SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Spectrin repeat alignments in Ciona savignyi 76_2.0

These alignments are sequences aligned to the 0048652 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                     10           20        30        40        50  
                                                      |            |         |         |         |  
d1owaa_                ....meqfpketvvessgpkvl-----------------...-ETAEEIQERRQEVLTRYQSFKERVAERGQKLEDS
ENSCSAVP00000000082  ..............gvnqener-----------------...-----------------------------------
ENSCSAVP00000000080  ..............gvnqener-----------------...-----------------------------------
ENSCSAVP00000000073  ..............gvnqener-----------------...-----------------------------------
ENSCSAVP00000000074  ..............gvnqener-----------------...-----------------------------------
ENSCSAVP00000000075  ..............gvnqener-----------------...-----------------------------------
ENSCSAVP00000000078  ..............gvnqener-----------------...-----------------------------------
ENSCSAVP00000000079  ..............gvnqener-----------------...-----------------------------------
ENSCSAVP00000000077  ..............gvnqener-----------------...-----------------------------------
ENSCSAVP00000019466  ......................-----------------...-------------------------------LESN
ENSCSAVP00000019459  ......................-----------------...-------------------------------LESN
ENSCSAVP00000019462  ......................-----------------...-------------------------------LESN
ENSCSAVP00000019463  ......................-----------------...-------------------------------LESN
ENSCSAVP00000019464  ......................-----------------...-------------------------------LESN
ENSCSAVP00000019457  ......................-----------------...-------------------------------LESN
ENSCSAVP00000019461  ......................-----------------...-------------------------------LESN
ENSCSAVP00000019458  ......................-----------------...-------------------------------LESN
ENSCSAVP00000019460  ......................-----------------...-------------------------------LESN
ENSCSAVP00000000081  ..............gvnqener-----------------...-----------------------------------
ENSCSAVP00000000281  ......................--LDKLDNEGQDMVKNN...YSSSDVIEARLIELHLQWEALLKALELRGVKLRQT
ENSCSAVP00000019464  ......................-KLDNLRDEADRLSNEH...PEEADEIRKKFEQMERVWQELRDMLRQREDSLGEA
ENSCSAVP00000019458  ......................-KLDNLRDEADRLSNEH...PEEADEIRKKFEQMERVWQELRDMLRQREDSLGEA
ENSCSAVP00000019460  ......................-KLDNLRDEADRLSNEH...PEEADEIRKKFEQMERVWQELRDMLRQREDSLGEA
ENSCSAVP00000019465  ......................-KLDNLRDEADRLSNEH...PEEADEIRKKFEQMERVWQELRDMLRQREDSLGEA
ENSCSAVP00000019462  ......................-KLDNLRDEADRLSNEH...PEEADEIRKKFEQMERVWQELRDMLRQREDSLGEA
ENSCSAVP00000019457  ......................-KLDNLRDEADRLSNEH...PEEADEIRKKFEQMERVWQELRDMLRQREDSLGEA
ENSCSAVP00000019461  ......................-KLDNLRDEADRLSNEH...PEEADEIRKKFEQMERVWQELRDMLRQREDSLGEA
ENSCSAVP00000019459  ......................-KLDNLRDEADRLSNEH...PEEADEIRKKFEQMERVWQELRDMLRQREDSLGEA
ENSCSAVP00000019463  ....................av------------LRSEG...DEDVDTMNEERAKIKHRIEDLDEPLTKRKDALENS
ENSCSAVP00000019466  ....................vl-------------RSEG...DEDVDTMNEERAKIKHRIEDLDEPLTKRKDALENS
ENSCSAVP00000019458  ....................lr--------------SEG...DEDVDTMNEERAKIKHRIEDLDEPLTKRKDALENS
ENSCSAVP00000019460  ....................lr--------------SEG...DEDVDTMNEERAKIKHRIEDLDEPLTKRKDALENS
ENSCSAVP00000019457  ....................lr--------------SEG...DEDVDTMNEERAKIKHRIEDLDEPLTKRKDALENS
ENSCSAVP00000019465  ...................cep-----------------...----SAVEDKVVGVRTTYDQLCKQAADRRAKLDES
ENSCSAVP00000019462  ...................cep-----------------...----SAVEDKVVGVRTTYDQLCKQAADRRAKLDES
ENSCSAVP00000019466  ...................cep-----------------...----SAVEDKVVGVRTTYDQLCKQAADRRAKLDES
ENSCSAVP00000019466  ......................-KLDNLRDEADRLSNEH...PEEADEIRKKFEQMERVWQELRDMLRQREDSLGEA
ENSCSAVP00000019462  ....................av------------LRSEG...DEDVDTMNEERAKIKHRIEDLDEPLTKRKDALENS
ENSCSAVP00000019463  ...................cep-----------------...----SAVEDKVVGVRTTYDQLCKQAADRRAKLDES
ENSCSAVP00000019459  ....................ep-----------------...----SAVEDKVVGVRTTYDQLCKQAADRRAKLDES
ENSCSAVP00000019464  ....................ep-----------------...----SAVEDKVVGVRTTYDQLCKQAADRRAKLDES
ENSCSAVP00000019461  ...................cep-----------------...----SAVEDKVVGVRTTYDQLCKQAADRRAKLDES
ENSCSAVP00000019457  ...................cep-----------------...----SAVEDKVVGVRTTYDQLCKQAADRRAKLDES
ENSCSAVP00000019458  ...................cep-----------------...----SAVEDKVVGVRTTYDQLCKQAADRRAKLDES
ENSCSAVP00000019460  ...................cep-----------------...----SAVEDKVVGVRTTYDQLCKQAADRRAKLDES
ENSCSAVP00000019459  ....................rs---------------EG...DEDVDTMNEERAKIKHRIEDLDEPLTKRKDALENS
ENSCSAVP00000019465  ......................-----------------...-------------------------------LESN
ENSCSAVP00000019466  ......................PQVAVVNQMARGLVQTQ...HPNSDDVSAKQNELNARWNALRALLEERREILASA
ENSCSAVP00000019463  ......................PQVAVVNQMARGLVQTQ...HPNSDDVSAKQNELNARWNALRALLEERREILASA
ENSCSAVP00000019462  ......................PQVAVVNQMARGLVQTQ...HPNSDDVSAKQNELNARWNALRALLEERREILASA
ENSCSAVP00000019459  ......................PQVAVVNQMARGLVQTQ...HPNSDDVSAKQNELNARWNALRALLEERREILASA
ENSCSAVP00000019464  ......................-----------------...-----------------------------------
ENSCSAVP00000019461  ......................PQVAVVNQMARGLVQTQ...HPNSDDVSAKQNELNARWNALRALLEERREILASA
ENSCSAVP00000019457  ......................PQVAVVNQMARGLVQTQ...HPNSDDVSAKQNELNARWNALRALLEERREILASA
ENSCSAVP00000019463  ......................-QVEAITSAGSELEGRYa..GDDLQEIQKKIEAVLSAWNNLLSLVKKRAALLSDA
ENSCSAVP00000019458  ......................-QVEAITSAGSELEGRYa..GDDLQEIQKKIEAVLSAWNNLLSLVKKRAALLSDA
ENSCSAVP00000019460  ......................-QVEAITSAGSELEGRYa..GDDLQEIQKKIEAVLSAWNNLLSLVKKRAALLSDA
ENSCSAVP00000019459  ......................-QVEAITSAGSELEGRYa..GDDLQEIQKKIEAVLSAWNNLLSLVKKRAALLSDA
ENSCSAVP00000019462  ......................-QVEAITSAGSELEGRYa..GDDLQEIQKKIEAVLSAWNNLLSLVKKRAALLSDA
ENSCSAVP00000019464  ......................-QVEAITSAGSELEGRYa..GDDLQEIQKKIEAVLSAWNNLLSLVKKRAALLSDA
ENSCSAVP00000019463  ......................-KLDNLRDEADRLSNEH...PEEADEIRKKFEQMERVWQELRDMLRQREDSLGEA
ENSCSAVP00000019466  ......................-QVEAITSAGSELEGRYa..GDDLQEIQKKIEAVLSAWNNLLSLVKKRAALLSDA
ENSCSAVP00000019465  ....................ai------TSAGSELEGRYa..GDDLQEIQKKIEAVLSAWNNLLSLVKKRAALLSDA
ENSCSAVP00000019465  ....................sv-----------------...-----EVQERLRSVDSRYKELLDFAKLRKEKLIDA
ENSCSAVP00000019458  ....................sv-----------------...-----EVQERLRSVDSRYKELLDFAKLRKEKLIDA
ENSCSAVP00000019460  ....................sv-----------------...-----EVQERLRSVDSRYKELLDFAKLRKEKLIDA
ENSCSAVP00000019464  ...................esv-----------------...-----EVQERLRSVDSRYKELLDFAKLRKEKLIDA
ENSCSAVP00000019461  ....................gd-----------------...--DLQEIQKKIEAVLSAWNNLLSLVKKRAALLSDA
ENSCSAVP00000019457  ....................gd-----------------...--DLQEIQKKIEAVLSAWNNLLSLVKKRAALLSDA
ENSCSAVP00000019459  ......................ERVADAMRMSDELINAG...HTDAQDIAGWKDTIRDAWADLLELIDTRVEMLAAA
ENSCSAVP00000019466  ......................ERVEAVLRDAGKLADAD...HHAADKIKERAEKIAERRAKNKEEAGEVSTMLRDN
ENSCSAVP00000019457  ......................ERVADAMRMSDELINAG...HTDAQDIAGWKDTIRDAWADLLELIDTRVEMLAAA
ENSCSAVP00000019457  ......................ERVEAVLRDAGKLADAD...HHAADKIKERAEKIAERRAKNKEEAGEVSTMLRDN
ENSCSAVP00000019465  ......................ERVEAVLRDAGKLADAD...HHAADKIKERAEKIAERRAKNKEEAGEVSTMLRDN
ENSCSAVP00000019462  ......................ERVEAVLRDAGKLADAD...HHAADKIKERAEKIAERRAKNKEEAGEVSTMLRDN
ENSCSAVP00000019459  ......................ERVEAVLRDAGKLADAD...HHAADKIKERAEKIAERRAKNKEEAGEVSTMLRDN
ENSCSAVP00000019458  ......................ERVEAVLRDAGKLADAD...HHAADKIKERAEKIAERRAKNKEEAGEVSTMLRDN
ENSCSAVP00000019460  ......................ERVEAVLRDAGKLADAD...HHAADKIKERAEKIAERRAKNKEEAGEVSTMLRDN
ENSCSAVP00000019461  ......................ERVEAVLRDAGKLADAD...HHAADKIKERAEKIAERRAKNKEEAGEVSTMLRDN
ENSCSAVP00000019463  ......................ERVEAVLRDAGKLADAD...HHAADKIKERAEKIAERRAKNKEEAGEVSTMLRDN
ENSCSAVP00000019464  ......................ERVEAVLRDAGKLADAD...HHAADKIKERAEKIAERRAKNKEEAGEVSTMLRDN
ENSCSAVP00000019461  ....................lr--------------SEG...DEDVDTMNEERAKIKHRIEDLDEPLTKRKDALENS
ENSCSAVP00000019465  ......................ERVADAMRMSDELINAG...HTDAQDIAGWKDTIRDAWADLLELIDTRVEMLAAA
ENSCSAVP00000019462  ......................ERVADAMRMSDELINAG...HTDAQDIAGWKDTIRDAWADLLELIDTRVEMLAAA
ENSCSAVP00000019462  ....................vc-------HRGVAMATED...NPNTDKINEKCHELQENWNRLLEDVDERKRKLSEA
ENSCSAVP00000019464  ....................vc-------HRGVAMATED...NPNTDKINEKCHELQENWNRLLEDVDERKRKLSEA
ENSCSAVP00000019463  ....................vc-------HRGVAMATED...NPNTDKINEKCHELQENWNRLLEDVDERKRKLSEA
ENSCSAVP00000019458  ....................vc-------HRGVAMATED...NPNTDKINEKCHELQENWNRLLEDVDERKRKLSEA
ENSCSAVP00000019459  ....................vc-------HRGVAMATED...NPNTDKINEKCHELQENWNRLLEDVDERKRKLSEA
ENSCSAVP00000019460  ....................vc-------HRGVAMATED...NPNTDKINEKCHELQENWNRLLEDVDERKRKLSEA
ENSCSAVP00000000080  .....................i-----------------...-------------------------------LESI
ENSCSAVP00000000077  .....................i-----------------...-------------------------------LESI
ENSCSAVP00000000081  .....................i-----------------...-------------------------------LESI
ENSCSAVP00000000073  .....................i-----------------...-------------------------------LESI
ENSCSAVP00000000074  .....................i-----------------...-------------------------------LESI
ENSCSAVP00000000075  .....................i-----------------...-------------------------------LESI
ENSCSAVP00000000078  .....................i-----------------...-------------------------------LESI
ENSCSAVP00000000079  .....................i-----------------...-------------------------------LESI
ENSCSAVP00000000082  ................erldhl-----------------...-----------------------------------
ENSCSAVP00000000081  ................erldhl-----------------...-----------------------------------
ENSCSAVP00000000281  ...................att-----------------...-----------------------------------
ENSCSAVP00000000080  ................erldhl-----------------...-----------------------------------
ENSCSAVP00000000077  ................erldhl-----------------...-----------------------------------
ENSCSAVP00000000073  ................erldhl-----------------...-----------------------------------
ENSCSAVP00000000074  ................erldhl-----------------...-----------------------------------
ENSCSAVP00000000075  ................erldhl-----------------...-----------------------------------
ENSCSAVP00000000078  ................erldhl-----------------...-----------------------------------
ENSCSAVP00000000079  ................erldhl-----------------...-----------------------------------
ENSCSAVP00000019464  ......................ERVADAMRMSDELINAG...HTDAQDIAGWKDTIRDAWADLLELIDTRVEMLAAA
ENSCSAVP00000019465  ......................-----------------...-----------------------------------
ENSCSAVP00000019466  ......................-----------------...-----------------------------------
ENSCSAVP00000019459  ......................-----------------...-----------------------------------
ENSCSAVP00000019462  ......................-----------------...-----------------------------------
ENSCSAVP00000019463  ......................-----------------...-----------------------------------
ENSCSAVP00000019458  ......................-----------------...-----------------------------------
ENSCSAVP00000019460  ......................-----------------...-----------------------------------
ENSCSAVP00000019457  ......................-----------------...-----------------------------------
ENSCSAVP00000019461  ......................-----------------...-----------------------------------
ENSCSAVP00000019464  ......................-----------------...-----------------------------------
ENSCSAVP00000019457  .....................a-----VCHRGVAMATED...NPNTDKINEKCHELQENWNRLLEDVDERKRKLSEA
ENSCSAVP00000019462  .....................k-----------------...-----------------------------------
ENSCSAVP00000019463  .....................k-----------------...-----------------------------------
ENSCSAVP00000019457  .....................k-----------------...-----------------------------------
ENSCSAVP00000019461  .....................k-----------------...-----------------------------------
ENSCSAVP00000019466  ....................vc-------HRGVAMATED...NPNTDKINEKCHELQENWNRLLEDVDERKRKLSEA
ENSCSAVP00000019465  ......................-----------------...-----------------------------------
ENSCSAVP00000019461  ......................-----------------...-----------------------------------
ENSCSAVP00000019466  .....................l-----------------...-----------------------------------
ENSCSAVP00000019465  .....................i-----------------...-----------------------------------
ENSCSAVP00000019459  .....................i-----------------...-----------------------------------
ENSCSAVP00000019464  .....................i-----------------...-----------------------------------
ENSCSAVP00000019458  .....................i-----------------...-----------------------------------
ENSCSAVP00000019460  .....................i-----------------...-----------------------------------
ENSCSAVP00000019457  ......................-----------------...---------------------------RRTRLELN
ENSCSAVP00000019464  ......................-----------------...---------------------------RRTRLELN
ENSCSAVP00000019459  ......................-----------------...---------------------------RRTRLELN
ENSCSAVP00000019466  ......................ERVADAMRMSDELINAG...HTDAQDIAGWKDTIRDAWADLLELIDTRVEMLAAA
ENSCSAVP00000019461  ......................ERVADAMRMSDELINAG...HTDAQDIAGWKDTIRDAWADLLELIDTRVEMLAAA
ENSCSAVP00000019458  ......................ERVADAMRMSDELINAG...HTDAQDIAGWKDTIRDAWADLLELIDTRVEMLAAA
ENSCSAVP00000019460  ......................ERVADAMRMSDELINAG...HTDAQDIAGWKDTIRDAWADLLELIDTRVEMLAAA
ENSCSAVP00000000281  ......................-----------------...-----------------------------------
ENSCSAVP00000019463  .....................d-----------------...-----------------------------------
ENSCSAVP00000019465  ......................-----------------...-----------------------------------
ENSCSAVP00000019466  ......................-----------------...-----------------------------------
ENSCSAVP00000019463  ......................-----------------...-----------------------------------
ENSCSAVP00000019462  ......................-----------------...-----------------------------------
ENSCSAVP00000019461  ......................-----------------...-----------------------------------
ENSCSAVP00000019458  ......................-----------------...-----------------------------------
ENSCSAVP00000019460  ......................-----------------...-----------------------------------
ENSCSAVP00000019465  ....................qv------------LRSEG...DEDVDTMNEERAKIKHRIEDLDEPLTKRKDALENS
ENSCSAVP00000019466  ......................DTIQQLSKTCRDLCEQE...HPQSEQLSTRQQQVDQTYAGLKDLAEERRMKLRER
ENSCSAVP00000019457  ......................DTIQQLSKTCRDLCEQE...HPQSEQLSTRQQQVDQTYAGLKDLAEERRMKLRER
ENSCSAVP00000000080  .................hellr-----------------...-----------------------------------
ENSCSAVP00000000081  .................hellr-----------------...-----------------------------------
ENSCSAVP00000000074  .................hellr-----------------...-----------------------------------
ENSCSAVP00000000077  .................hellr-----------------...-----------------------------------
ENSCSAVP00000000075  .................hellr-----------------...-----------------------------------
ENSCSAVP00000000078  .................hellr-----------------...-----------------------------------
ENSCSAVP00000000079  .................hellr-----------------...-----------------------------------
ENSCSAVP00000019464  ..................lfea-----------------...-----------------------------------
ENSCSAVP00000000073  .................hellr-----------------...-----------------------------------
ENSCSAVP00000009334  ......................-----------------...-----------------------------------
ENSCSAVP00000006249  .....................r-----------------...-----------------------------------
ENSCSAVP00000003575  ....................fw-----------------...-------------------------LKYKEKMKQC
ENSCSAVP00000003574  ....................fw-----------------...-------------------------LKYKEKMKQC
ENSCSAVP00000003576  ....................fw-----------------...-------------------------LKYKEKMKQC
ENSCSAVP00000004591  ...................pmq-----------------...---LKRISELATELREVWKVTQKKSIQLKLHINKL
ENSCSAVP00000000076  egvqrklddfrdyrakqkppki-----------------...--------------------------D--------
ENSCSAVP00000003574  .....................v------RQHGCDLVAAG...HYAVDCIQPKTDELQNQTCEIKEQITELQCSFKS-
ENSCSAVP00000003576  .....................r-------QHGCDLVAAG...HYAVDCIQPKTDELQNQTCEIKEQITELQCSFKS-
ENSCSAVP00000019465  .....................e-----------------...-----------------------------------
ENSCSAVP00000019464  .....................e-----------------...-----------------------------------
ENSCSAVP00000019461  .....................e-----------------...-----------------------------------
ENSCSAVP00000019466  .....................e-----------------...-----------------------------------
ENSCSAVP00000019457  .....................e-----------------...-----------------------------------
ENSCSAVP00000019462  .....................e-----------------...-----------------------------------
ENSCSAVP00000019459  .....................e-----------------...-----------------------------------
ENSCSAVP00000019463  .....................e-----------------...-----------------------------------
ENSCSAVP00000019458  .....................e-----------------...-----------------------------------
ENSCSAVP00000019460  .....................e-----------------...-----------------------------------
ENSCSAVP00000013053  ......................DRVRTLENRISELLDAAakqSEEAATLRATTTSLDREKDALQAALDERTERAAAL


                              60        70           80          90        100           110       1
                               |         |            |           |          |             |        
d1owaa_                Y.HLQVFKRDADDLGKWIMEKVNILTD...KSYE..DPTNIQGKYQKHQSLEA.EVQTK....SRLMSELEKTREER
ENSCSAVP00000000082  -.LMDEYERLASDLLEWIARMKPWLDD...RTTDn.TMEGVQRKLDDFRDYRA.K----....--------------
ENSCSAVP00000000080  -.LMDEYERLASDLLEWIARMKPWLDD...RTTDn.TMEGVQRKLDDFRDYRA.K----....--------------
ENSCSAVP00000000073  -.LMDEYERLASDLLEWIARMKPWLDD...RTTDn.TMEGVQRKLDDFRDYRA.K----....--------------
ENSCSAVP00000000074  -.LMDEYERLASDLLEWIARMKPWLDD...RTTDn.TMEGVQRKLDDFRDYRA.K----....--------------
ENSCSAVP00000000075  -.LMDEYERLASDLLEWIARMKPWLDD...RTTDn.TMEGVQRKLDDFRDYRA.K----....--------------
ENSCSAVP00000000078  -.LMDEYERLASDLLEWIARMKPWLDD...RTTDn.TMEGVQRKLDDFRDYRA.K----....--------------
ENSCSAVP00000000079  -.LMDEYERLASDLLEWIARMKPWLDD...RTTDn.TMEGVQRKLDDFRDYRA.K----....--------------
ENSCSAVP00000000077  -.LMDEYERLASDLLEWIARMKPWLDD...RTTDn.TMEGVQRKLDDFRDYRA.K----....--------------
ENSCSAVP00000019466  Q.MVEKYDSLASDLLDWIEQTIEILND...RTFAn.SLSGVSAQLAAFNNYRT.AEKPQkfqeKGNLEVLLFTLQSK
ENSCSAVP00000019459  Q.MVEKYDSLASDLLDWIEQTIEILND...RTFAn.SLSGVSAQLAAFNNYRT.AEKPQkfqeKGNLEVLLFTLQSK
ENSCSAVP00000019462  Q.MVEKYDSLASDLLDWIEQTIEILND...RTFAn.SLSGVSAQLAAFNNYRT.AEKPQkfqeKGNLEVLLFTLQSK
ENSCSAVP00000019463  Q.MVEKYDSLASDLLDWIEQTIEILND...RTFAn.SLSGVSAQLAAFNNYRT.AEKPQkfqeKGNLEVLLFTLQSK
ENSCSAVP00000019464  Q.MVEKYDSLASDLLDWIEQTIEILND...RTFAn.SLSGVSAQLAAFNNYRT.AEKPQkfqeKGNLEVLLFTLQSK
ENSCSAVP00000019457  Q.MVEKYDSLASDLLDWIEQTIEILND...RTFAn.SLSGVSAQLAAFNNYRT.AEKPQkfqeKGNLEVLLFTLQSK
ENSCSAVP00000019461  Q.MVEKYDSLASDLLDWIEQTIEILND...RTFAn.SLSGVSAQLAAFNNYRT.AEKPQkfqeKGNLEVLLFTLQSK
ENSCSAVP00000019458  Q.MVEKYDSLASDLLDWIEQTIEILND...RTFAn.SLSGVSAQLAAFNNYRT.AEKPQkfqeKGNLEVLLFTLQSK
ENSCSAVP00000019460  Q.MVEKYDSLASDLLDWIEQTIEILND...RTFAn.SLSGVSAQLAAFNNYRT.AEKPQkfqeKGNLEVLLFTLQSK
ENSCSAVP00000000081  -.LMDEYERLASDLLEWIARMKPWLDD...RTTDn.TMEGVQRKLDDFRDYRA.K----....--------------
ENSCSAVP00000000281  F.LLIDFQRKCDEVLYWIRDKEIVVTS...TDSGn.DLEHVNMLVAKFEEFQS.ELQGY....SDRVKDVNDGADRL
ENSCSAVP00000019464  G.NLQKFLRDLDRFQAWLSTTQTTIAS...EDMPq.SLPEAEKLLQQHQAIKL.EIDNY....QADYEEIKSTGAQV
ENSCSAVP00000019458  G.NLQKFLRDLDRFQAWLSTTQTTIAS...EDMPq.SLPEAEKLLQQHQAIKL.EIDNY....QADYEEIKSTGAQV
ENSCSAVP00000019460  G.NLQKFLRDLDRFQAWLSTTQTTIAS...EDMPq.SLPEAEKLLQQHQAIKL.EIDNY....QADYEEIKSTGAQV
ENSCSAVP00000019465  G.NLQKFLRDLDRFQAWLSTTQTTIAS...EDMPq.SLPEAEKLLQQHQAIKL.EIDNY....QADYEEIKSTGAQV
ENSCSAVP00000019462  G.NLQKFLRDLDRFQAWLSTTQTTIAS...EDMPq.SLPEAEKLLQQHQAIKL.EIDNY....QADYEEIKSTGAQV
ENSCSAVP00000019457  G.NLQKFLRDLDRFQAWLSTTQTTIAS...EDMPq.SLPEAEKLLQQHQAIKL.EIDNY....QADYEEIKSTGAQV
ENSCSAVP00000019461  G.NLQKFLRDLDRFQAWLSTTQTTIAS...EDMPq.SLPEAEKLLQQHQAIKL.EIDNY....QADYEEIKSTGAQV
ENSCSAVP00000019459  G.NLQKFLRDLDRFQAWLSTTQTTIAS...EDMPq.SLPEAEKLLQQHQAIKL.EIDNY....QADYEEIKSTGAQV
ENSCSAVP00000019463  K.QLHQFYRDVQDEKLWIDEKHPQATS...NELGn.SLQEVQALQKKHQALRS.ELTAH....EPVVVAVCHRGVAM
ENSCSAVP00000019466  K.QLHQFYRDVQDEKLWIDEKHPQATS...NELGn.SLQEVQALQKKHQALRS.ELTAH....EPVVVAVCHRGVAM
ENSCSAVP00000019458  K.QLHQFYRDVQDEKLWIDEKHPQATS...NELGn.SLQEVQALQKKHQALRS.ELTAH....EPVVVAVCHRGVAM
ENSCSAVP00000019460  K.QLHQFYRDVQDEKLWIDEKHPQATS...NELGn.SLQEVQALQKKHQALRS.ELTAH....EPVVVAVCHRGVAM
ENSCSAVP00000019457  K.QLHQFYRDVQDEKLWIDEKHPQATS...NELGn.SLQEVQALQKKHQALRS.ELTAH....EPVVVAVCHRGVAM
ENSCSAVP00000019465  R.RMHLFFATMAEEVAWVKEKEQLLNS...DDLGr.DLTSVHSLLTKQKALED.EMNGR....KAMLANAIAVGEDL
ENSCSAVP00000019462  R.RMHLFFATMAEEVAWVKEKEQLLNS...DDLGr.DLTSVHSLLTKQKALED.EMNGR....KAMLANAIAVGEDL
ENSCSAVP00000019466  R.RMHLFFATMAEEVAWVKEKEQLLNS...DDLGr.DLTSVHSLLTKQKALED.EMNGR....KAMLANAIAVGEDL
ENSCSAVP00000019466  G.NLQKFLRDLDRFQAWLSTTQTTIAS...EDMPq.SLPEAEKLLQQHQAIKL.EIDNY....QADYEEIKSTGAQV
ENSCSAVP00000019462  K.QLHQFYRDVQDEKLWIDEKHPQATS...NELGn.SLQEVQALQKKHQALRS.ELTAH....EPVVVAVCHRGVAM
ENSCSAVP00000019463  R.RMHLFFATMAEEVAWVKEKEQLLNS...DDLGr.DLTSVHSLLTKQKALED.EMNGR....KAMLANAIAVGEDL
ENSCSAVP00000019459  R.RMHLFFATMAEEVAWVKEKEQLLNS...DDLGr.DLTSVHSLLTKQKALED.EMNGR....KAMLANAIAVGEDL
ENSCSAVP00000019464  R.RMHLFFATMAEEVAWVKEKEQLLNS...DDLGr.DLTSVHSLLTKQKALED.EMNGR....KAMLANAIAVGEDL
ENSCSAVP00000019461  R.RMHLFFATMAEEVAWVKEKEQLLNS...DDLGr.DLTSVHSLLTKQKALED.EMNGR....KAMLANAIAVGEDL
ENSCSAVP00000019457  R.RMHLFFATMAEEVAWVKEKEQLLNS...DDLGr.DLTSVHSLLTKQKALED.EMNGR....KAMLANAIAVGEDL
ENSCSAVP00000019458  R.RMHLFFATMAEEVAWVKEKEQLLNS...DDLGr.DLTSVHSLLTKQKALED.EMNGR....KAMLANAIAVGEDL
ENSCSAVP00000019460  R.RMHLFFATMAEEVAWVKEKEQLLNS...DDLGr.DLTSVHSLLTKQKALED.EMNGR....KAMLANAIAVGEDL
ENSCSAVP00000019459  K.QLHQFYRDVQDEKLWIDEKHPQATS...NELGn.SLQEVQALQKKHQALRS.ELTAH....EPVVVAVCHRGVAM
ENSCSAVP00000019465  Q.MVEKYDSLASDLLDWIEQTIEILND...RTFAn.SLSGVSAQLAAFNNY--.-----....--------------
ENSCSAVP00000019466  K.GLHGFKLECDETEGWIKDKARVLAAgaeDQLSdrDLAGVVALQRKLSSMEL.DLAAI....QAKLDNLRDEADRL
ENSCSAVP00000019463  K.GLHGFKLECDETEGWIKDKARVLAAgaeDQLSdrDLAGVVALQRKLSSMEL.DLAAI....QAKLDNLRDEADRL
ENSCSAVP00000019462  K.GLHGFKLECDETEGWIKDKARVLAAgaeDQLSdrDLAGVVALQRKLSSMEL.DLAAI....QAKLDNLRDEADRL
ENSCSAVP00000019459  K.GLHGFKLECDETEGWIKDKARVLAAgaeDQLSdrDLAGVVALQRKLSSMEL.DLAAI....QAKLDNLRDEADRL
ENSCSAVP00000019464  -.QLHQFYRDVQDEKLWIDEKHPQATS...NELGn.SLQEVQALQKKHQALRS.ELTAH....EPVVVAVCHRGVAM
ENSCSAVP00000019461  K.GLHGFKLECDETEGWIKDKARVLAAgaeDQLSdrDLAGVVALQRKLSSMEL.DLAAI....QAKLDNLRDEADRL
ENSCSAVP00000019457  K.GLHGFKLECDETEGWIKDKARVLAAgaeDQLSdrDLAGVVALQRKLSSMEL.DLAAI....QAKLDNLRDEADRL
ENSCSAVP00000019463  L.NKFRFFNMCRDLMDWMESTVRQIDL...QEKPr.DVSGVETAMSLHQGTKA.EIDAR....NGSFEECTQLGQHL
ENSCSAVP00000019458  L.NKFRFFNMCRDLMDWMESTVRQIDL...QEKPr.DVSGVETAMSLHQGTKA.EIDAR....NGSFEECTQLGQHL
ENSCSAVP00000019460  L.NKFRFFNMCRDLMDWMESTVRQIDL...QEKPr.DVSGVETAMSLHQGTKA.EIDAR....NGSFEECTQLGQHL
ENSCSAVP00000019459  L.NKFRFFNMCRDLMDWMESTVRQIDL...QEKPr.DVSGVETAMSLHQGTKA.EIDAR....NGSFEECTQLGQHL
ENSCSAVP00000019462  L.NKFRFFNMCRDLMDWMESTVRQIDL...QEKPr.DVSGVETAMSLHQGTKA.EIDAR....NGSFEECTQLGQHL
ENSCSAVP00000019464  L.NKFRFFNMCRDLMDWMESTVRQIDL...QEKPr.DVSGVETAMSLHQGTKA.EIDAR....NGSFEECTQLGQHL
ENSCSAVP00000019463  G.NLQKFLRDLDRFQAWLSTTQTTIAS...EDMPq.SLPEAEKLLQQHQAIKL.EIDNY....QADYEEIKSTGAQV
ENSCSAVP00000019466  L.NKFRFFNMCRDLMDWMESTVRQIDL...QEKPr.DVSGVETAMSLHQGTKA.EIDAR....NGSFEECTQLGQHL
ENSCSAVP00000019465  L.NKFRFFNMCRDLMDWMESTVRQIDL...QEKPr.DVSGVETAMSLHQGTKA.EIDAR....NGSFEECTQLGQHL
ENSCSAVP00000019465  R.ALYKFYGEADTISAWIAEKEQVLEN...MLVPd.NIEDMELVQHRFEGYEN.EVNKL....APQVAVVNQMARGL
ENSCSAVP00000019458  R.ALYKFYGEADTISAWIAEKEQVLEN...MLVPd.NIEDMELVQHRFEGYEN.EVNKL....APQVAVVNQMARGL
ENSCSAVP00000019460  R.ALYKFYGEADTISAWIAEKEQVLEN...MLVPd.NIEDMELVQHRFEGYEN.EVNKL....APQVAVVNQMARGL
ENSCSAVP00000019464  R.ALYKFYGEADTISAWIAEKEQVLEN...MLVPd.NIEDMELVQHRFEGYEN.EVNKL....APQVAVVNQMARGL
ENSCSAVP00000019461  L.NKFRFFNMCRDLMDWMESTVRQIDL...QEKPr.DVSGVETAMSLHQGTKA.EIDAR....NGSFEECTQLGQHL
ENSCSAVP00000019457  L.NKFRFFNMCRDLMDWMESTVRQIDL...QEKPr.DVSGVETAMSLHQGTKA.EIDAR....NGSFEECTQLGQHL
ENSCSAVP00000019459  Y.ALHKFHYDAAEILARIQEKRQEVP-...EELGr.DHDAVENFKREHDIFAQ.DIKAI....GAQVEAITSAGSEL
ENSCSAVP00000019466  L.ALQKFVADCDELSEWVNEKMLTAKD...ATYD..DARNLHSKWQKHQAFSA.ELTAN....KDRLERLEEDGSTL
ENSCSAVP00000019457  Y.ALHKFHYDAAEILARIQEKRQEVP-...EELGr.DHDAVENFKREHDIFAQ.DIKAI....GAQVEAITSAGSEL
ENSCSAVP00000019457  L.ALQKFVADCDELSEWVNEKMLTAKD...ATYD..DARNLHSKWQKHQAFSA.ELTAN....KDRLERLEEDGSTL
ENSCSAVP00000019465  L.ALQKFVADCDELSEWVNEKMLTAKD...ATYD..DARNLHSKWQKHQAFSA.ELTAN....KDRLERLEEDGSTL
ENSCSAVP00000019462  L.ALQKFVADCDELSEWVNEKMLTAKD...ATYD..DARNLHSKWQKHQAFSA.ELTAN....KDRLERLEEDGSTL
ENSCSAVP00000019459  L.ALQKFVADCDELSEWVNEKMLTAKD...ATYD..DARNLHSKWQKHQAFSA.ELTAN....KDRLERLEEDGSTL
ENSCSAVP00000019458  L.ALQKFVADCDELSEWVNEKMLTAKD...ATYD..DARNLHSKWQKHQAFSA.ELTAN....KDRLERLEEDGSTL
ENSCSAVP00000019460  L.ALQKFVADCDELSEWVNEKMLTAKD...ATYD..DARNLHSKWQKHQAFSA.ELTAN....KDRLERLEEDGSTL
ENSCSAVP00000019461  L.ALQKFVADCDELSEWVNEKMLTAKD...ATYD..DARNLHSKWQKHQAFSA.ELTAN....KDRLERLEEDGSTL
ENSCSAVP00000019463  L.ALQKFVADCDELSEWVNEKMLTAKD...ATYD..DARNLHSKWQKHQAFSA.ELTAN....KDRLERLEEDGSTL
ENSCSAVP00000019464  L.ALQKFVADCDELSEWVNEKMLTAKD...ATYD..DARNLHSKWQKHQAFSA.ELTAN....KDRLERLEEDGSTL
ENSCSAVP00000019461  K.QLHQFYRDVQDEKLWIDEKHPQATS...NELGn.SLQEVQALQKKHQALRS.ELTAH....EPVVVAVCHRGVAM
ENSCSAVP00000019465  Y.ALHKFHYDAAEILARIQEKRQEVP-...EELGr.DHDAVENFKREHDIFAQ.DIKAI....GAQVEAITSAGSEL
ENSCSAVP00000019462  Y.ALHKFHYDAAEILARIQEKRQEVP-...EELGr.DHDAVENFKREHDIFAQ.DIKAI....GAQVEAITSAGSEL
ENSCSAVP00000019462  E.NAQQYFFDADEAVVLMEEQELYMMS...DEKAk.DSQGATKMLKKHQAQEQ.NIDDF....ADTIQQLSKTCRDL
ENSCSAVP00000019464  E.NAQQYFFDADEAVVLMEEQELYMMS...DEKAk.DSQGATKMLKKHQAQEQ.NIDDF....ADTIQQLSKTCRDL
ENSCSAVP00000019463  E.NAQQYFFDADEAVVLMEEQELYMMS...DEKAk.DSQGATKMLKKHQAQEQ.NIDDF....ADTIQQLSKTCRDL
ENSCSAVP00000019458  E.NAQQYFFDADEAVVLMEEQELYMMS...DEKAk.DSQGATKMLKKHQAQEQ.NIDDF....ADTIQQLSKTCRDL
ENSCSAVP00000019459  E.NAQQYFFDADEAVVLMEEQELYMMS...DEKAk.DSQGATKMLKKHQAQEQ.NIDDF....ADTIQQLSKTCRDL
ENSCSAVP00000019460  E.NAQQYFFDADEAVVLMEEQELYMMS...DEKAk.DSQGATKMLKKHQAQEQ.NIDDF....ADTIQQLSKTCRDL
ENSCSAVP00000000080  EqQHLEFAKRAAPFNNWMDCAKEDLED...MFIVh.SMLEIRKLISAHGVFKD.TLPDA....QKEKESIIALVQNI
ENSCSAVP00000000077  EqQHLEFAKRAAPFNNWMDCAKEDLED...MFIVh.SMLEIRKLISAHGVFKD.TLPDA....QKEKESIIALVQNI
ENSCSAVP00000000081  EqQHLEFAKRAAPFNNWMDCAKEDLED...MFIVh.SMLEIRKLISAHGVFKD.TLPDA....QKEKESIIALVQNI
ENSCSAVP00000000073  EqQHLEFAKRAAPFNNWMDCAKEDLED...MFIVh.SMLEIRKLISAHGVFKD.TLPDA....QKEKESIIALVQNI
ENSCSAVP00000000074  EqQHLEFAKRAAPFNNWMDCAKEDLED...MFIVh.SMLEIRKLISAHGVFKD.TLPDA....QKEKESIIALVQNI
ENSCSAVP00000000075  EqQHLEFAKRAAPFNNWMDCAKEDLED...MFIVh.SMLEIRKLISAHGVFKD.TLPDA....QKEKESIIALVQNI
ENSCSAVP00000000078  EqQHLEFAKRAAPFNNWMDCAKEDLED...MFIVh.SMLEIRKLISAHGVFKD.TLPDA....QKEKESIIALVQNI
ENSCSAVP00000000079  EqQHLEFAKRAAPFNNWMDCAKEDLED...MFIVh.SMLEIRKLISAHGVFKD.TLPDA....QKEKESIIALVQNI
ENSCSAVP00000000082  -.-AKKFYYKAGIHEKWTVGQEENLAS...EEYKraSLQELKALMKKHEAFES.DLAAH....QDRVEQIAAIAQEL
ENSCSAVP00000000081  -.-AKKFYYKAGIHEKWTVGQEENLAS...EEYKraSLQELKALMKKHEAFES.DLAAH....QDRVEQIAAIAQEL
ENSCSAVP00000000281  -.EVFKFKRDVNESISWMKEKESLLES...NDLGt.DVSSVQALQRRHEGIER.DLAAL....EEKVSELLSEADRI
ENSCSAVP00000000080  -.-AKKFYYKAGIHEKWTVGQEENLAS...EEYKraSLQELKALMKKHEAFES.DLAAH....QDRVEQIAAIAQEL
ENSCSAVP00000000077  -.-AKKFYYKAGIHEKWTVGQEENLAS...EEYKraSLQELKALMKKHEAFES.DLAAH....QDRVEQIAAIAQEL
ENSCSAVP00000000073  -.-AKKFYYKAGIHEKWTVGQEENLAS...EEYKraSLQELKALMKKHEAFES.DLAAH....QDRVEQIAAIAQEL
ENSCSAVP00000000074  -.-AKKFYYKAGIHEKWTVGQEENLAS...EEYKraSLQELKALMKKHEAFES.DLAAH....QDRVEQIAAIAQEL
ENSCSAVP00000000075  -.-AKKFYYKAGIHEKWTVGQEENLAS...EEYKraSLQELKALMKKHEAFES.DLAAH....QDRVEQIAAIAQEL
ENSCSAVP00000000078  -.-AKKFYYKAGIHEKWTVGQEENLAS...EEYKraSLQELKALMKKHEAFES.DLAAH....QDRVEQIAAIAQEL
ENSCSAVP00000000079  -.-AKKFYYKAGIHEKWTVGQEENLAS...EEYKraSLQELKALMKKHEAFES.DLAAH....QDRVEQIAAIAQEL
ENSCSAVP00000019464  Y.ALHKFHYDAAEILARIQEKRQEVP-...EELGr.DHDAVENFKREHDIFAQ.DIKAI....GAQVEAITSAGSEL
ENSCSAVP00000019465  -.---RFDRKAAMRETWLSENQKLVTQ...DNFGg.DLPAVEAATKKHEAIET.DVKAY....EERVQAVVDVASEL
ENSCSAVP00000019466  -.---RFDRKAAMRETWLSENQKLVTQ...DNFGg.DLPAVEAATKKHEAIET.DVKAY....EERVQAVVDVASEL
ENSCSAVP00000019459  -.---RFDRKAAMRETWLSENQKLVTQ...DNFGg.DLPAVEAATKKHEAIET.DVKAY....EERVQAVVDVASEL
ENSCSAVP00000019462  -.---RFDRKAAMRETWLSENQKLVTQ...DNFGg.DLPAVEAATKKHEAIET.DVKAY....EERVQAVVDVASEL
ENSCSAVP00000019463  -.---RFDRKAAMRETWLSENQKLVTQ...DNFGg.DLPAVEAATKKHEAIET.DVKAY....EERVQAVVDVASEL
ENSCSAVP00000019458  -.---RFDRKAAMRETWLSENQKLVTQ...DNFGg.DLPAVEAATKKHEAIET.DVKAY....EERVQAVVDVASEL
ENSCSAVP00000019460  -.---RFDRKAAMRETWLSENQKLVTQ...DNFGg.DLPAVEAATKKHEAIET.DVKAY....EERVQAVVDVASEL
ENSCSAVP00000019457  -.---RFDRKAAMRETWLSENQKLVTQ...DNFGg.DLPAVEAATKKHEAIET.DVKAY....EERVQAVVDVASEL
ENSCSAVP00000019461  -.---RFDRKAAMRETWLSENQKLVTQ...DNFGg.DLPAVEAATKKHEAIET.DVKAY....EERVQAVVDVASEL
ENSCSAVP00000019464  -.---RFDRKAAMRETWLSENQKLVTQ...DNFGg.DLPAVEAATKKHEAIET.DVKAY....EERVQAVVDVASEL
ENSCSAVP00000019457  E.NAQQYFFDADEAVVLMEEQELYMMS...DEKAk.DSQGATKMLKKHQAQEQ.NIDDF....ADTIQQLSKTCRDL
ENSCSAVP00000019462  -.-LYQFYADTDDVDTWLVDMFRIVST...DDCGr.DEPSVLSLLKKHAQVQE.ELTKY....EGVIKALHDEADGL
ENSCSAVP00000019463  -.-LYQFYADTDDVDTWLVDMFRIVST...DDCGr.DEPSVLSLLKKHAQVQE.ELTKY....EGVIKALHDEADGL
ENSCSAVP00000019457  -.-LYQFYADTDDVDTWLVDMFRIVST...DDCGr.DEPSVLSLLKKHAQVQE.ELTKY....EGVIKALHDEADGL
ENSCSAVP00000019461  -.-LYQFYADTDDVDTWLVDMFRIVST...DDCGr.DEPSVLSLLKKHAQVQE.ELTKY....EGVIKALHDEADGL
ENSCSAVP00000019466  E.NAQQYFFDADEAVVLMEEQELYMMS...DEKAk.DSQGATKMLKKHQAQEQ.NIDDF....ADTIQQLSKTCRDL
ENSCSAVP00000019465  -.--QQYFFDADEAVVLMEEQELYMMS...DEKAk.DSQGATKMLKKHQAQEQ.NIDDF....ADTIQQLSKTCRDL
ENSCSAVP00000019461  -.--QQYFFDADEAVVLMEEQELYMMS...DEKAk.DSQGATKMLKKHQAQEQ.NIDDF....ADTIQQLSKTCRDL
ENSCSAVP00000019466  -.----FYADTDDVDTWLVDMFRIVST...DDCGr.DEPSVLSLLKKHAQVQE.ELTKY....EGVIKALHDEADGL
ENSCSAVP00000019465  -.----FYADTDDVDTWLVDMFRIVST...DDCGr.DEPSVLSLLKKHAQVQE.ELTKY....EGVIKALHDEADGL
ENSCSAVP00000019459  -.----FYADTDDVDTWLVDMFRIVST...DDCGr.DEPSVLSLLKKHAQVQE.ELTKY....EGVIKALHDEADGL
ENSCSAVP00000019464  -.----FYADTDDVDTWLVDMFRIVST...DDCGr.DEPSVLSLLKKHAQVQE.ELTKY....EGVIKALHDEADGL
ENSCSAVP00000019458  -.----FYADTDDVDTWLVDMFRIVST...DDCGr.DEPSVLSLLKKHAQVQE.ELTKY....EGVIKALHDEADGL
ENSCSAVP00000019460  -.----FYADTDDVDTWLVDMFRIVST...DDCGr.DEPSVLSLLKKHAQVQE.ELTKY....EGVIKALHDEADGL
ENSCSAVP00000019457  V.RLQQMFEEMMSLLDWMDDMKGQLAN...EDLGq.HLMGVEDILQKHMLLEQ.DITVH....GDRVKAIESQSQEF
ENSCSAVP00000019464  V.RLQQMFEEMMSLLDWMDDMKGQLAN...EDLGq.HLMGVEDILQKHMLLEQ.DITVH....GDRVKAIESQSQEF
ENSCSAVP00000019459  V.RLQQMFEEMMSLLDWMDDMKGQLAN...EDLGq.HLMGVEDILQKHMLLEQ.DITVH....GDRVKAIESQSQEF
ENSCSAVP00000019466  Y.ALHKFHYDAAEILARIQEKRQEVP-...EELGr.DHDAVENFKREHDIFAQ.DIKAI....GAQVEAITSAGSEL
ENSCSAVP00000019461  Y.ALHKFHYDAAEILARIQEKRQEVP-...EELGr.DHDAVENFKREHDIFAQ.DIKAI....GAQVEAITSAGSEL
ENSCSAVP00000019458  Y.ALHKFHYDAAEILARIQEKRQEVP-...EELGr.DHDAVENFKREHDIFAQ.DIKAI....GAQVEAITSAGSEL
ENSCSAVP00000019460  Y.ALHKFHYDAAEILARIQEKRQEVP-...EELGr.DHDAVENFKREHDIFAQ.DIKAI....GAQVEAITSAGSEL
ENSCSAVP00000000281  -.ELQKFLAESRELLSWCDDIESRITA...DELAh.DVSGAEALVDKHQEHRK.SAVAQ....EEKIGSVNDVANRL
ENSCSAVP00000019463  -.-LFRLSRDIDDLEQWIAQREVVAAS...QEQGq.DFDHVSMLQDQFNDFQR.DTIKTg...EERVADAMRMSDEL
ENSCSAVP00000019465  -.-LQQMFEEMMSLLDWMDDMKGQLAN...EDLGq.HLMGVEDILQKHMLLEQ.DITVH....GDRVKAIESQSQEF
ENSCSAVP00000019466  -.-LQQMFEEMMSLLDWMDDMKGQLAN...EDLGq.HLMGVEDILQKHMLLEQ.DITVH....GDRVKAIESQSQEF
ENSCSAVP00000019463  -.-LQQMFEEMMSLLDWMDDMKGQLAN...EDLGq.HLMGVEDILQKHMLLEQ.DITVH....GDRVKAIESQSQEF
ENSCSAVP00000019462  -.-LQQMFEEMMSLLDWMDDMKGQLAN...EDLGq.HLMGVEDILQKHMLLEQ.DITVH....GDRVKAIESQSQEF
ENSCSAVP00000019461  -.-LQQMFEEMMSLLDWMDDMKGQLAN...EDLGq.HLMGVEDILQKHMLLEQ.DITVH....GDRVKAIESQSQEF
ENSCSAVP00000019458  -.-LQQMFEEMMSLLDWMDDMKGQLAN...EDLGq.HLMGVEDILQKHMLLEQ.DITVH....GDRVKAIESQSQEF
ENSCSAVP00000019460  -.-LQQMFEEMMSLLDWMDDMKGQLAN...EDLGq.HLMGVEDILQKHMLLEQ.DITVH....GDRVKAIESQSQEF
ENSCSAVP00000019465  K.QLHQFYRDVQDEKLWIDEKHPQATS...NELGn.SLQEVQALQKKHQVTHR.-----....--------------
ENSCSAVP00000019466  C.DLFRLSRDIDDLEQWIAQREVVAAS...QEQGq.DFDHVSMLQDQFNDFQR.D----....--------------
ENSCSAVP00000019457  C.DLFRLSRDIDDLEQWIAQREVVAAS...QEQGq.DFDHVSMLQDQFNDFQR.D----....--------------
ENSCSAVP00000000080  -.--TEFAQIANQFGPWMVEFTKEINR...IAMS..MVGSLEDVKNSLMDYQQ.RMMAN....KPQLDTLEKKHQQM
ENSCSAVP00000000081  -.--TEFAQIANQFGPWMVEFTKEINR...IAMS..MVGSLEDVKNSLMDYQQ.RMMAN....KPQLDTLEKKHQQM
ENSCSAVP00000000074  -.--TEFAQIANQFGPWMVEFTKEINR...IAMS..MVGSLEDVKNSLMDYQQ.RMMAN....KPQLDTLEKKHQQM
ENSCSAVP00000000077  -.--TEFAQIANQFGPWMVEFTKEINR...IAMS..MVGSLEDVKNSLMDYQQ.RMMAN....KPQLDTLEKKHQQM
ENSCSAVP00000000075  -.--TEFAQIANQFGPWMVEFTKEINR...IAMS..MVGSLEDVKNSLMDYQQ.RMMAN....KPQLDTLEKKHQQM
ENSCSAVP00000000078  -.--TEFAQIANQFGPWMVEFTKEINR...IAMS..MVGSLEDVKNSLMDYQQ.RMMAN....KPQLDTLEKKHQQM
ENSCSAVP00000000079  -.--TEFAQIANQFGPWMVEFTKEINR...IAMS..MVGSLEDVKNSLMDYQQ.RMMAN....KPQLDTLEKKHQQM
ENSCSAVP00000019464  N.KAELFSQTCEDLEKFASMMEEQLNS...DDVGk.DLASVNVLLKDHLAQQD.EIEVR....KQEVQELES--QVL
ENSCSAVP00000000073  -.--TEFAQIANQFGPWMVEFTKVGDR...IAMS..MVGSLEDVKNSLMDYQQ.RMMAN....KPQLDTLEKKHQQM
ENSCSAVP00000009334  -.---QFSWKTDMVEAWIAEKERALKT...DDNPt.DLSSVQALIVKQETFDA.GLAAFe...QEGVAKITGLKDQL
ENSCSAVP00000006249  -.--QQLNNDLNDVLAWLDKVKCDLTTv..CDCV..TMRELELSLAELKELQK.QIESR....NPIVKSIRILATPL
ENSCSAVP00000003575  L.QLRLFEEDYRDVCSKLETVRQQIESky.LNVGi.TFPWLEAFISGLSDLEQ.STNEC....LEVCGKVRQHGCDL
ENSCSAVP00000003574  L.QLRLFEEDYRDVCSKLETVRQQIESky.LNVGi.TFPWLEAFISGLSDLEQ.STNEC....LEVCGKVRQHGCDL
ENSCSAVP00000003576  L.QLRLFEEDYRDVCSKLETVRQQIESky.LNVGi.TFPWLEAFISGLSDLEQ.STNEC....LEVCGKVRQHGCDL
ENSCSAVP00000004591  LpAVEGLDAILSKCYSMLQNIERTKEDw..VGVGdlPIEALQGHIKKMKIFQKdQMNPI....SESMDELKSSISYF
ENSCSAVP00000000076  -.-------------------------...----..-----------------.-----....--------------
ENSCSAVP00000003574  -.-YQHFINQLNEVRQWCEDGMAFLAGqv.LETSl.TVDGANSAL---NELEI.KFEKK....EQNVQILVENSVVQ
ENSCSAVP00000003576  -.-YQHFINQLNEVRQWCEDGMAFLAGqv.LETSl.TVDGANSAL---NELEI.KFEKK....EQNVQILVENSVVQ
ENSCSAVP00000019465  -.-VYQFAHDANTCDAWVQQQLGLIRDmp.VDTCr.SADDADQLLRRLDGFEK.AAVPW....EDRFAALEKL----
ENSCSAVP00000019464  -.-VYQFAHDANTCDAWVQQQLGLIRDmp.VDTCr.SADDADQLLRRLDGFEK.AAVPW....EDRFAALEKLTEEE
ENSCSAVP00000019461  -.-VYQFAHDANTCDAWVQQQLGLIRDmp.VDTCr.SADDADQLLRRLDGFEK.AAVPW....EDRFAALEKLTEVS
ENSCSAVP00000019466  -.-VYQFAHDANTCDAWVQQQLGLIRDmp.VDTCr.SADDADQLLRRLDGFEK.AAVPW....EDRFAALE------
ENSCSAVP00000019457  -.-VYQFAHDANTCDAWVQQQLGLIRDmp.VDTCr.SADDADQLLRRLDGFEK.AAVPW....EDRFAALEKLTEVS
ENSCSAVP00000019462  -.-VYQFAHDANTCDAWVQQQLGLIRDmp.VDTCr.SADDADQLLRRLDGFEK.AAVPW....EDRFAALEKLTEVS
ENSCSAVP00000019459  -.-VYQFAHDANTCDAWVQQQLGLIRDmp.VDTCr.SADDADQLLRRLDGFEK.AAVPW....EDRFAALEKLTEVS
ENSCSAVP00000019463  -.-VYQFAHDANTCDAWVQQQLGLIRDmp.VDTCr.SADDADQLLRRLDGFEK.AAVPW....EDRFAALEKLTEVS
ENSCSAVP00000019458  -.-VYQFAHDANTCDAWVQQQLGLIRDmp.VDTCr.SADDADQLLRRLDGFEK.AAVPW....EDRFAALEKLTEVS
ENSCSAVP00000019460  -.-VYQFAHDANTCDAWVQQQLGLIRDmp.VDTCr.SADDADQLLRRLDGFEK.AAVPW....EDRFAALEKLTEVS
ENSCSAVP00000013053  DeHLSRRERDMSDLRVAISDLEAKLDRag.DDLAs.SEREVRSLRRQLDATQT.DLAEA....SRAKETALRENRRM


                       20                  130       140       150                                  
                        |                    |         |         |                                  
d1owaa_                FT....MGHSAHE.......ETKAHIEELRHLWDLLLELTLEKGDQL--lr..........................
ENSCSAVP00000000082  --....-------.......-----------------------------qkppkidekghleaayntlqtklrlsnr
ENSCSAVP00000000080  --....-------.......-----------------------------qkppkidekghleaayntlqtklrlsnr
ENSCSAVP00000000073  --....-------.......-----------------------------qkppkidekghleaayntlqtklrlsnr
ENSCSAVP00000000074  --....-------.......-----------------------------qkppkidekghleaayntlqtklrlsnr
ENSCSAVP00000000075  --....-------.......-----------------------------qkppkidekghleaayntlqtklrlsnr
ENSCSAVP00000000078  --....-------.......-----------------------------qkppkidekghleaayntlqtklrlsnr
ENSCSAVP00000000079  --....-------.......-----------------------------qkppkidekghleaayntlqtklrlsnr
ENSCSAVP00000000077  --....-------.......-----------------------------qkppkidekghleaayntlqtklrlsnr
ENSCSAVP00000019466  MRan..NQKPYLP.......KEGKLVSDINKAWEKLEK-----------aehgrelairnelir.............
ENSCSAVP00000019459  MRan..NQKPYLP.......KEGKLVSDINKAWEKLEK-----------aehgrelairnelir.............
ENSCSAVP00000019462  MRan..NQKPYLP.......KEGKLVSDINKAWEKLEK-----------aehgrelairnelir.............
ENSCSAVP00000019463  MRan..NQKPYLP.......KEGKLVSDINKAWEKLEK-----------aehgrelairnelir.............
ENSCSAVP00000019464  MRan..NQKPYLP.......KEGKLVSDINKAWEKLEK-----------aehgrelairnelir.............
ENSCSAVP00000019457  MRan..NQKPYLP.......KEGKLVSDINKAWEKLEK-----------aehgrelairnelir.............
ENSCSAVP00000019461  MRan..NQKPYLP.......KEGKLVSDINKAWEKLEK-----------aehgrelairnelir.............
ENSCSAVP00000019458  MRan..NQKPYLP.......KEGKLVSDINKAWEKLEK-----------aehgrelairnelir.............
ENSCSAVP00000019460  MRan..NQKPYLP.......KEGKLVSDINKAWEKLEK-----------aehgrelairnelir.............
ENSCSAVP00000000081  --....-------.......-----------------------------qkppkidekghleaayntlqtklrlsnr
ENSCSAVP00000000281  IAi...EEHPEVD.......VITNKKEAVNNAWTSLNQRAQQRNRHL--............................
ENSCSAVP00000019464  TSgr..EDEPQYM.......FLGQRLQALDQGWIELHKMWENRNHFL--n...........................
ENSCSAVP00000019458  TSgr..EDEPQYM.......FLGQRLQALDQGWIELHKMWENRNHFL--n...........................
ENSCSAVP00000019460  TSgr..EDEPQYM.......FLGQRLQALDQGWIELHKMWENRNHFL--n...........................
ENSCSAVP00000019465  TSgr..EDEPQYM.......FLGQRLQALDQGWIELHKMWENRNHFL--............................
ENSCSAVP00000019462  TSgr..EDEPQYM.......FLGQRLQALDQGWIELHKMWENRNHFL--n...........................
ENSCSAVP00000019457  TSgr..EDEPQYM.......FLGQRLQALDQGWIELHKMWENRNHFL--n...........................
ENSCSAVP00000019461  TSgr..EDEPQYM.......FLGQRLQALDQGWIELHKMWENRNHFL--............................
ENSCSAVP00000019459  TSgr..EDEPQYM.......FLGQRLQALDQGWIELHKMWENRNHFL--............................
ENSCSAVP00000019463  AT....EDNPNTD.......KINEKCHELQENWNRLLEDVDERKRKL--............................
ENSCSAVP00000019466  AT....EDNPNTD.......KINEKCHELQENWNRLLEDVDERKRKL--s...........................
ENSCSAVP00000019458  AT....EDNPNTD.......KINEKCHELQENWNRLLEDVDERKRKL--s...........................
ENSCSAVP00000019460  AT....EDNPNTD.......KINEKCHELQENWNRLLEDVDERKRKL--s...........................
ENSCSAVP00000019457  AT....EDNPNTD.......KINEKCHELQENWNRLLEDVDERKRKL--s...........................
ENSCSAVP00000019465  IS....EDHFASQ.......DIAKHISDINEQWKNLEELAEARNELL--k...........................
ENSCSAVP00000019462  IS....EDHFASQ.......DIAKHISDINEQWKNLEELAEARNELL--k...........................
ENSCSAVP00000019466  IS....EDHFASQ.......DIAKHISDINEQWKNLEELAEARNELL--k...........................
ENSCSAVP00000019466  TSgr..EDEPQYM.......FLGQRLQALDQGWIELHKMWENR------............................
ENSCSAVP00000019462  AT....EDNPNTD.......KINEKCHELQENWNRLLEDVDERKRKL--............................
ENSCSAVP00000019463  IS....EDHFASQ.......DIAKHISDINEQWKNLEELAEARNELL--............................
ENSCSAVP00000019459  IS....EDHFASQ.......DIAKHISDINEQWKNLEELAEARNELL--k...........................
ENSCSAVP00000019464  IS....EDHFASQ.......DIAKHISDINEQWKNLEELAEARNELL--k...........................
ENSCSAVP00000019461  IS....EDHFASQ.......DIAKHISDINEQWKNLEELAEARNELL--............................
ENSCSAVP00000019457  IS....EDHFASQ.......DIAKHISDINEQWKNLEELAEARNELL--............................
ENSCSAVP00000019458  IS....EDHFASQ.......DIAKHISDINEQWKNLEELAEARNELL--............................
ENSCSAVP00000019460  IS....EDHFASQ.......DIAKHISDINEQWKNLEELAEARNELL--............................
ENSCSAVP00000019459  AT....EDNPNTD.......KINEKCHELQENWNRLLEDVDERKRKL--............................
ENSCSAVP00000019465  --....-------.......-----------------------------rtaekpqkfqekgnlevllftlqskmra
ENSCSAVP00000019466  SN....EHPEEAD.......EIRKKFEQMERVWQELRDMLRQREDSL--g...........................
ENSCSAVP00000019463  SN....EHPEEAD.......EIRKKFEQMERVWQELRDMLRQREDSL--g...........................
ENSCSAVP00000019462  SN....EHPEEAD.......EIRKKFEQMERVWQELRDMLRQREDSL--g...........................
ENSCSAVP00000019459  SN....EHPEEAD.......EIRKKFEQMERVWQELRDMLRQREDSL--............................
ENSCSAVP00000019464  AT....EDNPNTD.......KINEKCHELQENWNRLLEDVDERKRKLSEa...........................
ENSCSAVP00000019461  SN....EHPEEAD.......EIRKKFEQMERVWQELRDMLRQREDSL--............................
ENSCSAVP00000019457  SN....EHPEEAD.......EIRKKFEQMERVWQELRDMLRQREDSL--............................
ENSCSAVP00000019463  IT....TGHYASD.......EIRVKLDELGAKRNHVVDRWQEKW-----e...........................
ENSCSAVP00000019458  IT....TGHYASD.......EIRVKLDELGAKRNHVVDRWQEKW-----e...........................
ENSCSAVP00000019460  IT....TGHYASD.......EIRVKLDELGAKRNHVVDRWQEKW-----e...........................
ENSCSAVP00000019459  IT....TGHYASD.......EIRVKLDELGAKRNHVVDRWQEKW-----e...........................
ENSCSAVP00000019462  IT....TGHYASD.......EIRVKLDELGAKRNHVVDRWQEKW-----e...........................
ENSCSAVP00000019464  IT....TGHYASD.......EIRVKLDELGAKRNHVVDRWQEKW-----e...........................
ENSCSAVP00000019463  TSgr..EDEPQYM.......FLGQRLQALDQGWIEL-------------............................
ENSCSAVP00000019466  IT....TGHYASD.......EIRVKLDELGAKRNHVVDRWQE-------k...........................
ENSCSAVP00000019465  IT....TGHYASD.......EIRVKLDELGAKRNHVVDRWQEKW-----e...........................
ENSCSAVP00000019465  VQ....TQHPNSD.......DVSAKQNELNARWNALRALLEERREIL--............................
ENSCSAVP00000019458  VQ....TQHPNSD.......DVSAKQNELNARWNALRALLEERREIL--............................
ENSCSAVP00000019460  VQ....TQHPNSD.......DVSAKQNELNARWNALRALLEERREIL--............................
ENSCSAVP00000019464  VQ....TQHPNSD.......DVSAKQNELNARWNALRALLEERREIL--............................
ENSCSAVP00000019461  IT....TGHYASD.......EIRVKLDELGAKRNHVVDRWQEKW-----e...........................
ENSCSAVP00000019457  IT....TGHYASD.......EIRVKLDELGAKRNHVVDRWQEKW-----e...........................
ENSCSAVP00000019459  EGr...YAGDDLQ.......EIQKKIEAVLSAWNNLLSLVKKRAALL--s...........................
ENSCSAVP00000019466  AK....SKPEWKD.......QIDVRLDDLRKHWEALESCTKTKEKTL--............................
ENSCSAVP00000019457  EGr...YAGDDLQ.......EIQKKIEAVLSAWNNLLSLVKKRAALL--s...........................
ENSCSAVP00000019457  AK....SKPEWKD.......QIDVRLDDLRKHWEALESCTKTKEKTL--............................
ENSCSAVP00000019465  AK....SKPEWKD.......QIDVRLDDLRKHWEALESCTKTKEKTL--............................
ENSCSAVP00000019462  AK....SKPEWKD.......QIDVRLDDLRKHWEALESCTKTKEKTL--............................
ENSCSAVP00000019459  AK....SKPEWKD.......QIDVRLDDLRKHWEALESCTKTKEKTL--............................
ENSCSAVP00000019458  AK....SKPEWKD.......QIDVRLDDLRKHWEALESCTKTKEKTL--............................
ENSCSAVP00000019460  AK....SKPEWKD.......QIDVRLDDLRKHWEALESCTKTKEKTL--............................
ENSCSAVP00000019461  AK....SKPEWKD.......QIDVRLDDLRKHWEALESCTKTKEKTL--............................
ENSCSAVP00000019463  AK....SKPEWKD.......QIDVRLDDLRKHWEALESCTKTKEKTL--............................
ENSCSAVP00000019464  AK....SKPEWKD.......QIDVRLDDLRKHWEALESCTKTKEKTL--............................
ENSCSAVP00000019461  AT....EDNPNTD.......KINEKCHELQENWN---------------............................
ENSCSAVP00000019465  EGr...YAGDDLQ.......EIQKKIEAVLSAWNNLLSLVKKRAALL--............................
ENSCSAVP00000019462  EGr...YAGDDLQ.......EIQKKIEAVLSAWNNLLSLVKKRAALL--............................
ENSCSAVP00000019462  CE....QEHPQSE.......QLSTRQQQVDQTYAGLKDLAEERRMKL--............................
ENSCSAVP00000019464  CE....QEHPQSE.......QLSTRQQQVDQTYAGLKDLAEERRMKL--............................
ENSCSAVP00000019463  CE....QEHPQSE.......QLSTRQQQVDQTYAGLKDLAEERRMKL--............................
ENSCSAVP00000019458  CE....QEHPQSE.......QLSTRQQQVDQTYAGLKDLAEERRMKL--............................
ENSCSAVP00000019459  CE....QEHPQSE.......QLSTRQQQVDQTYAGLKDLAEERRMKL--............................
ENSCSAVP00000019460  CE....QEHPQSE.......QLSTRQQQVDQTYAGLKDLAEERRMKL--............................
ENSCSAVP00000000080  KKi...QRQYDLPdescenaYTTVTPEEIESKWNVVRNMVPARDASLQ-ael.........................
ENSCSAVP00000000077  KKi...QRQYDLPdescenaYTTVTPEEIESKWNVVRNMVPARDASLQ-ael.........................
ENSCSAVP00000000081  KKi...QRQYDLPdescenaYTTVTPEEIESKWNVVRNMVPARDASLQ-ael.........................
ENSCSAVP00000000073  KKi...QRQYDLPdescenaYTTVTPEEIESKWNVVRNMVPARDASLQ-ael.........................
ENSCSAVP00000000074  KKi...QRQYDLPdescenaYTTVTPEEIESKWNVVRNMVPARDASLQ-ael.........................
ENSCSAVP00000000075  KKi...QRQYDLPdescenaYTTVTPEEIESKWNVVRNMVPARDASLQ-ael.........................
ENSCSAVP00000000078  KKi...QRQYDLPdescenaYTTVTPEEIESKWNVVRNMVPARDASLQ-ael.........................
ENSCSAVP00000000079  KKi...QRQYDLPdescenaYTTVTPEEIESKWNVVRNMVPARDASLQ-ael.........................
ENSCSAVP00000000082  ND....LDYHDTE.......TINDRCRDICDEWDRLGSATQKRRTALE-n...........................
ENSCSAVP00000000081  ND....LDYHDTE.......TINDRCRDICDEWDRLGSATQKRRTALE-v...........................
ENSCSAVP00000000281  -E....RDHGTMQ.......EINEQRDVINGNWERVTRVAAERKIRLK-qsyelqkf....................
ENSCSAVP00000000080  ND....LDYHDTE.......TINDRCRDICDEWDRLGSATQKRRTALE-n...........................
ENSCSAVP00000000077  ND....LDYHDTE.......TINDRCRDICDEWDRLGSATQKRRTALE-n...........................
ENSCSAVP00000000073  ND....LDYHDTE.......TINDRCRDICDEWDRLGSATQKRRTALE-n...........................
ENSCSAVP00000000074  ND....LDYHDTE.......TINDRCRDICDEWDRLGSATQKRRTALE-n...........................
ENSCSAVP00000000075  ND....LDYHDTE.......TINDRCRDICDEWDRLGSATQKRRTALE-n...........................
ENSCSAVP00000000078  ND....LDYHDTE.......TINDRCRDICDEWDRLGSATQKRRTALE-n...........................
ENSCSAVP00000000079  ND....LDYHDTE.......TINDRCRDICDEWDRLGSATQKRRTALE-n...........................
ENSCSAVP00000019464  EGr...YAGDDLQ.......EIQKKIEAVLSAWNNL-------------............................
ENSCSAVP00000019465  QR....EDYHDIT.......RVNQRKDNVLQLWEYLLELLQGRRTRLE-............................
ENSCSAVP00000019466  QR....EDYHDIT.......RVNQRKDNVLQLWEYLLELLQGRRTRLE-............................
ENSCSAVP00000019459  QR....EDYHDIT.......RVNQRKDNVLQLWEYLLELLQGRRTRLE-............................
ENSCSAVP00000019462  QR....EDYHDIT.......RVNQRKDNVLQLWEYLLELLQGRRTRLE-............................
ENSCSAVP00000019463  QR....EDYHDIT.......RVNQRKDNVLQLWEYLLELLQGRRTRLE-............................
ENSCSAVP00000019458  QR....EDYHDIT.......RVNQRKDNVLQLWEYLLELLQGRRTRLE-............................
ENSCSAVP00000019460  QR....EDYHDIT.......RVNQRKDNVLQLWEYLLELLQGRRTRLE-............................
ENSCSAVP00000019457  QR....EDYHDIT.......RVNQRKDNVLQLWEYLLELLQGRRTRLE-............................
ENSCSAVP00000019461  QR....EDYHDIT.......RVNQRKDNVLQLWEYLLELLQGRRTRLE-............................
ENSCSAVP00000019464  QR....EDYHDIT.......RVNQRKDNVLQLWEYLLELLQGRRTRLE-............................
ENSCSAVP00000019457  CE....QEHPQSE.......QLSTRQQQVDQTY----------------............................
ENSCSAVP00000019462  TE....KD-RESV.......EVQERLRSVDSRYKELLDFAKLRKEKL--ida.........................
ENSCSAVP00000019463  TE....KD-RESV.......EVQERLRSVDSRYKELLDFAKLRKEKL--ida.........................
ENSCSAVP00000019457  TE....KD-RESV.......EVQERLRSVDSRYKELLDFAKLRKEKL--ida.........................
ENSCSAVP00000019461  TE....KD-RESV.......EVQERLRSVDSRYKELLDFAKLRKEKL--ida.........................
ENSCSAVP00000019466  CE....QEHPQSE.......QLSTRQQQVDQTY----------------............................
ENSCSAVP00000019465  CE....QEHPQSE.......QLSTRQQQVDQTYAGLKDLAEERRMKL--re..........................
ENSCSAVP00000019461  CE....QEHPQSE.......QLSTRQQQVDQTYAGLKDLAEERRMKL--re..........................
ENSCSAVP00000019466  TE....KD-RESV.......EVQERLRSVDSRYKELLDFAKLRKEKL--ida.........................
ENSCSAVP00000019465  TE....KD-RESV.......EVQERLRSVDSRYKELLDFAKLRKEKL--ida.........................
ENSCSAVP00000019459  TE....KD-RESV.......EVQERLRSVDSRYKELLDFAKLRKEKL--ida.........................
ENSCSAVP00000019464  TE....KD-RESV.......EVQERLRSVDSRYKELLDFAKLRKEKL--ida.........................
ENSCSAVP00000019458  TE....KD-RESV.......EVQERLRSVDSRYKELLDFAKLRKEKL--ida.........................
ENSCSAVP00000019460  TE....KD-RESV.......EVQERLRSVDSRYKELLDFAKLRKEKL--ida.........................
ENSCSAVP00000019457  LQptndYSACEPS.......AVEDKVVGVRTTYDQLCKQAADRRAKLDE............................
ENSCSAVP00000019464  LQptndYSACEPS.......AVEDKVVGVRTTYDQLCKQAADRRAKLDEs...........................
ENSCSAVP00000019459  LQptndYSACEPS.......AVEDKVVGVRTTYDQLCKQAADRRAKLDEs...........................
ENSCSAVP00000019466  --....-------.......-----------------------------e...........................
ENSCSAVP00000019461  --....-------.......-----------------------------e...........................
ENSCSAVP00000019458  --....-------.......-----------------------------............................
ENSCSAVP00000019460  --....-------.......-----------------------------............................
ENSCSAVP00000000281  IE....RGHYAQD.......EIGKR------------------------r...........................
ENSCSAVP00000019463  IN....AGHTDAQ.......DIAGWKDTIRDAWADLLELIDTRVEML--aaa.........................
ENSCSAVP00000019465  LQptndYSACEPS.......AVEDKVVGVRTTYDQLCKQAADRRAKLDEs...........................
ENSCSAVP00000019466  LQptndYSACEPS.......AVEDKVVGVRTTYDQLCKQAADRRAKLDEs...........................
ENSCSAVP00000019463  LQptndYSACEPS.......AVEDKVVGVRTTYDQLCKQAADRRAKLDEs...........................
ENSCSAVP00000019462  LQptndYSACEPS.......AVEDKVVGVRTTYDQLCKQAADRRAKLDEs...........................
ENSCSAVP00000019461  LQptndYSACEPS.......AVEDKVVGVRTTYDQLCKQAADRRAKLDEs...........................
ENSCSAVP00000019458  LQptndYSACEPS.......AVEDKVVGVRTTYDQLCKQAADRRAKLDEs...........................
ENSCSAVP00000019460  LQptndYSACEPS.......AVEDKVVGVRTTYDQLCKQAADRRAKLDEs...........................
ENSCSAVP00000019465  --....-------.......-----------------------------sragr.......................
ENSCSAVP00000019466  --....-------.......-----------------------------ti..........................
ENSCSAVP00000019457  --....-------.......-----------------------------ti..........................
ENSCSAVP00000000080  QE....ALVFDNP.......HSAYSMESLHASWEHIKALLSLTINEVE-nqilmrd.....................
ENSCSAVP00000000081  QE....ALVFDNP.......HSAYSMESLHASWEHIKALLSLTINEVE-nqilmrd.....................
ENSCSAVP00000000074  QE....ALVFDNP.......HSAYSMESLHASWEHIKALLSLTINEVE-nqilmrd.....................
ENSCSAVP00000000077  QE....ALVFDNP.......HSAYSMESLHASWEHIKALLSLTINEVE-nqilmrd.....................
ENSCSAVP00000000075  QE....ALVFDNP.......HSAYSMESLHASWEHIKALLSLTINEVE-nqilmrd.....................
ENSCSAVP00000000078  QE....ALVFDNP.......HSAYSMESLHASWEHIKALLSLTINEVE-nqilmrd.....................
ENSCSAVP00000000079  QE....ALVFDNP.......HSAYSMESLHASWEHIKALLSLTINEVE-nqilmrd.....................
ENSCSAVP00000019464  RS....EGDEDVD.......TMNEERAKIKHRIEDLDEPLTKRKDALE-nskqlhqfy...................
ENSCSAVP00000000073  QE....ALVFDNP.......HSAYSMESLHASWEHIKALLSLTINEVE-nqilmrd.....................
ENSCSAVP00000009334  VK....AD-----.......-----------------------------h...........................
ENSCSAVP00000006249  SR....ND----G.......EMKTKLHRLEQGWDRVNNSANQWRETLQ-scf.........................
ENSCSAVP00000003575  VA....AGHYAVD.......CIQPKTDELQNQTCEIKEQIT--------e...........................
ENSCSAVP00000003574  VA....AGHYAVD.......CIQPKTDELQNQTCEIKEQIT--------e...........................
ENSCSAVP00000003576  VA....AGHYAVD.......CIQPKTDELQNQTCEIKEQIT--------e...........................
ENSCSAVP00000004591  HD....MKMQFTP.......ATKKKIDDVNMRWKMMQIYCSERTKQL--............................
ENSCSAVP00000000076  --....-------.......-----------------------------ekghleaayntlqtkliias........
ENSCSAVP00000003574  SQ....CGRLWSA.......EAEELSCHVKSRLTEVTLLYEKRRSSL--............................
ENSCSAVP00000003576  SQ....CGRLWSA.......EAEELSCHVKSRLTEVTLLYEKRRSSL--............................
ENSCSAVP00000019465  --....-------.......-----------------------------te..........................
ENSCSAVP00000019464  QE....KKRKEEE.......EQEER------------------------rrkaeedeqkikke..............
ENSCSAVP00000019461  --....-------.......-----------------------------qeeqe.......................
ENSCSAVP00000019466  --....-------.......-----------------------------k...........................
ENSCSAVP00000019457  --....-------.......-----------------------------qeeqe.......................
ENSCSAVP00000019462  --....-------.......-----------------------------qeeqe.......................
ENSCSAVP00000019459  --....-------.......-----------------------------qeeqe.......................
ENSCSAVP00000019463  --....-------.......-----------------------------qeeqe.......................
ENSCSAVP00000019458  --....-------.......-----------------------------qeeqe.......................
ENSCSAVP00000019460  --....-------.......-----------------------------qeeqe.......................
ENSCSAVP00000013053  QDdls.TLTRENQ.......DINMELDDVMRDRDDLKNKVQDH------vgr.........................


                                                                           
                                                                           
d1owaa_                ....................................................
ENSCSAVP00000000082  pafmpsegklvsditsawkglegaekgyeewllaemrrl.............
ENSCSAVP00000000080  pafmpsegklvsditsawkglegaekgyeewllaemrrl.............
ENSCSAVP00000000073  pafmpsegklvsditsawkglegaekgyeewllaemrrl.............
ENSCSAVP00000000074  pafmpsegklvsditsawkglegaekgyeewllaemrrl.............
ENSCSAVP00000000075  pafmpsegklvsditsawkglegaekgyeewllaemrrl.............
ENSCSAVP00000000078  pafmpsegklvsditsawkglegaekgyeewllaemrrl.............
ENSCSAVP00000000079  pafmpsegklvsditsawkglegaekgyeewllaemrrl.............
ENSCSAVP00000000077  pafmpsegklvsditsawkglegaekgyeewllaemrrl.............
ENSCSAVP00000019466  ....................................................
ENSCSAVP00000019459  ....................................................
ENSCSAVP00000019462  ....................................................
ENSCSAVP00000019463  ....................................................
ENSCSAVP00000019464  ....................................................
ENSCSAVP00000019457  ....................................................
ENSCSAVP00000019461  ....................................................
ENSCSAVP00000019458  ....................................................
ENSCSAVP00000019460  ....................................................
ENSCSAVP00000000081  pafmpsegklvsditsawkglegaekgyeewllaemrrl.............
ENSCSAVP00000000281  ....................................................
ENSCSAVP00000019464  ....................................................
ENSCSAVP00000019458  ....................................................
ENSCSAVP00000019460  ....................................................
ENSCSAVP00000019465  ....................................................
ENSCSAVP00000019462  ....................................................
ENSCSAVP00000019457  ....................................................
ENSCSAVP00000019461  ....................................................
ENSCSAVP00000019459  ....................................................
ENSCSAVP00000019463  ....................................................
ENSCSAVP00000019466  ....................................................
ENSCSAVP00000019458  ....................................................
ENSCSAVP00000019460  ....................................................
ENSCSAVP00000019457  ....................................................
ENSCSAVP00000019465  ....................................................
ENSCSAVP00000019462  ....................................................
ENSCSAVP00000019466  ....................................................
ENSCSAVP00000019466  ....................................................
ENSCSAVP00000019462  ....................................................
ENSCSAVP00000019463  ....................................................
ENSCSAVP00000019459  ....................................................
ENSCSAVP00000019464  ....................................................
ENSCSAVP00000019461  ....................................................
ENSCSAVP00000019457  ....................................................
ENSCSAVP00000019458  ....................................................
ENSCSAVP00000019460  ....................................................
ENSCSAVP00000019459  ....................................................
ENSCSAVP00000019465  nnqkpylpkegklvsdinkvslricrktefaweklekaehgrelairnelir
ENSCSAVP00000019466  ....................................................
ENSCSAVP00000019463  ....................................................
ENSCSAVP00000019462  ....................................................
ENSCSAVP00000019459  ....................................................
ENSCSAVP00000019464  ....................................................
ENSCSAVP00000019461  ....................................................
ENSCSAVP00000019457  ....................................................
ENSCSAVP00000019463  ....................................................
ENSCSAVP00000019458  ....................................................
ENSCSAVP00000019460  ....................................................
ENSCSAVP00000019459  ....................................................
ENSCSAVP00000019462  ....................................................
ENSCSAVP00000019464  ....................................................
ENSCSAVP00000019463  ....................................................
ENSCSAVP00000019466  ....................................................
ENSCSAVP00000019465  ....................................................
ENSCSAVP00000019465  ....................................................
ENSCSAVP00000019458  ....................................................
ENSCSAVP00000019460  ....................................................
ENSCSAVP00000019464  ....................................................
ENSCSAVP00000019461  ....................................................
ENSCSAVP00000019457  ....................................................
ENSCSAVP00000019459  ....................................................
ENSCSAVP00000019466  ....................................................
ENSCSAVP00000019457  ....................................................
ENSCSAVP00000019457  ....................................................
ENSCSAVP00000019465  ....................................................
ENSCSAVP00000019462  ....................................................
ENSCSAVP00000019459  ....................................................
ENSCSAVP00000019458  ....................................................
ENSCSAVP00000019460  ....................................................
ENSCSAVP00000019461  ....................................................
ENSCSAVP00000019463  ....................................................
ENSCSAVP00000019464  ....................................................
ENSCSAVP00000019461  ....................................................
ENSCSAVP00000019465  ....................................................
ENSCSAVP00000019462  ....................................................
ENSCSAVP00000019462  ....................................................
ENSCSAVP00000019464  ....................................................
ENSCSAVP00000019463  ....................................................
ENSCSAVP00000019458  ....................................................
ENSCSAVP00000019459  ....................................................
ENSCSAVP00000019460  ....................................................
ENSCSAVP00000000080  ....................................................
ENSCSAVP00000000077  ....................................................
ENSCSAVP00000000081  ....................................................
ENSCSAVP00000000073  ....................................................
ENSCSAVP00000000074  ....................................................
ENSCSAVP00000000075  ....................................................
ENSCSAVP00000000078  ....................................................
ENSCSAVP00000000079  ....................................................
ENSCSAVP00000000082  ....................................................
ENSCSAVP00000000081  ....................................................
ENSCSAVP00000000281  ....................................................
ENSCSAVP00000000080  ....................................................
ENSCSAVP00000000077  ....................................................
ENSCSAVP00000000073  ....................................................
ENSCSAVP00000000074  ....................................................
ENSCSAVP00000000075  ....................................................
ENSCSAVP00000000078  ....................................................
ENSCSAVP00000000079  ....................................................
ENSCSAVP00000019464  ....................................................
ENSCSAVP00000019465  ....................................................
ENSCSAVP00000019466  ....................................................
ENSCSAVP00000019459  ....................................................
ENSCSAVP00000019462  ....................................................
ENSCSAVP00000019463  ....................................................
ENSCSAVP00000019458  ....................................................
ENSCSAVP00000019460  ....................................................
ENSCSAVP00000019457  ....................................................
ENSCSAVP00000019461  ....................................................
ENSCSAVP00000019464  ....................................................
ENSCSAVP00000019457  ....................................................
ENSCSAVP00000019462  ....................................................
ENSCSAVP00000019463  ....................................................
ENSCSAVP00000019457  ....................................................
ENSCSAVP00000019461  ....................................................
ENSCSAVP00000019466  ....................................................
ENSCSAVP00000019465  ....................................................
ENSCSAVP00000019461  ....................................................
ENSCSAVP00000019466  ....................................................
ENSCSAVP00000019465  ....................................................
ENSCSAVP00000019459  ....................................................
ENSCSAVP00000019464  ....................................................
ENSCSAVP00000019458  ....................................................
ENSCSAVP00000019460  ....................................................
ENSCSAVP00000019457  ....................................................
ENSCSAVP00000019464  ....................................................
ENSCSAVP00000019459  ....................................................
ENSCSAVP00000019466  ....................................................
ENSCSAVP00000019461  ....................................................
ENSCSAVP00000019458  ....................................................
ENSCSAVP00000019460  ....................................................
ENSCSAVP00000000281  ....................................................
ENSCSAVP00000019463  ....................................................
ENSCSAVP00000019465  ....................................................
ENSCSAVP00000019466  ....................................................
ENSCSAVP00000019463  ....................................................
ENSCSAVP00000019462  ....................................................
ENSCSAVP00000019461  ....................................................
ENSCSAVP00000019458  ....................................................
ENSCSAVP00000019460  ....................................................
ENSCSAVP00000019465  ....................................................
ENSCSAVP00000019466  ....................................................
ENSCSAVP00000019457  ....................................................
ENSCSAVP00000000080  ....................................................
ENSCSAVP00000000081  ....................................................
ENSCSAVP00000000074  ....................................................
ENSCSAVP00000000077  ....................................................
ENSCSAVP00000000075  ....................................................
ENSCSAVP00000000078  ....................................................
ENSCSAVP00000000079  ....................................................
ENSCSAVP00000019464  ....................................................
ENSCSAVP00000000073  ....................................................
ENSCSAVP00000009334  ....................................................
ENSCSAVP00000006249  ....................................................
ENSCSAVP00000003575  ....................................................
ENSCSAVP00000003574  ....................................................
ENSCSAVP00000003576  ....................................................
ENSCSAVP00000004591  ....................................................
ENSCSAVP00000000076  ....................................................
ENSCSAVP00000003574  ....................................................
ENSCSAVP00000003576  ....................................................
ENSCSAVP00000019465  ....................................................
ENSCSAVP00000019464  ....................................................
ENSCSAVP00000019461  ....................................................
ENSCSAVP00000019466  ....................................................
ENSCSAVP00000019457  ....................................................
ENSCSAVP00000019462  ....................................................
ENSCSAVP00000019459  ....................................................
ENSCSAVP00000019463  ....................................................
ENSCSAVP00000019458  ....................................................
ENSCSAVP00000019460  ....................................................
ENSCSAVP00000013053  ....................................................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0048652 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Yarrowia lipolytica CLIB122
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Capsella rubella v183
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Solanum tuberosum - Potato
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Oryza meridionalis 22
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Amborella trichopoda 22
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Trypanosoma vivax
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Ichthyophthirius multifiliis strain G5
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Synechococcus sp. PCC 7502
NoYes   Halothece sp. PCC 7418
NoYes   Saccharomonospora viridis DSM 43017
NoYes   Herpetosiphon aurantiacus DSM 785
NoYes   Chloroflexus aggregans DSM 9485
NoYes   Truepera radiovictrix DSM 17093
NoYes   Meiothermus ruber DSM 1279
NoYes   Clostridium thermocellum ATCC 27405
NoYes   Enterococcus faecalis 62
NoYes   Pediococcus pentosaceus ATCC 25745
NoYes   Bacillus sp. 1NLA3E
NoYes   Bacillus anthracis str. A0248
NoYes   Bacillus cellulosilyticus DSM 2522
NoYes   Prosthecochloris aestuarii DSM 271
NoYes   Niastella koreensis GR20-10
NoYes   Thermosipho africanus TCF52B
NoYes   Dictyoglomus turgidum DSM 6724
NoYes   Burkholderia sp. CCGE1002
NoYes   Burkholderia vietnamiensis G4
NoYes   Acidiphilium multivorum AIU301
NoYes   Acidiphilium cryptum JF-5
NoYes   Beijerinckia indica subsp. indica ATCC 9039
NoYes   Xanthomonas campestris pv. campestris str. B100
NoYes   Thioalkalivibrio sulfidophilus HL-EbGr7
NoYes   Shigella flexneri 5 str. 8401
NoYes   Shigella dysenteriae Sd197
NoYes   Fervidicoccus fontis Kam940
NoYes   Thermofilum sp. 1910b
NoYes   Halalkalicoccus jeotgali B3
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Cryptococcus neoformans var. grubii H99
NoYes   Cryptococcus neoformans B-3501A
NoYes   Cryptococcus neoformans JEC21
NoYes   Paracoccidioides brasiliensis Pb01
NoYes   Paracoccidioides brasiliensis Pb03
NoYes   Coccidioides posadasii str. Silveira
NoYes   Coccidioides immitis RMSCC 3703
NoYes   Coccidioides immitis RMSCC 2394
NoYes   Coccidioides immitis H538.4
NoYes   Ajellomyces dermatitidis ER-3
NoYes   Histoplasma capsulatum H143
NoYes   Histoplasma capsulatum H88
NoYes   Histoplasma capsulatum G186AR
NoYes   Aspergillus fumigatus A1163
NoYes   Saccharomyces cerevisiae FostersO
NoYes   Saccharomyces cerevisiae AWRI796
NoYes   Schizosaccharomyces pombe 972h-
NoYes   Batrachochytrium dendrobatidis JEL423
NoYes   Batrachochytrium dendrobatidis JAM81
NoYes   Thermus thermophilus HB8
NoYes   Clostridium thermocellum DSM 1313
NoYes   Coprococcus catus GD/7
NoYes   Enterococcus faecalis D32
NoYes   Bacillus thuringiensis serovar konkukian str. 97-27
NoYes   Bacillus cereus biovar anthracis str. CI
NoYes   Bacillus cereus AH820
NoYes   Bacillus anthracis str. H9401
NoYes   Bacillus anthracis str. CDC 684
NoYes   Bacillus anthracis str. 'Ames Ancestor'
NoYes   Bacillus anthracis str. Sterne
NoYes   Bacillus anthracis str. Ames
NoYes   Prevotella sp. oral taxon 299 str. F0039
NoYes   Variovorax paradoxus B4
NoYes   Xanthomonas campestris pv. raphani 756C
NoYes   Xanthomonas campestris pv. campestris str. 8004
NoYes   Xanthomonas campestris pv. campestris str. ATCC 33913
NoYes   Shigella flexneri 2002017
NoYes   Shigella flexneri 2a str. 2457T
NoYes   Shigella dysenteriae 1617
NoYes   Pseudomonas stutzeri DSM 10701
NoYes   Methylophaga sp. JAM7
NoYes   Aeropyrum camini SY1 = JCM 12091
NoYes   Archaeoglobus sulfaticallidus PM70-1
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Caenorhabditis elegans 69_215 - Roundworm
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Heliconius numata
NoYes   Loa loa v3.3 - Eye worm
NoYes   Wuchereria bancrofti v1.0 - Agent of lymphatic filariasis
NoYes   Brugia malayi v1.0 - Agent of lymphatic filariasis
NoYes   Moniliophthora perniciosa FA553
NoYes   Nicotiana benthamiana 0.4.4
NoYes   2_050719S (meta-genome)
NoYes   3_050719R (meta-genome)
NoYes   4_050719Q (meta-genome)
NoYes   5_050719P (meta-genome)
NoYes   6_Upper_euphotic (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 1 (meta-genome)
NoYes   Atta cephalotes fungus garden (ACEF) (meta-genome)
NoYes   Dendroctonus ponderosae beetle community (MPB hybrid beetle) (Lodgepole pine) (meta-genome)
NoYes   Dump bottom (Dump bottom) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #1 (meta-genome)
NoYes   Freshwater propionate enrichment of Brocadia fulgida (meta-genome)
NoYes   Fungus garden combined (combined) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden top (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 09(Y) (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP8 from OSP Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP15 from Mushroom Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP17 from Obsidian Pool Prime (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP4 from Joseph's Coat Springs (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP5 from Bath Lake Vista Annex (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP7 from Chocolate Pots (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP9 from Dragon Spring, Norris Geyser Basin (meta-genome)
NoYes   Human Gut Community Subject 7 (meta-genome)
NoYes   Marine anammox bioreactor enriched for Scalindua species (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formaldehyde enrichment (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   simLC - Simulated Low Complexity Metagenome (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- (Maryland Estuary ambient) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 4 Nevada Test Site Crust CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- (Oak Ridge ambient) (meta-genome)
NoYes   Soil microbial community from bioreactor at Alameda Naval Air Station, CA, contaminated with Chloroethene, Sample 196 (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample from switchgrass (Panicum virg (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Wastewater Terephthalate-degrading communities from Bioreactor (meta-genome)
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   NCBI viral sequences (Viral)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   UniProt viral sequences (Viral)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]