SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

RalF, C-terminal domain alignments

These alignments are sequences aligned to the 0051098 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                               10        20        30        40         50        60
                                                |         |         |         |          |         |
d1xsza2                              ..KTSPGYELTSTTLNKDSTFKKLDSFLHSTDVNINTVFPGIG.DNVKTTVDQPKSWLSFFTG
Pr5_ENSFALP00000006552               qk----------------------DPFIDFEMEDIKAELAEVK.EALKMRNDELEELHGKVKG
gi|157826859|ref|YP_001495923.1|   ..QTATGYEIAGISSQNDKTFKKLDDFL-TAKTDINNVFSNLG.NNVTAQHKQPKTWLNKFTG
gi|51473566|ref|YP_067323.1|       ..DSSPGYQINNISSQNDKVFKQLNQFL-EEKRNIQNIFPKLQnNNLTIEFKNAKTFLNKFTG
jkW_gi|383499614|ref|YP_005412975.1| ..DSSPGYQINNISSQNDKTFKQLNQFL-EEKRNIQNIFPKLQnNNLTIEFKNPKTFLSKFTG
gi|67458977|ref|YP_246601.1|       ..DSSPGYEIDNISSQNDQTFKKLSKFL-EEKRNIQDVFPKLQnNNLTAEFKNPKTLLNKFTG
ioy_gi|383501828|ref|YP_005415187.1| ..DSSPGYEIDNISSQNDQTFKKLNKFL-KETRNIQDSFSKLQnNNLTAEFKNPKTLLNKFTG
gi|157825637|ref|YP_001493357.1|   ..DSSPGYEIYNISSQNDQTFKKLNKFL-EEKSTIQDVFSKLQnNNLTAEFKNPKTLLNKFTG
gi|289164734|ref|YP_003454872.1|   ..KTTPGYLLTSSTLDDDLMFKKLDLLLQSSISTTEEIFPEIA.DNITVTFDKPKAWLKAFIG
gi|148359513|ref|YP_001250720.1|   ..KTSPGYELTSITLNKDSTFKKLDSFLHSTDVNINTVFPGIG.DNVKTTVDQPKSWLSFFTG
gi|91205683|ref|YP_538038.1|       ..QTATGYEIAGISSQNDKTFKKLDDFL-TAKTDINNVFSNLG.NNVTAQHKQPKTWLNKFTG
OjC_gi|383843178|ref|YP_005423681.1| ..DSSPGYQINNISSQNDKVFKQLNQFL-EEKRNIQNIFPKLQnNNLTIEFKNAKTFLNKFTG
hdn_gi|383752341|ref|YP_005427441.1| ..DSSPGYQINNISSQNDKVFKQLNQFL-EEKRNIQNIFPKLQnNNLTIEFKNAKTFLNKFTG
ky9_gi|478693609|ref|YP_007750516.1| ..DSSPGYQINNISSQNDKTFKQLNQFL-EEKRNIQNIFPKLQnNNLTIEFKNPKTFLSKFTG
I6w_gi|478693131|ref|YP_007750039.1| ..DSSPGYQINNISSQNDKTFKQLNQFL-EEKRNIQNIFPKLQnNNLTIEFKNPKTFLSKFTG
kCJ_gi|383500450|ref|YP_005413810.1| ..DSSPGYQINNISSQNDKTFKQLNQFL-EEKRNIQNIFPKLQnNNLTIEFKNPKTFLSKFTG
k9H_gi|383487210|ref|YP_005404890.1| ..DSSPGYQINNISSQNDKTFKQLNQFL-EEKRNIQNIFPKLQnNNLTIEFKNPKTFLSKFTG
jy6_gi|383489475|ref|YP_005407152.1| ..DSSPGYQINNISSQNDKTFKQLNQFL-EEKRNIQNIFPKLQnNNLTIEFKNPKTFLSKFTG
kAN_gi|383488635|ref|YP_005406313.1| ..DSSPGYQINNISSQNDKTFKQLNQFL-EEKRNIQNIFPKLQnNNLTIEFKNPKTFLSKFTG
jsG_gi|383487788|ref|YP_005405467.1| ..DSSPGYQINNISSQNDKTFKQLNQFL-EEKRNIQNIFPKLQnNNLTIEFKNPKTFLSKFTG
kAX_gi|386082219|ref|YP_005998796.1| ..DSSPGYQINNISSQNDKTFKQLNQFL-EEKRNIQNIFPKLQnNNLTIEFKNPKTFLSKFTG
gi|15604241|ref|NP_220757.1|       ..DSSPGYQINNISSQNDKTFKQLNQFL-EEKRNIQNIFPKLQnNNLTIEFKNPKTFLSKFTG
gi|54297877|ref|YP_124246.1|       ..KTSPGYELNSTTLNKDSTFKKLDSFLHSTDVNINTVFPGIG.DNVKTTVDQPKSWLSFFTG
gi|54294840|ref|YP_127255.1|       ..KTSPGYELNSTTLNKDSTFKKLNSFLYSTDANINTVFPGIG.DNVKTTVDQPKSWLSFFTG
SHC_gi|470181905|ref|YP_007567780.1| ..KTSPGYELTSTTLNKDSTFKKLDSFLHSTDVNINTVFPGIG.DNVKTTVDQPKSWLSFFTG
E4w_gi|509151256|ref|YP_008063630.1| ..KTSPGYELTSTTLNKDSTFKKLDSFLHSTDVNINTVFPGIG.DNVKTTVDQPKSWLSFFTG


                                             70        80        90       100             110       
                                              |         |         |         |               |       
d1xsza2                              YKGTITLTDNKTSAQATIQVYTPNIFSKWLFGEQPRVIIQP......GQTKESIDLAAKAAAD
Pr5_ENSFALP00000006552               YEGQLKQLQEA-AQGPTITMPRDNIYQDYID----------......---SKFESLRQEIIEG
gi|157826859|ref|YP_001495923.1|   YEGSVSVKAG--NAEVEIQVYKPNILSKWFLGEKSKLVIQPk.....GGSEQSLKLAAQIAAS
gi|51473566|ref|YP_067323.1|       YKGNVIIQDEQ-CGKAEIQVYKPSIFSRWFLGEKSKIIIQPlredgkQPSEQSLELAAQITAS
jkW_gi|383499614|ref|YP_005412975.1| YKGSVIIKDEK-SGAAEIQVYKPSIFSRWFLGEKSKIIIQPlreegrQPSEQSLKLAAQITAS
gi|67458977|ref|YP_246601.1|       YEGSVIVKDEK-GGKAEIQVYKPSVFSRWFSGEKSKIIIQPlseegkQPSEQSLKLAAQITAN
ioy_gi|383501828|ref|YP_005415187.1| YEGSVIVKDEK-GGKAAIQVYTPSVFSRWFLGEKSKIIIQPlseegkQPSEQSLKLAAQITAS
gi|157825637|ref|YP_001493357.1|   YEGSVIVKDEK-GGKATIQVYKPSVFSRWFLGEKSKIIIQPlseegkQPSEQSLTLASQITAS
gi|289164734|ref|YP_003454872.1|   YEGTIKFTTESGRELANIQIYKPSLVSKWLFGAQPKVIIQPidqd..ENPKEAIELAAKIAVL
gi|148359513|ref|YP_001250720.1|   YKGTITLTDKQTSAQATIQVYTPNIFSKWLFGEQPRVIIQP......GQTKESIDLAAKIAAG
gi|91205683|ref|YP_538038.1|       YEGSVSVKAG--NAEVEIQVYKPNILSKWFLGEKSKLVIQPk.....GGSEQSLKLAAQIAAS
OjC_gi|383843178|ref|YP_005423681.1| YKGNVIIQDEQ-CGKAEIQVYKPSIFSRWFLGEKSKIIIQPlredgkQPSEQSLELAAQITAS
hdn_gi|383752341|ref|YP_005427441.1| YKGNVIIQDEQ-CGKAEIQVYKPSIFSRWFLGEKSKIIIQPlredgkQPSEQSLELAAQITAS
ky9_gi|478693609|ref|YP_007750516.1| YKGSVIIKDEK-SGAAEIQVYKPSIFSRWFLGEKSKIIIQPlreegrQPSEQSLKLAAQITAS
I6w_gi|478693131|ref|YP_007750039.1| YKGSVIIKDEK-SGAAEIQVYKPSIFSRWFLGEKSKIIIQPlreegrQPSEQSLKLAAQITAS
kCJ_gi|383500450|ref|YP_005413810.1| YKGSVIIKDEK-SGAAEIQVYKPSIFSRWFLGEKSKIIIQPlreegrQPSEQSLKLAAQITAS
k9H_gi|383487210|ref|YP_005404890.1| YKGSVIIKDEK-SGAAEIQVYKPSIFSRWFLGEKSKIIIQPlreegrQPSEQSLKLAAQITAS
jy6_gi|383489475|ref|YP_005407152.1| YKGSVIIKDEK-SGAAEIQVYKPSIFSRWFLGEKSKIIIQPlreegrQPSEQSLKLAAQITAS
kAN_gi|383488635|ref|YP_005406313.1| YKGSVIIKDEK-SGAAEIQVYKPSIFSRWFLGEKSKIIIQPlreegrQPSEQSLKLAAQITAS
jsG_gi|383487788|ref|YP_005405467.1| YKGSVIIKDEK-SGAAEIQVYKPSIFSRWFLGEKSKIIIQPlreegrQPSEQSLKLAAQITAS
kAX_gi|386082219|ref|YP_005998796.1| YKGSVIIKDEK-SGAAEIQVYKPSIFSRWFLGEKSKIIIQPlreegrQPSEQSLKLAAQITAS
gi|15604241|ref|NP_220757.1|       YKGSVIIKDEK-SGAAEIQVYKPSIFSRWFLGEKSKIIIQPlreegrQPSEQSLKLAAQITAS
gi|54297877|ref|YP_124246.1|       YKGTITLTDKQTSAQATIQVYTPNILSKWLFGEQPKVIIQP......GQTKESIDLAAKVAAG
gi|54294840|ref|YP_127255.1|       YKGTITLTDKQTSAQATIQVYTPNIFSKWLFGEQPRVIIQP......GQTKESIDLAAKAAAG
SHC_gi|470181905|ref|YP_007567780.1| YKGTITLTDNKTSAQATIQVYTPNIFSKWLFGEQPRVIIQP......GQTKESIDLAAKAAAD
E4w_gi|509151256|ref|YP_008063630.1| YKGTITLTDNKTSAQATIQVYTPNIFSKWLFGEQPRVIIQP......GQTKESIDLAAKAAAD


                                     120       130       140       150            
                                       |         |         |         |            
d1xsza2                              FSSPVKNFKATYDYEVGDLIKAYDNQKKLITIERN-----lalka
Pr5_ENSFALP00000006552               FEKKMTDLKNSCEYRLEDIQQQYDDSEN------------n....
gi|157826859|ref|YP_001495923.1|   FETKVTSIKATYDYLKQDLENYYNNPEQELRKANLVVD--l....
gi|51473566|ref|YP_067323.1|       FETEVTSIKATYDYLKEDLKSKYDNIRNAKQELERI----st...
jkW_gi|383499614|ref|YP_005412975.1| FETKVTSIKATYDYLKEDLKSQYDNIRNPKKELEKASA--i....
gi|67458977|ref|YP_246601.1|       FETKVTSIKATYDYLKEDLKSWYENIRNPKKELERA----ss...
ioy_gi|383501828|ref|YP_005415187.1| FDTKVTSIKATYDYLKEDLKSRYENIINPKQELERA----ss...
gi|157825637|ref|YP_001493357.1|   FETKVTSVKATYDYLKEDLKSRYENISNPKQELERA----ss...
gi|289164734|ref|YP_003454872.1|   FESPVNSFKATYDYELSELISAYDQQHKE-----------l....
gi|148359513|ref|YP_001250720.1|   FSSPVKNFKATYDYEAGDLIKAYDNQKKLISTNKNTVI--k....
gi|91205683|ref|YP_538038.1|       FETKVTSIKATYDYLKQDLENYYNNPEQELRKANSVVDLH.....
OjC_gi|383843178|ref|YP_005423681.1| FETEVTSIKATYDYLKEDLKSKYDNIRNAKQELERI----st...
hdn_gi|383752341|ref|YP_005427441.1| FETEVTSIKATYDYLKEDLKSKYDNIRNAKQELERI----st...
ky9_gi|478693609|ref|YP_007750516.1| FETKVTSIKATYDYLKEDLKSQYDNIRNPKKELEKASA--i....
I6w_gi|478693131|ref|YP_007750039.1| FETKVTSIKATYDYLKEDLKSQYDNIRNPKKELEKASA--i....
kCJ_gi|383500450|ref|YP_005413810.1| FETKVTSIKATYDYLKEDLKSQYDNIRNPKKELEKASA--i....
k9H_gi|383487210|ref|YP_005404890.1| FETKVTSIKATYDYLKEDLKSQYDNIRNPKKELEKASA--i....
jy6_gi|383489475|ref|YP_005407152.1| FETKVTSIKATYDYLKEDLKSQYDNIRNPKKELEKASA--i....
kAN_gi|383488635|ref|YP_005406313.1| FETKVTSIKATYDYLKEDLKSQYDNIRNPKKELEKASA--i....
jsG_gi|383487788|ref|YP_005405467.1| FETKVTSIKATYDYLKEDLKSQYDNIRNPKKELEKASA--i....
kAX_gi|386082219|ref|YP_005998796.1| FETKVTSIKATYDYLKEDLKSQYDNIRNPKKELEKASA--i....
gi|15604241|ref|NP_220757.1|       FETKVTSIKATYDYLKEDLKSQYDNIRNPKKELEKASA--i....
gi|54297877|ref|YP_124246.1|       FSSPVKNFKATYDYEVGDLIKAYDNQKKLISTNKNT----lf...
gi|54294840|ref|YP_127255.1|       FSSPVKNFKATYDYEVGDLIKAYDNQKKLISPNKNMVI--k....
SHC_gi|470181905|ref|YP_007567780.1| FSSPVKNFKATYDYEVGDLIKAYDNQKKLIT---------iern.
E4w_gi|509151256|ref|YP_008063630.1| FSSPVKNFKATYDYEVGDLIKAYDNQKKLIT---------iern.


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0051098 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Rickettsia bellii OSU 85-389
NoYes   Rickettsia typhi str. Wilmington
NoYes   Rickettsia prowazekii str. BuV67-CWPP
NoYes   Rickettsia felis URRWXCal2
NoYes   Rickettsia australis str. Cutlack
NoYes   Rickettsia akari str. Hartford
NoYes   Legionella longbeachae NSW150
NoYes   Legionella pneumophila str. Corby
NoYes   Rickettsia bellii RML369-C
NoYes   Rickettsia typhi str. B9991CWPP
NoYes   Rickettsia typhi str. TH1527
NoYes   Rickettsia prowazekii str. Breinl
NoYes   Rickettsia prowazekii str. NMRC Madrid E
NoYes   Rickettsia prowazekii str. RpGvF24
NoYes   Rickettsia prowazekii str. GvV257
NoYes   Rickettsia prowazekii str. Dachau
NoYes   Rickettsia prowazekii str. Katsinyian
NoYes   Rickettsia prowazekii str. Chernikova
NoYes   Rickettsia prowazekii Rp22
NoYes   Rickettsia prowazekii str. Madrid E
NoYes   Legionella pneumophila str. Paris
NoYes   Legionella pneumophila str. Lens
NoYes   Legionella pneumophila subsp. pneumophila LPE509
NoYes   Legionella pneumophila subsp. pneumophila str. Thunder Bay
NoYes   Legionella pneumophila subsp. pneumophila str. Philadelphia 1
NoYes   Legionella pneumophila subsp. pneumophila
NoYes   Legionella pneumophila subsp. pneumophila
NoYes   Legionella pneumophila subsp. pneumophila ATCC 43290
NoYes   Legionella pneumophila 2300/99 Alcoy
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Uniprot 2018_03 genome
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]