SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from Please contact us if you experience any problems.

Phage tail protein-like alignments in Laribacter hongkongensis HLHK9

These alignments are sequences aligned to the 0051468 model.

Sophisticated options are available for refining alignments:

Jump to [ Top of page · Refine alignments · Add alignments from genomes ]


The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                    10        20    
                                                                                     |         |    
d1z1za1                             ........................................KHTELRAAVLDALEKHDTGATFFD
gi|226940569|ref|YP_002795643.1|  irqlqdslpasvevcgcpenreelrrpfddgrvlvvyggg------------------------

                                        30        40        50        60        70        80        
                                         |         |         |         |         |         |        
gi|226940569|ref|YP_002795643.1|  ----------K-----------------------------------------------------

                                    90       100       110       120                                
                                     |         |         |         |                                
d1z1za1                             SDIPALSDLITSMVASGYDYRRDDDAGLWSSADLTYVITYE.......................
gi|226940569|ref|YP_002795643.1|  -----------------------------------------saaprdasgagqyrseewmlviq

d1z1za1                             ....................................
gi|226940569|ref|YP_002795643.1|  hakrsrliglvdavtliltgfrppgaagrmrhvads

Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:

Model: 0051468 (list models)
Initial SAMT99 seed:

Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues

Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.

Select to display   Genome
NoYes   Ignavibacterium album JCM 16511
NoYes   Chloroherpeton thalassium ATCC 35110
NoYes   Pseudogulbenkiania sp. NH8B
NoYes   Laribacter hongkongensis HLHK9
NoYes   Chromobacterium violaceum ATCC 12472
NoYes   Neisseria meningitidis alpha14
NoYes   Neisseria lactamica 020-06
NoYes   Cupriavidus necator N-1
NoYes   Ralstonia solanacearum CFBP2957
NoYes   Pseudovibrio sp. FO-BEG1
NoYes   Rhodospirillum centenum SW
NoYes   Gallibacterium anatis UMN179
NoYes   Haemophilus parasuis SH0165
NoYes   Actinobacillus pleuropneumoniae serovar 5b str. L20
NoYes   Methylococcus capsulatus str. Bath
NoYes   Photorhabdus luminescens subsp. laumondii TTO1
NoYes   Rahnella sp. Y9602
NoYes   Serratia sp. AS12
NoYes   Serratia plymuthica AS9
NoYes   Pectobacterium wasabiae WPP163
NoYes   Pectobacterium sp. SCC3193
NoYes   Pectobacterium atrosepticum SCRI1043
NoYes   Pectobacterium carotovorum subsp. carotovorum PC1
NoYes   Sodalis glossinidius str. 'morsitans'
NoYes   Shigella sonnei Ss046
NoYes   Shigella flexneri 5 str. 8401
NoYes   Shigella boydii CDC 3083-94
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
NoYes   Escherichia fergusonii ATCC 35469
NoYes   Escherichia coli 'BL21-Gold(DE3)pLysS AG'
NoYes   Citrobacter rodentium ICC168
NoYes   Burkholderia cenocepacia J2315
NoYes   Mannheimia succiniciproducens MBEL55E
NoYes   Mannheimia haemolytica USMARC_2286
NoYes   Mannheimia haemolytica M42548
NoYes   Mannheimia haemolytica D174
NoYes   Mannheimia haemolytica D171
NoYes   Mannheimia haemolytica D153
NoYes   Mannheimia haemolytica USDA-ARS-USMARC-183
NoYes   Mannheimia haemolytica USDA-ARS-USMARC-185
NoYes   Pasteurella multocida subsp. multocida str. HN06
NoYes   Haemophilus parasuis ZJ0906
NoYes   Haemophilus influenzae F3031
NoYes   Haemophilus influenzae 10810
NoYes   Actinobacillus suis H91-0380
NoYes   Actinobacillus pleuropneumoniae serovar 7 str. AP76
NoYes   Vibrio sp. EJY3
NoYes   Edwardsiella tarda FL6-60
NoYes   Rahnella aquatilis HX2
NoYes   Serratia sp. AS13
NoYes   Pectobacterium carotovorum subsp. carotovorum PCC21
NoYes   Shigella sonnei 53G
NoYes   Shigella flexneri 2002017
NoYes   Shigella flexneri 2a str. 2457T
NoYes   Shigella flexneri 2a str. 301
NoYes   Shigella boydii Sb227
NoYes   Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. 08-1736
NoYes   Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633
NoYes   Salmonella enterica subsp. enterica Serovar Cubana str. CFSAN002050
NoYes   Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67
NoYes   Salmonella enterica subsp. enterica serovar Newport str. USMARC-S3124.1
NoYes   Salmonella enterica subsp. enterica serovar Newport str. SL254
NoYes   Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium var. 5- str. CFSAN001921
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. U288
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. 798
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. UK-1
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. ST4/74
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. T000240
NoYes   Salmonella enterica The genome of subsp. enterica serovar Typhimurium str. DT2
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. D23580
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium Definitive Type 104
NoYes   Salmonella enterica subsp. enterica serovar Typhi str. P-stx-12
NoYes   Salmonella enterica subsp. enterica serovar Typhi str. Ty21a
NoYes   Salmonella enterica subsp. enterica serovar Typhi str. CT18
NoYes   Salmonella enterica subsp. enterica serovar Typhi str. Ty2
NoYes   Salmonella enterica serovar Bovismorbificans genomics
NoYes   Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000189
NoYes   Salmonella enterica subsp. enterica serovar Agona str. 24249
NoYes   Salmonella enterica subsp. enterica serovar Agona str. SL483
NoYes   Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
NoYes   Salmonella enterica subsp. enterica Serovar Heidelberg str. CFSAN002069
NoYes   Salmonella enterica subsp. enterica serovar Heidelberg str. B182
NoYes   Salmonella enterica subsp. enterica serovar Heidelberg str. 41578
NoYes   Salmonella enterica subsp. enterica serovar Heidelberg str. SL476
NoYes   Salmonella enterica subsp. enterica serovar Pullorum str. S06004
NoYes   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. CDC1983-67
NoYes   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078
NoYes   Salmonella enterica subsp. enterica serovar Thompson str. RM6836
NoYes   Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91
NoYes   Klebsiella oxytoca KCTC 1686
NoYes   Enterobacter aerogenes EA1509E
NoYes   Escherichia coli E. coli PMV-1
NoYes   Escherichia coli JJ1886
NoYes   Escherichia coli LY180
NoYes   Escherichia coli O7:K1 str. CE10
NoYes   Escherichia coli O104:H4 str. 2009EL-2050
NoYes   Escherichia coli O104:H4 str. 2009EL-2071
NoYes   Escherichia coli O104:H4 str. 2011C-3493
NoYes   Escherichia coli NA114
NoYes   Escherichia coli str. 'clone D i2'
NoYes   Escherichia coli str. 'clone D i14'
NoYes   Escherichia coli UM146
NoYes   Escherichia coli 042
NoYes   Escherichia coli Xuzhou21
NoYes   Escherichia coli IHE3034
NoYes   Escherichia coli UMNK88
NoYes   Escherichia coli O83:H1 str. NRG 857C
NoYes   Escherichia coli ABU 83972
NoYes   Escherichia coli KO11FL
NoYes   Escherichia coli KO11FL
NoYes   Escherichia coli LF82
NoYes   Escherichia coli ED1a
NoYes   Escherichia coli IAI39
NoYes   Escherichia coli UMN026
NoYes   Escherichia coli 55989
NoYes   Escherichia coli S88
NoYes   Escherichia coli IAI1
NoYes   Escherichia coli W
NoYes   Escherichia coli W
NoYes   Escherichia coli ATCC 8739
NoYes   Escherichia coli BL21(DE3)
NoYes   Escherichia coli BL21(DE3)
NoYes   Escherichia coli SE15
NoYes   Escherichia coli SE11
NoYes   Escherichia coli APEC O1
NoYes   Escherichia coli O103:H2 str. 12009
NoYes   Escherichia coli UTI89
NoYes   Escherichia coli 536
NoYes   Escherichia coli ETEC H10407
NoYes   Escherichia coli O55:H7 str. RM12579
NoYes   Escherichia coli O55:H7 str. CB9615
NoYes   Escherichia coli O26:H11 str. 11368
NoYes   Escherichia coli CFT073
NoYes   Escherichia coli O111:H- str. 11128
NoYes   Escherichia coli O127:H6 str. E2348/69
NoYes   Escherichia coli O157:H7 str. TW14359
NoYes   Escherichia coli O157:H7 str. EC4115
NoYes   Escherichia coli O157:H7 str. Sakai
NoYes   Escherichia coli O157:H7 str. EDL933
NoYes   Escherichia coli BW2952
NoYes   Enterobacter cloacae SCF1
NoYes   Enterobacter cloacae subsp. cloacae ATCC 13047
NoYes   Pseudomonas aeruginosa SCV20265
NoYes   Pseudomonas aeruginosa PA1R
NoYes   Pseudomonas aeruginosa PA1
NoYes   Combined (meta-genome)
NoYes   Cyphomyrmex longiscapus fungus garden (meta-genome)
NoYes   Dump bottom (Dump bottom) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Freshwater propionate enrichment of Brocadia fulgida (meta-genome)
NoYes   Fungus garden combined (combined) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden bottom (Fungus garden bottom) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden top (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP20 from Bath Lake Vista Annex - Purple-Sulfur Mats (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP5 from Bath Lake Vista Annex (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP7 from Chocolate Pots (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Soil microbial communities from Minnesota Farm (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Uniprot 2018_03 genome
NoYes   Wastewater Terephthalate-degrading communities from Bioreactor (meta-genome)
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   NCBI viral sequences (Viral)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   The Salmonella enterica Pan-genome (meta-genome)
NoYes   UniProt viral sequences (Viral)
NoYes   ALL (only advised for small superfamilies)

Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]