGAPKSKSDgkkasapsAVFIWGTDKPGsdigLYRSDDNGSTWTRVNDQEHNYS-GPTMIEADPKVY-------------GRVYLGTNGRG


        0       260       270       280       290       300       310       320       330       340 
        |         |         |         |         |         |         |         |         |         | 
d1sqja1 GPWGVTFGEVWRQNRTSGAWDDITPRVGNSSPAPYNNQTFPAGGFCGLSVDATNPNRLVVITLDRDPGPALDSIYLSTDAGATWKDVTQLSS
d1sqja2 IVYADL--------------------------------------------------------------------------------------


              350       360       370       380       390       400       410       420             
                |         |         |         |         |         |         |         |             
d1sqja1 PSNLEGNWGHPTNAARYKDGTPVPWLDFNNGPQWGGYGAPHGTPGLTKFGWWMSAVLIDPFNPEHLMYGTGATIWATDTLSR----vekd..
d1sqja2 --------------------------------------------------------------------------------------tnkksn


                          
                          
d1sqja1 ..................
d1sqja2 eekstakcangqkgthcy


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0043715 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Sphaerobolus stellatus v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Hydnomerulius pinastri v2.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Galerina marginata v1.0
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Aspergillus zonatus v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus niger 22
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Microcoleus sp. PCC 7113
NoYes   Geitlerinema sp. PCC 7407
NoYes   Rivularia sp. PCC 7116
NoYes   Calothrix sp. PCC 7507
NoYes   Nostoc sp. PCC 7524
NoYes   Thermobispora bispora DSM 43833
NoYes   Acidothermus cellulolyticus 11B
NoYes   Catenulispora acidiphila DSM 44928
NoYes   Thermobifida fusca YX
NoYes   Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111
NoYes   Streptosporangium roseum DSM 43021
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces sp. PAMC26508
NoYes   Streptomyces flavogriseus ATCC 33331
NoYes   Streptomyces sp. SirexAA-E
NoYes   Streptomyces bingchenggensis BCW-1
NoYes   Streptomyces violaceusniger Tu 4113
NoYes   Streptomyces avermitilis MA-4680
NoYes   Streptomyces scabiei 87.22
NoYes   Streptomyces hygroscopicus subsp. jinggangensis 5008
NoYes   Actinosynnema mirum DSM 43827
NoYes   Amycolatopsis mediterranei U32
NoYes   Kribbella flavida DSM 17836
NoYes   Actinoplanes sp. N902-109
NoYes   Actinoplanes sp. SE50/110
NoYes   Jonesia denitrificans DSM 20603
NoYes   Cellulomonas fimi ATCC 484
NoYes   [Cellvibrio] gilvus ATCC 13127
NoYes   Herpetosiphon aurantiacus DSM 785
NoYes   Clostridium clariflavum DSM 19732
NoYes   Eubacterium siraeum
NoYes   Clostridium cellulolyticum H10
NoYes   Clostridium thermocellum ATCC 27405
NoYes   Ruminococcus albus 7
NoYes   Clostridium lentocellum DSM 5427
NoYes   Roseburia intestinalis
NoYes   Clostridium sp. BNL1100
NoYes   Clostridium cellulovorans 743B
NoYes   Clostridium acetobutylicum ATCC 824
NoYes   Caldicellulosiruptor obsidiansis OB47
NoYes   Caldicellulosiruptor kronotskyensis 2002
NoYes   Caldicellulosiruptor lactoaceticus 6A
NoYes   Caldicellulosiruptor kristjanssonii 177R1B
NoYes   Caldicellulosiruptor saccharolyticus DSM 8903
NoYes   Caldicellulosiruptor bescii DSM 6725
NoYes   Paenibacillus sp. JDR-2
NoYes   Paenibacillus terrae HPL-003
NoYes   Paenibacillus mucilaginosus 3016
NoYes   Paenibacillus polymyxa M1
NoYes   Niastella koreensis GR20-10
NoYes   Cytophaga hutchinsonii ATCC 33406
NoYes   Fibrobacter succinogenes subsp. succinogenes S85
NoYes   Thermotoga sp. RQ2
NoYes   Thermotoga maritima MSB8
NoYes   Collimonas fungivorans Ter331
NoYes   Asticcacaulis excentricus CB 48
NoYes   Teredinibacter turnerae T7901
NoYes   Cellvibrio japonicus Ueda107
NoYes   Pseudoxanthomonas suwonensis 11-1
NoYes   Xanthomonas axonopodis pv. citri str. 306
NoYes   Xanthomonas campestris pv. campestris str. B100
NoYes   Aspergillus fumigatus A1163
NoYes   Oscillatoria acuminata PCC 6304
NoYes   Gloeobacter kilaueensis Gloeobacter sp. JS
NoYes   Calothrix parietina Calothrix sp. PCC 6303
NoYes   Streptomyces rapamycinicus NRRL 5491
NoYes   Streptomyces davawensis JCM 4913
NoYes   Streptomyces venezuelae ATCC 10712
NoYes   Streptomyces hygroscopicus subsp. jinggangensis TL01
NoYes   Amycolatopsis mediterranei RB
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis mediterranei S699
NoYes   Actinoplanes friuliensis DSM 7358
NoYes   Eubacterium siraeum V10Sc8a
NoYes   Clostridium thermocellum DSM 1313
NoYes   Ruminococcus champanellensis 18P13
NoYes   Roseburia intestinalis XB6B4
NoYes   Clostridium saccharoperbutylacetonicum N1-4(HMT)
NoYes   Clostridium acetobutylicum DSM 1731
NoYes   Clostridium acetobutylicum EA 2018
NoYes   Paenibacillus mucilaginosus KNP414
NoYes   Paenibacillus mucilaginosus K02
NoYes   Paenibacillus polymyxa CR1
NoYes   Paenibacillus polymyxa SC2
NoYes   Paenibacillus polymyxa E681
NoYes   Fibrobacter succinogenes subsp. succinogenes S85
NoYes   Spirochaeta thermophila DSM 6578
NoYes   Thermotoga maritima MSB8
NoYes   Burkholderia ambifaria MC40-6
NoYes   Xanthomonas citri subsp. citri Aw12879
NoYes   Xanthomonas campestris pv. vesicatoria str. 85-10
NoYes   Xanthomonas axonopodis pv. citrumelo F1
NoYes   Xanthomonas axonopodis Xac29-1
NoYes   Xanthomonas campestris pv. raphani 756C
NoYes   Xanthomonas campestris pv. campestris str. 8004
NoYes   Xanthomonas campestris pv. campestris str. ATCC 33913
NoYes   Moniliophthora perniciosa FA553
NoYes   Ricinus communis - Castor bean
NoYes   Air microbial communities Singapore indoor air filters 1 (meta-genome)
NoYes   Dump bottom (Dump bottom) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Hindgut microbiome of Nasutitermes sp. (Costa Rica) (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   simHC - Simulated High Complexity Metagenome (meta-genome)
NoYes   simLC - Simulated Low Complexity Metagenome (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- (Maryland Estuary ambient) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- (Oak Ridge ambient) (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Uniprot 2018_03 genome
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]