SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.


Diaminopimelate epimerase-like alignments

These alignments are sequences aligned to the 0044048 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                10        20        30        40        50        60        70        80        90  
                 |         |         |         |         |         |         |         |         |  
d1tm0a_ MRSTKVIHIVGCHAEGEVGDVIVGGVAPPPGETVWEQSRFIANDETLRNFVLNKPRGGVFRHVNLLVPPKDPRAQMGFIIMEPADTPPMSGS


             100       110       120       130       140       150       160       170       180    
               |         |         |         |         |         |         |         |         |    
d1tm0a_ NSICVSTVLLDSGIIAMQEPVTHMVLEAPGGIIEVEAECRNGKAERISVRNVPSFADRLDAPLDVTGLGTIMVDTAYGGDSFVIVDAAQIGM


           190       200       210       220       230       240       250       260       270      
             |         |         |         |         |         |         |         |         |      
d1tm0a_ KIEPGQARELAEIGVKITKAANEQLGFRHPERDWRHISFCQITEPVTREGDVLTGVNTVAIRPAKFDRSPTGTGCSARMAVLHAKGQMKAGE


         280       290       300       310       320       330  
           |         |         |         |         |         |  
d1tm0a_ RFIGKSVLGTEFHCRLDKVLELGGKPAISPIISGRAWVTGTSQLMLDPSDPFPHGY


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0044048 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Homo sapiens 76_38 - Human
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Octopus bimaculoides 280
NoYes   Lottia gigantea - Owl limpet
NoYes   Strigamia maritima 22
NoYes   Caenorhabditis japonica
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Penicillium marneffei ATCC 18224
NoYes   Candida parapsilosis
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Aureococcus anophagefferens
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Emiliania huxleyi CCMP1516
NoYes   Rubrobacter xylanophilus DSM 9941
NoYes   Catenulispora acidiphila DSM 44928
NoYes   Stackebrandtia nassauensis DSM 44728
NoYes   Streptosporangium roseum DSM 43021
NoYes   Kitasatospora setae KM-6054
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces griseus subsp. griseus NBRC 13350
NoYes   Streptomyces bingchenggensis BCW-1
NoYes   Streptomyces violaceusniger Tu 4113
NoYes   Streptomyces avermitilis MA-4680
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces scabiei 87.22
NoYes   Streptomyces hygroscopicus subsp. jinggangensis 5008
NoYes   Actinosynnema mirum DSM 43827
NoYes   Saccharopolyspora erythraea NRRL 2338
NoYes   Amycolatopsis mediterranei U32
NoYes   Kribbella flavida DSM 17836
NoYes   Microlunatus phosphovorus NM-1
NoYes   Micromonospora sp. L5
NoYes   Gordonia polyisoprenivorans VH2
NoYes   Rhodococcus jostii RHA1
NoYes   Clavibacter michiganensis subsp. michiganensis NCPPB 382
NoYes   Intrasporangium calvum DSM 43043
NoYes   Brachybacterium faecium DSM 4810
NoYes   Arthrobacter sp. Rue61a
NoYes   Renibacterium salmoninarum ATCC 33209
NoYes   Sphaerobacter thermophilus DSM 20745
NoYes   Roseiflexus sp. RS-1
NoYes   Roseiflexus castenholzii DSM 13941
NoYes   Chloroflexus sp. MS-G
NoYes   Chloroflexus sp. Y-400-fl
NoYes   Chloroflexus aurantiacus J-10-fl
NoYes   Truepera radiovictrix DSM 17093
NoYes   Deinococcus deserti VCD115
NoYes   Megasphaera elsdenii DSM 20460
NoYes   Desulfosporosinus acidiphilus SJ4
NoYes   Eubacterium limosum KIST612
NoYes   Clostridium difficile 630
NoYes   Clostridium sticklandii DSM 519
NoYes   Alkaliphilus oremlandii OhILAs
NoYes   Alkaliphilus metalliredigens QYMF
NoYes   Clostridium botulinum A str. ATCC 3502
NoYes   Thermosediminibacter oceani DSM 16646
NoYes   Melissococcus plutonius DAT561
NoYes   Enterococcus hirae ATCC 9790
NoYes   Brevibacillus brevis NBRC 100599
NoYes   Paenibacillus terrae HPL-003
NoYes   Lysinibacillus sphaericus C3-41
NoYes   Bacillus weihenstephanensis KBAB4
NoYes   Bacillus thuringiensis str. Al Hakam
NoYes   Bacillus cereus 03BB102
NoYes   Bacillus anthracis str. A0248
NoYes   Haliscomenobacter hydrossis DSM 1100
NoYes   Niastella koreensis GR20-10
NoYes   Chitinophaga pinensis DSM 2588
NoYes   Rhodothermus marinus DSM 4252
NoYes   Belliella baltica DSM 15883
NoYes   Fibrella aestuarina
NoYes   Leadbetterella byssophila DSM 17132
NoYes   Dyadobacter fermentans DSM 18053
NoYes   Spirosoma linguale DSM 74
NoYes   Runella slithyformis DSM 19594
NoYes   Sphingobacterium sp. 21
NoYes   Zunongwangia profunda SM-A87
NoYes   Krokinobacter sp. 4H-3-7-5
NoYes   Maribacter sp. HTCC2170
NoYes   Robiginitalea biformata HTCC2501
NoYes   Zobellia galactanivorans
NoYes   Muricauda ruestringensis DSM 13258
NoYes   Cellulophaga algicola DSM 14237
NoYes   Cellulophaga lytica DSM 7489
NoYes   Flavobacterium columnare ATCC 49512
NoYes   Fretibacterium fastidiosum
NoYes   Thermovirga lienii DSM 17291
NoYes   Thermanaerovibrio acidaminovorans DSM 6589
NoYes   Anaerobaculum mobile DSM 13181
NoYes   Deferribacter desulfuricans SSM1
NoYes   Candidatus Solibacter usitatus Ellin6076
NoYes   Arcobacter nitrofigilis DSM 7299
NoYes   Desulfobacterium autotrophicum HRM2
NoYes   Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774
NoYes   Pseudogulbenkiania sp. NH8B
NoYes   Burkholderia phytofirmans PsJN
NoYes   Burkholderia phymatum STM815
NoYes   Burkholderia xenovorans LB400
NoYes   Burkholderia sp. RPE64
NoYes   Burkholderia sp. CCGE1002
NoYes   Burkholderia ambifaria AMMD
NoYes   Burkholderia cenocepacia HI2424
NoYes   Burkholderia multivorans ATCC 17616
NoYes   Burkholderia gladioli BSR3
NoYes   Collimonas fungivorans Ter331
NoYes   Herbaspirillum seropedicae SmR1
NoYes   Bordetella petrii DSM 12804
NoYes   Achromobacter xylosoxidans A8
NoYes   Achromobacter xylosoxidans
NoYes   Asticcacaulis excentricus CB 48
NoYes   Sphingobium sp. SYK-6
NoYes   Maricaulis maris MCS10
NoYes   Phaeobacter gallaeciensis 2.10
NoYes   Pseudovibrio sp. FO-BEG1
NoYes   Jannaschia sp. CCS1
NoYes   Ruegeria sp. TM1040
NoYes   Ruegeria pomeroyi DSS-3
NoYes   Ketogulonicigenium vulgare Y25
NoYes   Ketogulonigenium vulgarum WSH-001
NoYes   Rhodobacter sphaeroides ATCC 17029
NoYes   Paracoccus denitrificans PD1222
NoYes   Tistrella mobilis KA081020-065
NoYes   Rhodospirillum rubrum F11
NoYes   Azospirillum brasilense Sp245
NoYes   Candidatus Puniceispirillum marinum IMCC1322
NoYes   Starkeya novella DSM 506
NoYes   Methylobacterium sp. 4-46
NoYes   Methylobacterium nodulans ORS 2060
NoYes   Ochrobactrum anthropi ATCC 49188
NoYes   Brucella microti CCM 4915
NoYes   Brucella pinnipedialis B2/94
NoYes   Brucella canis ATCC 23365
NoYes   Brucella suis ATCC 23445
NoYes   Brucella melitensis ATCC 23457
NoYes   Brucella ovis ATCC 25840
NoYes   Brucella abortus S19
NoYes   Sinorhizobium fredii NGR234
NoYes   Sinorhizobium medicae WSM419
NoYes   Sinorhizobium meliloti AK83
NoYes   Genome sequence of Rhizobium sp. strain IRBG74
NoYes   Rhizobium etli CIAT 652
NoYes   Rhizobium leguminosarum bv. viciae 3841
NoYes   Agrobacterium tumefaciens str. C58
NoYes   Agrobacterium radiobacter K84
NoYes   Agrobacterium sp. H13-3
NoYes   Agrobacterium vitis S4
NoYes   Mesorhizobium sp. BNC1
NoYes   Mesorhizobium opportunistum WSM2075
NoYes   Mesorhizobium ciceri biovar biserrulae WSM1271
NoYes   Mesorhizobium loti MAFF303099
NoYes   Pelagibacterium halotolerans B2
NoYes   Oceanimonas sp. GK1
NoYes   Vibrio sp. Ex25
NoYes   Vibrio parahaemolyticus RIMD 2210633
NoYes   Psychromonas ingrahamii 37
NoYes   Ferrimonas balearica DSM 9799
NoYes   Shewanella piezotolerans WP3
NoYes   Shewanella loihica PV-4
NoYes   Shewanella halifaxensis HAW-EB4
NoYes   Shewanella sediminis HAW-EB3
NoYes   Shewanella pealeana ATCC 700345
NoYes   Shewanella woodyi ATCC 51908
NoYes   Shewanella amazonensis SB2B
NoYes   Shewanella violacea DSS12
NoYes   Colwellia psychrerythraea 34H
NoYes   Marinobacter adhaerens HP15
NoYes   Marinobacter sp. BSs20148
NoYes   Marinobacter hydrocarbonoclasticus ATCC 49840
NoYes   Marinobacter aquaeolei VT8
NoYes   Hahella chejuensis KCTC 2396
NoYes   Marinomonas sp. MWYL1
NoYes   Chromohalobacter salexigens DSM 3043
NoYes   Halomonas elongata DSM 2581
NoYes   Xanthomonas axonopodis pv. citri str. 306
NoYes   Spiribacter sp. UAH-SP71
NoYes   Alkalilimnicola ehrlichii MLHE-1
NoYes   Pseudomonas sp. TKP
NoYes   Pseudomonas sp. UW4
NoYes   Pseudomonas brassicacearum subsp. brassicacearum NFM421
NoYes   Pseudomonas putida F1
NoYes   Pseudomonas fluorescens SBW25
NoYes   Pseudomonas aeruginosa UCBPP-PA14
NoYes   Candidatus Korarchaeum cryptofilum OPF8
NoYes   Thermococcus sibiricus MM 739
NoYes   Haloferax volcanii DS2
NoYes   Haloarcula hispanica ATCC 33960
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Spiroplasma apis B31
NoYes   Gordonibacter pamelaeae 7-10-1-b
NoYes   Streptomyces rapamycinicus NRRL 5491
NoYes   Streptomyces davawensis JCM 4913
NoYes   Streptomyces fulvissimus DSM 40593
NoYes   Streptomyces venezuelae ATCC 10712
NoYes   Streptomyces collinus Tu 365
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces hygroscopicus subsp. jinggangensis TL01
NoYes   Amycolatopsis mediterranei RB
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis orientalis HCCB10007
NoYes   Propionibacterium acidipropionici ATCC 4875
NoYes   Nocardia brasiliensis ATCC 700358
NoYes   Clavibacter michiganensis subsp. sepedonicus
NoYes   Clavibacter michiganensis subsp. nebraskensis NCPPB 2581
NoYes   Bifidobacterium thermophilum RBL67
NoYes   Clostridium difficile BI1
NoYes   Clostridium difficile R20291
NoYes   Clostridium difficile CD196
NoYes   Clostridium botulinum H04402 065
NoYes   Clostridium botulinum F str. 230613
NoYes   Clostridium botulinum F str. Langeland
NoYes   Clostridium botulinum B1 str. Okra
NoYes   Clostridium botulinum Ba4 str. 657
NoYes   Clostridium botulinum A2 str. Kyoto
NoYes   Clostridium botulinum A3 str. Loch Maree
NoYes   Clostridium botulinum A str. Hall
NoYes   Clostridium botulinum A str. ATCC 19397
NoYes   Thermacetogenium phaeum DSM 12270
NoYes   Melissococcus plutonius ATCC 35311
NoYes   Paenibacillus polymyxa CR1
NoYes   Bacillus toyonensis BCT-7112
NoYes   Bacillus thuringiensis HD-771
NoYes   Bacillus thuringiensis HD-789
NoYes   Bacillus thuringiensis MC28
NoYes   Bacillus thuringiensis serovar chinensis CT-43
NoYes   Bacillus thuringiensis YBT-1518
NoYes   Bacillus thuringiensis Bt407
NoYes   Bacillus thuringiensis serovar konkukian str. 97-27
NoYes   Bacillus thuringiensis serovar kurstaki str. HD73
NoYes   Bacillus thuringiensis BMB171
NoYes   Bacillus thuringiensis serovar finitimus YBT-020
NoYes   Bacillus thuringiensis serovar thuringiensis str. IS5056
NoYes   Bacillus cereus FRI-35
NoYes   Bacillus cereus biovar anthracis str. CI
NoYes   Bacillus cereus AH820
NoYes   Bacillus cereus AH187
NoYes   Bacillus cereus B4264
NoYes   Bacillus cereus G9842
NoYes   Bacillus cereus Q1
NoYes   Bacillus cereus F837/76
NoYes   Bacillus cereus NC7401
NoYes   Bacillus cereus E33L
NoYes   Bacillus cereus ATCC 14579
NoYes   Bacillus cereus ATCC 10987
NoYes   Bacillus anthracis str. H9401
NoYes   Bacillus anthracis str. CDC 684
NoYes   Bacillus anthracis str. 'Ames Ancestor'
NoYes   Bacillus anthracis str. Sterne
NoYes   Bacillus anthracis str. Ames
NoYes   Rhodothermus marinus SG0.5JP17-172
NoYes   Echinicola vietnamensis DSM 17526
NoYes   Emticicia oligotrophica DSM 17448
NoYes   Psychroflexus torquis ATCC 700755
NoYes   Sorangium cellulosum So0157-2
NoYes   Burkholderia phenoliruptrix BR3459a
NoYes   Burkholderia sp. YI23
NoYes   Burkholderia lata
NoYes   Burkholderia ambifaria MC40-6
NoYes   Burkholderia cenocepacia MC0-3
NoYes   Burkholderia cenocepacia AU 1054
NoYes   Burkholderia cenocepacia J2315
NoYes   Burkholderia multivorans ATCC 17616
NoYes   Burkholderia cepacia GG4
NoYes   Achromobacter xylosoxidans NBRC 15126 = ATCC 27061
NoYes   Phaeobacter gallaeciensis DSM 17395
NoYes   Phaeobacter gallaeciensis DSM 26640
NoYes   Leisingera methylohalidivorans DSM 14336
NoYes   Octadecabacter antarcticus 307
NoYes   Octadecabacter arcticus 238
NoYes   Rhodobacter sphaeroides KD131
NoYes   Rhodobacter sphaeroides 2.4.1
NoYes   Paracoccus aminophilus JCM 7686
NoYes   Rhodospirillum rubrum ATCC 11170
NoYes   Brucella ceti TE10759-12
NoYes   Brucella ceti TE28753-12
NoYes   Brucella canis HSK A52141
NoYes   Brucella suis VBI22
NoYes   Brucella suis 1330
NoYes   Brucella suis 1330
NoYes   Brucella melitensis NI
NoYes   Brucella melitensis M5-90
NoYes   Brucella melitensis M28
NoYes   Brucella melitensis bv. 1 str. 16M
NoYes   Brucella abortus A13334
NoYes   Brucella melitensis biovar Abortus 2308
NoYes   Brucella abortus bv. 1 str. 9-941
NoYes   Sinorhizobium fredii USDA 257
NoYes   Sinorhizobium fredii HH103
NoYes   Sinorhizobium meliloti 2011
NoYes   Sinorhizobium meliloti GR4
NoYes   Sinorhizobium meliloti Rm41
NoYes   Sinorhizobium meliloti SM11
NoYes   Sinorhizobium meliloti BL225C
NoYes   Sinorhizobium meliloti 1021
NoYes   Rhizobium etli CFN 42
NoYes   Rhizobium etli bv. mimosae str. Mim1
NoYes   Rhizobium tropici CIAT 899
NoYes   Rhizobium leguminosarum bv. trifolii WSM2304
NoYes   Rhizobium leguminosarum bv. trifolii WSM1325
NoYes   Mesorhizobium australicum WSM2073
NoYes   Simiduia agarivorans SA1 = DSM 21679
NoYes   Vibrio parahaemolyticus BB22OP
NoYes   Vibrio alginolyticus NBRC 15630 = ATCC 17749
NoYes   Xanthomonas axonopodis Xac29-1
NoYes   Spiribacter salinus M19-40
NoYes   Pseudomonas denitrificans ATCC 13867
NoYes   Pseudomonas monteilii SB3101
NoYes   Pseudomonas monteilii SB3078
NoYes   Pseudomonas putida H8234
NoYes   Pseudomonas putida HB3267
NoYes   Pseudomonas putida NBRC 14164
NoYes   Pseudomonas putida DOT-T1E
NoYes   Pseudomonas putida S16
NoYes   Pseudomonas putida BIRD-1
NoYes   Pseudomonas putida W619
NoYes   Pseudomonas putida ND6
NoYes   Pseudomonas putida KT2440
NoYes   Pseudomonas putida GB-1
NoYes   Pseudomonas fluorescens F113
NoYes   Pseudomonas fluorescens Pf0-1
NoYes   Pseudomonas aeruginosa SCV20265
NoYes   Pseudomonas aeruginosa MTB-1
NoYes   Pseudomonas aeruginosa LES431
NoYes   Pseudomonas aeruginosa RP73
NoYes   Pseudomonas aeruginosa B136-33
NoYes   Pseudomonas aeruginosa PA1R
NoYes   Pseudomonas aeruginosa PA1
NoYes   Pseudomonas aeruginosa DK2
NoYes   Pseudomonas aeruginosa NCGM2.S1
NoYes   Pseudomonas aeruginosa M18
NoYes   Pseudomonas aeruginosa LESB58
NoYes   Pseudomonas aeruginosa PA7
NoYes   Pseudomonas aeruginosa PAO1
NoYes   Thermococcus litoralis DSM 5473
NoYes   Ferroplasma acidarmanus fer1
NoYes   Haloarcula hispanica N601
NoYes   Homo sapiens 69_37 - Human
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   3_Below_base_of_euphotic (meta-genome)
NoYes   4_050719Q (meta-genome)
NoYes   4_Deep_abyss (meta-genome)
NoYes   5_050719P (meta-genome)
NoYes   5_Below_upper_mesopelagic (meta-genome)
NoYes   7_Oxygen_minimum_layer (meta-genome)
NoYes   Activated sludge plasmid pool Visp-2009 (Newbler) (meta-genome)
NoYes   Atta cephalotes fungus garden (ACEF) (meta-genome)
NoYes   Combined (meta-genome)
NoYes   Cyphomyrmex longiscapus fungus garden (meta-genome)
NoYes   Dendroctonus ponderosae beetle community (MPB hybrid beetle) (Lodgepole pine) (meta-genome)
NoYes   Dendroctonus ponderosae fungus gallery (Hybrid pine) (MPB hybrid gallery) (meta-genome)
NoYes   Dump bottom (Dump bottom) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #1 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #2 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #3 (meta-genome)
NoYes   Fungus garden combined (combined) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden bottom (Fungus garden bottom) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden top (meta-genome)
NoYes   Groundwater dechlorinating community (KB-1) from synthetic mineral medium in Toronto, ON, sample from Site contaminated with chlorinated ethenes
NoYes   Guerrero Negro salt ponds hypersaline mat 04(N) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 07(S) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 08(T) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 10(Z) (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP18 from Washburn Springs #1 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP5 from Bath Lake Vista Annex (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP7 from Chocolate Pots (meta-genome)
NoYes   Marine anammox bioreactor enriched for Scalindua species (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formaldehyde enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formate enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methane enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methanol enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methylamine enrichment (meta-genome)
NoYes   Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine (MPB hybrid beetle) (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   Olavius algarvensis endosymbiont metagenome Delta1 (meta-genome)
NoYes   Olavius algarvensis endosymbiont metagenome Gamma3 (meta-genome)
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   simHC - Simulated High Complexity Metagenome (meta-genome)
NoYes   simLC - Simulated Low Complexity Metagenome (meta-genome)
NoYes   simMC - Simulated Medium Complexity Metagenome (meta-genome)
NoYes   Sludge/US, Jazz Assembly (meta-genome)
NoYes   Sludge/US, Phrap Assembly (meta-genome)
NoYes   Soil microbial communities from Minnesota Farm (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- (Maryland Estuary ambient) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 4 Nevada Test Site Crust CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+ (Oak Ridge elevated CO2) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- (Oak Ridge ambient) (meta-genome)
NoYes   Soil microbial community from bioreactor at Alameda Naval Air Station, CA, contaminated with Chloroethene, Sample 196 (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Wastewater Terephthalate-degrading communities from Bioreactor (meta-genome)
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]