SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

PMT central region-like alignments

These alignments are sequences aligned to the 0053875 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                               10        20        30        40        50        60 
                                                |         |         |         |         |         | 
d2ebfx1                              lg--GSPYSPFRIGLEGVWTPEVLKARASVIGKPIGESYKRILAKLQRIHNSNILDERQGLMH
LyG_gi|392399465|ref|YP_006436066.1| .e-----------------------------------EYKKVLQEIKQMIA------------


                                            70        80        90       100       110       120    
                                             |         |         |         |         |         |    
d2ebfx1                              ELMELIDLYEESQPSSERLNAFRELRTQLEKALYLPEMEALKKQILQIPNKGSGAARFLLRTA
LyG_gi|392399465|ref|YP_006436066.1| ---------------QSRVAALTKVNQEILLLYHNIGTQILQKQ------KQRGWGAKIIDTL


                                        130       140       150       160       170       180       
                                          |         |         |         |         |         |       
d2ebfx1                              MNEMAGKTSESTADLIRFALQDTVISAPFRGYAGAIPEAIDFPVKYVIEDISVFDKIQTNYWE
LyG_gi|392399465|ref|YP_006436066.1| SKDLSDNFPKMRGFSVRNLKNMKKFAVAYSGTQIVQPLVAQLSWTHHIILLNKFEDEKTRNWY


                                     190       200       210       220       230       240       250
                                       |         |         |         |         |         |         |
d2ebfx1                              LPAYESWNEGSNSALLPGLLRESQSKGMLSKCRIIENSLYIGHSYEEMFYSISPYSNQVGGPY
LyG_gi|392399465|ref|YP_006436066.1| IEKSAKEGWSKRVLQH-----------------------------------------------


                                            260       270       280       290       300           
                                              |         |         |         |         |           
d2ebfx1                              ELYPFTFFSMLQEVQGDLGFEQAFATRNFFNTLVSDRLSLMENTMLLT--es.........
LyG_gi|392399465|ref|YP_006436066.1| --------------------------------------------------qiqlevhkefg


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0053875 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Flexibacter litoralis DSM 6794
NoYes   Aeromonas hydrophila subsp. hydrophila ATCC 7966
NoYes   Vibrio anguillarum 775
NoYes   Vibrio vulnificus MO6-24/O
NoYes   Vibrio cholerae O395
NoYes   Photorhabdus asymbiotica
NoYes   Photorhabdus luminescens subsp. laumondii TTO1
NoYes   Xenorhabdus bovienii SS-2004
NoYes   Xenorhabdus nematophila ATCC 19061
NoYes   Proteus mirabilis HI4320
NoYes   Pasteurella multocida subsp. multocida str. HN06
NoYes   Vibrio anguillarum Listonella anguillarum M3
NoYes   Vibrio vulnificus CMCP6
NoYes   Vibrio vulnificus YJ016
NoYes   Vibrio cholerae LMA3984-4
NoYes   Vibrio cholerae M66-2
NoYes   Vibrio cholerae O395
NoYes   Vibrio cholerae IEC224
NoYes   Vibrio cholerae O1 str. 2010EL-1786
NoYes   Vibrio cholerae MJ-1236
NoYes   Vibrio cholerae O1 biovar El Tor str. N16961
NoYes   Proteus mirabilis BB2000
NoYes   NCBI 2017_08 genome
NoYes   STRING v9.0.5 (STRING)
NoYes   Uniprot 2018_03 genome
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]