SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Second domain of FERM alignments in Loxodonta africana 69_3

These alignments are sequences aligned to the 0051790 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d2al6a1               k.............................................................................
ENSLAFP00000004369  ..............................................................................
ENSLAFP00000012502  vsee..........................................................................
ENSLAFP00000029102  g.............................................................................
ENSLAFP00000007813  d.............................................................................
ENSLAFP00000014469  v.............................................................................
ENSLAFP00000017759  eelvq.........................................................................
ENSLAFP00000005545  pdpa..........................................................................
ENSLAFP00000013233  dpnk..........................................................................
ENSLAFP00000005072  pdpa..........................................................................
ENSLAFP00000019139  epnn..........................................................................
ENSLAFP00000020095  pdps..........................................................................
ENSLAFP00000006881  edpck.........................................................................
ENSLAFP00000002150  pdpt..........................................................................
ENSLAFP00000005735  epnn..........................................................................
ENSLAFP00000001601  pdpnt.........................................................................
ENSLAFP00000012149  dd............................................................................
ENSLAFP00000006204  dpa...........................................................................
ENSLAFP00000020639  ..............................................................................
ENSLAFP00000028365  ..............................................................................
ENSLAFP00000023682  rkffys........................................................................
ENSLAFP00000000602  ..............................................................................
ENSLAFP00000006012  epl...........................................................................
ENSLAFP00000008039  sv............................................................................
ENSLAFP00000012210  pdpg..........................................................................
ENSLAFP00000006793  nvs...........................................................................
ENSLAFP00000014923  engr..........................................................................
ENSLAFP00000004389  dha...........................................................................
ENSLAFP00000002060  rkffys........................................................................
ENSLAFP00000010057  dpgh..........................................................................
ENSLAFP00000026665  engr..........................................................................
ENSLAFP00000003799  es............................................................................
ENSLAFP00000001204  es............................................................................
ENSLAFP00000004752  phl...........................................................................
ENSLAFP00000009845  rikffvscvg....................................................................
ENSLAFP00000007214  srlyfsvqargetdrek.............................................................
ENSLAFP00000008659  mrklwlnvspgkdvnad.............................................................
ENSLAFP00000008751  knrlyfrsqvkgetererllla........................................................
ENSLAFP00000021921  rnvffpkr......................................................................
ENSLAFP00000010867  ek............................................................................
ENSLAFP00000003442  tdnv..........................................................................
ENSLAFP00000003110  ev............................................................................
ENSLAFP00000008659  rkefftpwhds...................................................................
ENSLAFP00000007128  wetpl.........................................................................
ENSLAFP00000014229  davrinqlyeqarwailleeidcteeemlifaalqyhisklslsteiqdftneteadeveaalsnlevtleggktdnt
ENSLAFP00000020352  rfkyysffdldpk.................................................................
ENSLAFP00000005479  rfkyysffdlnpky................................................................
ENSLAFP00000012997  wdqplkf.......................................................................
ENSLAFP00000022414  ea............................................................................
ENSLAFP00000003280  qf............................................................................
ENSLAFP00000005479  ..............................................................................


                                                                                                    
                                                                                                    
d2al6a1               ..............................................................................
ENSLAFP00000004369  ..............................................................................
ENSLAFP00000012502  ..............................................................................
ENSLAFP00000029102  ..............................................................................
ENSLAFP00000007813  ..............................................................................
ENSLAFP00000014469  ..............................................................................
ENSLAFP00000017759  ..............................................................................
ENSLAFP00000005545  ..............................................................................
ENSLAFP00000013233  ..............................................................................
ENSLAFP00000005072  ..............................................................................
ENSLAFP00000019139  ..............................................................................
ENSLAFP00000020095  ..............................................................................
ENSLAFP00000006881  ..............................................................................
ENSLAFP00000002150  ..............................................................................
ENSLAFP00000005735  ..............................................................................
ENSLAFP00000001601  ..............................................................................
ENSLAFP00000012149  ..............................................................................
ENSLAFP00000006204  ..............................................................................
ENSLAFP00000020639  ..............................................................................
ENSLAFP00000028365  ..............................................................................
ENSLAFP00000023682  ..............................................................................
ENSLAFP00000000602  ..............................................................................
ENSLAFP00000006012  ..............................................................................
ENSLAFP00000008039  ..............................................................................
ENSLAFP00000012210  ..............................................................................
ENSLAFP00000006793  ..............................................................................
ENSLAFP00000014923  ..............................................................................
ENSLAFP00000004389  ..............................................................................
ENSLAFP00000002060  ..............................................................................
ENSLAFP00000010057  ..............................................................................
ENSLAFP00000026665  ..............................................................................
ENSLAFP00000003799  ..............................................................................
ENSLAFP00000001204  ..............................................................................
ENSLAFP00000004752  ..............................................................................
ENSLAFP00000009845  ..............................................................................
ENSLAFP00000007214  ..............................................................................
ENSLAFP00000008659  ..............................................................................
ENSLAFP00000008751  ..............................................................................
ENSLAFP00000021921  ..............................................................................
ENSLAFP00000010867  ..............................................................................
ENSLAFP00000003442  ..............................................................................
ENSLAFP00000003110  ..............................................................................
ENSLAFP00000008659  ..............................................................................
ENSLAFP00000007128  ..............................................................................
ENSLAFP00000014229  leditdipkladnlklfrpkklilkafkqywfvfkdtsiayfknkeleqgepveklnlrgcevvpdvnvagrkfgikl
ENSLAFP00000020352  ..............................................................................
ENSLAFP00000005479  ..............................................................................
ENSLAFP00000012997  ..............................................................................
ENSLAFP00000022414  ..............................................................................
ENSLAFP00000003280  ..............................................................................
ENSLAFP00000005479  ..............................................................................


                                                                                                    
                                                                                                    
d2al6a1               ......................................................................-GFLNQFT
ENSLAFP00000004369  ......................................................................EDFMESLK
ENSLAFP00000012502  ......................................................................------LI
ENSLAFP00000029102  ......................................................................--FLNQFT
ENSLAFP00000007813  ......................................................................--VPEELI
ENSLAFP00000014469  ......................................................................---SEELI
ENSLAFP00000017759  ......................................................................--------
ENSLAFP00000005545  ......................................................................------QL
ENSLAFP00000013233  ......................................................................-------L
ENSLAFP00000005072  ......................................................................------QL
ENSLAFP00000019139  ......................................................................-------L
ENSLAFP00000020095  ......................................................................------QL
ENSLAFP00000006881  ......................................................................-------L
ENSLAFP00000002150  ......................................................................------QL
ENSLAFP00000005735  ......................................................................-------L
ENSLAFP00000001601  ......................................................................-------L
ENSLAFP00000012149  ......................................................................----VSLI
ENSLAFP00000006204  ......................................................................------AL
ENSLAFP00000020639  ......................................................................KDPIDLLR
ENSLAFP00000028365  ......................................................................KDPVELLH
ENSLAFP00000023682  ......................................................................--DQNVDS
ENSLAFP00000000602  ......................................................................KDPLDLLK
ENSLAFP00000006012  ......................................................................------KI
ENSLAFP00000008039  ......................................................................-----SQL
ENSLAFP00000012210  ......................................................................------QL
ENSLAFP00000006793  ......................................................................------WL
ENSLAFP00000014923  ......................................................................------LI
ENSLAFP00000004389  ......................................................................------QL
ENSLAFP00000002060  ......................................................................--DQNVDS
ENSLAFP00000010057  ......................................................................-------L
ENSLAFP00000026665  ......................................................................------VI
ENSLAFP00000003799  ......................................................................----ISYL
ENSLAFP00000001204  ......................................................................----ISFL
ENSLAFP00000004752  ......................................................................-------I
ENSLAFP00000009845  ......................................................................------LL
ENSLAFP00000007214  ......................................................................--------
ENSLAFP00000008659  ......................................................................--------
ENSLAFP00000008751  ......................................................................--------
ENSLAFP00000021921  ......................................................................---RELQI
ENSLAFP00000010867  ......................................................................------KI
ENSLAFP00000003442  ......................................................................-------P
ENSLAFP00000003110  ......................................................................--------
ENSLAFP00000008659  ......................................................................-------R
ENSLAFP00000007128  ......................................................................------HF
ENSLAFP00000014229  lipvadgmnevylkcdhenqyarwmaacilaskgktmadssyqpevlsilsllrmknrssasptassves--------
ENSLAFP00000020352  ......................................................................--------
ENSLAFP00000005479  ......................................................................--------
ENSLAFP00000012997  ......................................................................--------
ENSLAFP00000022414  ......................................................................------PL
ENSLAFP00000003280  ......................................................................--------
ENSLAFP00000005479  ......................................................................--------


                      10        20            30                  40        50                  60  
                       |         |             |                   |         |                   |  
d2al6a1               EDKPTLNFFYQQVKNDYMLE....IADQVDQ..........EIALKLGCLEIRRSYGEMRG..........NALEKKS
ENSLAFP00000004369  EDRTTLLYFYQQLRNDYMQR....YASKVSE..........GMALQLGCLELRRFFKDMPH..........NALDKKS
ENSLAFP00000012502  QE-ITQRLFFLQVKEAILND....EI-YCPP..........ETAVLLASYAVQAKYGDYNK..........EIHKPGY
ENSLAFP00000029102  EDKPTLNFFYQQVKSDYMLE....IADQVDQ..........EIALKLGCLEIRRSYWEMRG..........NALEKKS
ENSLAFP00000007813  QD-ITQKLFFLQVKEGILSD....EI-YCPP..........ETAVLLGSYAVQAKFGDYNK..........ELHKSGY
ENSLAFP00000014469  QD-ITQRLFFLQVKEGILND....DI-YCPP..........ETAVLLASYAVQSKYGDFNK..........EVHKSGY
ENSLAFP00000017759  --EITQHLFFLQVKKQILDE....KI-YCPP..........EASVLLASYAVQAKYGDYDP..........SVHKRGF
ENSLAFP00000005545  TEDITRYYLCLQLRADIITG....RL-PCSF..........VTHALLGSYAVQAELGDYDA..........EEHVGNY
ENSLAFP00000013233  QEEYTRYQYFLQIKQDILTG....RL-PCPC..........NTAALLASFAVQSEFGDYNQ..........SENLPGY
ENSLAFP00000005072  SEDITRYYLCLQLRDDIVSG....RL-PCSF..........VTLALLGSYTVQSELGDYDP..........DECGNDY
ENSLAFP00000019139  REELTRYLFVLQLKQDILSG....KL-ECPF..........DTAVQLAAYNLQAELGDYDL..........AEHSPEL
ENSLAFP00000020095  TEDITRYFLCLQLRQDIASG....RL-PCSF..........VTHALLGSYTLQAELGDYDP..........EEHSPDV
ENSLAFP00000006881  KEEITRYQFFLQVKQDVLQG....RL-PSPI..........NVAAQLGAYAIQSELGDYDP..........YKHTAGY
ENSLAFP00000002150  TEDITRYYLCLQLRQDIVAG....RL-PCSF..........ATLALLGSYTIQSELGDYDR..........ELHGADY
ENSLAFP00000005735  REEFTRYLFVLQLRHDILSG....KL-KCPY..........ETAVELAALCLQAELGECEL..........PEHTPEL
ENSLAFP00000001601  QQEQTRHLYFLQLKMDICEG....RL-ICPL..........NSAVVLASYAVQSHFGDYNA..........SIHHSGY
ENSLAFP00000012149  QHTLTCHQYYLQLRKDILEE....RM-HCDD..........ETSVLLASLALQAEYGDYQP..........EVYGVSY
ENSLAFP00000006204  KEEITRYLVFLQIKRDLYHG....RL-LCKT..........SDAALLAAYILQAEIGDYDP..........GKHPEGY
ENSLAFP00000020639  RDPVAFEYLYVQSCNDVVQEr...FGPELKY..........DIALRLAALQMYIAT---VT..........TKQTQKI
ENSLAFP00000028365  RDPAAFEYLYIQSRNDVIREr...FGMEPKP..........EMLLCLAALHIYITV---SA..........TRPSQKI
ENSLAFP00000023682  RDPVQLNLLYVQARDDILNG....SH-PVSF..........EKACEFGGFQAQIQFGPHVD..........HKHKPGF
ENSLAFP00000000602  EDPVAFEYLYLQSCSDVLQEr...FAVEMKC..........SSALRLAALHIQERI---YA..........CAQPQKI
ENSLAFP00000006012  KEELTRYLLYLQIKRDIFHG....RL-LCSF..........SDAAYLGACIVQAELGDYHP..........DEHPENY
ENSLAFP00000008039  QQEITRYQYYLQLKKDILEG....NI-PCTL..........EQAIQLAGLAVQADFGDFDQ..........YE-SQDF
ENSLAFP00000012210  QEEYTRYLFALQLKRDLLEG....QL-TCSD..........TTAALLASHLLQSEIGDYDE..........TL-DREH
ENSLAFP00000006793  QQEATRYQYYLQVKKDVLEG....RL-RCTL..........EQVIRLAGLAVQADFGDYNQ..........FD-SQDF
ENSLAFP00000014923  SDRAARYYYYWHLRKQVLHS....QC-VLRE..........EAYFLLAAFALQADLGNFKR..........NKHYGKY
ENSLAFP00000004389  QEELTRYLFALQVKQDLAQG....RL-TCND..........TSAALLISHIVQSEIGDFD-..........EALDREH
ENSLAFP00000002060  RDPVQLNLLYVQARDDILNG....SH-PVSF..........DKACEFAGFQCQIQFGPHNE..........QKHKAGF
ENSLAFP00000010057  REELTRYLFTLQIKKDLALG....KL-PCSD..........NCTALMVSHILQSELGDFHE..........E-TDRKH
ENSLAFP00000026665  RDRTAQHLYYCHLKEQVLRS....EC-AHRE..........EAYFLLAALGLQADFGNHRE..........AAHVGRG
ENSLAFP00000003799  KDNATIELFFLNAKSCIYKE....LI-DVDS..........EVVFELASYILQEAKGDFSS..........NEVVRSD
ENSLAFP00000001204  KDKTTVELFFLNAKSCVHKG....QI-EVDS..........ETIFKLAALVLQEAKGDYTS..........DENARKD
ENSLAFP00000004752  LQEQTRHIFFLHIKEALLAG....HL-QCSP..........EQAVELNALLAQTKFGDYNQ..........NT--AKY
ENSLAFP00000009845  QQSQTRHQFYLQLRRDILEE....KL-YCND..........ETLLQLGSLELLIELQVWPK..........EQVKEGK
ENSLAFP00000007214  ------LLLMYQTNNQIING....LF-PLNK..........DLALEMAALLAQVEIGDFERpfstpaghitNQCKVNQ
ENSLAFP00000008659  -----TILHYHQELPKYLRG....FH-KCSR..........EDVLHLAGLIYKAQFDNDRS..........QLASIPK
ENSLAFP00000008751  ----------SQTNGEIVAG....RF-PVNK..........ELALEMAALMAQVEYGDLEK..........PTLPGPG
ENSLAFP00000021921  RDEEVLRLLYEEAKGNVLTA....RY-PCDV..........EDCEALGALVCRVQLGPYQP..........GQSAACT
ENSLAFP00000010867  EDPLAILILFDEARYNLLKG....FY-TAPD..........AKLITLASLLLQIVYGNYES..........KKHKQGF
ENSLAFP00000003442  KDSVEFAFMFEQAHEAVIHG....HY-PAPE..........ENLQVLAPLRLQYLQGDYTPhiav......PALEEVY
ENSLAFP00000003110  --------VFVQGQYDLVKC....LAPIRDPkteqdghdieNECLGMAVLAI-------SH..........YAMMKKM
ENSLAFP00000008659  EDPVSTELIYRQVLHGVWSG....EYSFERE..........EELVELLARHCYVQLGASAG..........SEAIQEL
ENSLAFP00000007128  DHPTYICIHYSQVLWDYLQG....KL-LVSA..........QADAQLAHLAALQHL---SR..........-------
ENSLAFP00000014229  --------------------....-------..........--------------------..........-------
ENSLAFP00000020352  MDPVRLTQLYEQARWDLLLE....EI-DCTE..........EEMMVFAALQYH--------..........-------
ENSLAFP00000005479  -DAIRINQLYEQAKWAILLE....EI-ECTE..........EEMMMFAALQYH--------..........-------
ENSLAFP00000012997  ENELYVTMHYNQVLPDYLKG....LFSMLPSrpseqql...QQVSKLALLQHCTKDHFYLP..........-------
ENSLAFP00000022414  LDDFVMSYLFAQWRHDFVCGwiklPVTHETQ..........EECLGLAVLDMMRIA-----..........--KEKGQ
ENSLAFP00000003280  LDPASFEYIFEQGKHEFVND....VASLWELsseeeihhfkNESLGMAFLHL-------CH..........LALHRGV
ENSLAFP00000005479  --------------------....-------..........--------------------..........-------


                            70            80              90                                        
                             |             |               |                                        
d2al6a1               NYEVLEKDV....GLRRFFPKSL.LD..SVK...AKTL...RKLIQQTFR............................
ENSLAFP00000004369  NFELLEKEV....GLDLFFPRQM.QE..NLK...PKQF...RKMIQQTFQ............................
ENSLAFP00000012502  LAN------....--DRLLPQRV.LE..QHKlt.KEQW...EERIQNWHE............................
ENSLAFP00000029102  NYEVLEKDV....GLKRFFPKSL.LD..SVK...AKTL...RKLIQQTFR............................
ENSLAFP00000007813  LSS------....--ERLVPQRV.MD..QHKlt.RDQW...EDRIQVWHA............................
ENSLAFP00000014469  LAG------....--DKLLPQRV.LE..QHKln.KDQW...EERIQVWHE............................
ENSLAFP00000017759  LAQ------....--EELLPKRV.INlyQMT...PEMW...EERITAWYA............................
ENSLAFP00000005545  VSE------....--LRFAPN--.--..--Q...TREL...EERIMELHK............................
ENSLAFP00000013233  LSD------....--YSFIPN--.--..--Q...PQDF...EKEIAKFHQ............................
ENSLAFP00000005072  VSE------....--FRFAPN--.--..--H...TKEL...EDKVIELHK............................
ENSLAFP00000019139  VSE------....--FRFVPI--.--..--Q...TEEM...ELAIFEKWK............................
ENSLAFP00000020095  VSD------....--FQFAP---.--..-TQ...TKEL...EEKVAELHK............................
ENSLAFP00000006881  VSE------....--YRFVPD--.--..--Q...KEEL...EEAIERIHK............................
ENSLAFP00000002150  VSD------....--------FK.LA..PNQ...TKEL...EEKVMELHK............................
ENSLAFP00000005735  VSE------....--FRFIPNQ-.--..---...TEAM...EFDIFQRWK............................
ENSLAFP00000001601  LSD------....--HQFIPY--.--..--Q...NDDF...LTKVASLHE............................
ENSLAFP00000012149  --------F....RLEHYLPARV.ME..KLE...LAYI...KQELPKLHN............................
ENSLAFP00000006204  SSK------....--FQFFPK--.--..--H...SEKL...ERKIAEIHKt...........................
ENSLAFP00000020639  SLKYIEKEW....GLETFLPSAV.LQ..SMK...EKNI...KKALSHLVK............................
ENSLAFP00000028365  SLKNVEKEW....GLEPFLPPSL.LQ..GIK...EKNL...RKSLSQQLK............................
ENSLAFP00000023682  --------L....DLKEFLPK--.-E..YIK...QRGA...EKRIFQEHK............................
ENSLAFP00000000602  SLKYIEKDW....GIENFISPTL.LR..NMK...GKDI...KKAISFHMK............................
ENSLAFP00000006012  ISE------....--FEIFPK--.--..--Q...SQKL...ERKIVEIHK............................
ENSLAFP00000008039  LQK------....--FALFPVGW.LQ..DEKv..LEEA...TQKVASLHQ............................
ENSLAFP00000012210  LE-------....-VNEYLPD--.--..---...QARS...LEKVLEFHQ............................
ENSLAFP00000006793  LREYV----....----LFPMDLaLE..EAV...LEEL...TQKVAHEHK............................
ENSLAFP00000014923  FEP------....--EAYFPSWV.VS..KRG...KDYI...LKHIPNMHK............................
ENSLAFP00000004389  LAK------....--NKYIPQ--.--..---...QDAL...EDKIVEFHH............................
ENSLAFP00000002060  ---------....--LEFFEKFY.YS..---...-SQR...ETKVFGAHK............................
ENSLAFP00000010057  LAQ------....--TRYLPN--.--..---...QDCL...ESKILHFHQ............................
ENSLAFP00000026665  HEA------....--TATSPPHI.LA..KRG...SAYL...LRHTPAMHR............................
ENSLAFP00000003799  LKK------....--LPALPTQA.LK..EHPs..LAYC...EDRVIEHYK............................
ENSLAFP00000001204  LRT------....--LPAFPTKT.LQ..EHPs..LAYC...EDRIIEHYL............................
ENSLAFP00000004752  NYEELC---....----------.-A..KEL...SSAT...LNSIIAKHK............................
ENSLAFP00000009845  ------AYF....QVEDYIPASL.IR..RMT...ASRV...QLKISEMHC............................
ENSLAFP00000007214  TLK-----Q....VIEKFYPKRY.RD..GCS...EEQLrqlCQRLSTRWM............................
ENSLAFP00000008659  -------I-....-LRQLVPENL.TR..LMS...SEEWk..KESIPLAYD............................
ENSLAFP00000008751  GTPPAKAQHllqqVLDRFYPRRY.RH..GPPaeqLRHL...ADTLTTKWL............................
ENSLAFP00000021921  LRE------....KLDSFLPAHL.CK..---...----...---------............................
ENSLAFP00000010867  LNE-----E....NLKSIVPITK.LK..S-K...APHW...TNRILHEYK............................
ENSLAFP00000003442  CLPRLKARIsq..STKSFTPGER.LE..KRR...TSFL...EGTLRRGFRtgtvlrqkveeeqmldmwvkeevssara
ENSLAFP00000003110  QLPELPKDI....SYKRYIPETL.NK..SIR...QRNLlt.RMRINNVFK............................
ENSLAFP00000008659  ---------....-LPSCIPTKL.YR..TKP...PEKW...ASLVAAAHT............................
ENSLAFP00000007128  NTKDPPTER....DLLLYVPKQL.QR..QLN...MATI...KRLMDQELR............................
ENSLAFP00000014229  ------MDM....NPECFVSPRC.AK..KHK...AKQL...AARILEAHQ............................
ENSLAFP00000020352  ---------....----------.--..---...----...---------............................
ENSLAFP00000005479  ---------....----------.--..---...----...---------............................
ENSLAFP00000012997  ------NVW....EVREYIPAQL.YH..TTA...GSTW...LSLISQHWQ............................
ENSLAFP00000022414  TPLAIYNSI....SYKTFLPKCV.RA..KIQ...DYHIlt.RKRIRYRFR............................
ENSLAFP00000003280  SLEEVAKKI....SFKDCIPRSF.RS..QIQ...QHNAlt.RLRLRSIFH............................
ENSLAFP00000005479  ---------....----------.--..---...-KQI...TARILEAHQ............................


                           100                           110       120                              
                             |                             |         |                              
d2al6a1               .......QF...........ANL.........NREESILKFFEILSPVYRF...........................
ENSLAFP00000004369  .......QY...........ASL.........KEEECIMKFFNTLA-----g..........................
ENSLAFP00000012502  .......EH...........RGM.........LREDSMMEYLKIAQDL---...........................
ENSLAFP00000029102  .......QF...........ANL.........NREESILKFFEILSPVYRF...........................
ENSLAFP00000007813  .......EH...........RGM.........LRDSAMLEYLKIAQDL---...........................
ENSLAFP00000014469  .......EH...........RGM.........LREDAVLEYLKIAQDL---...........................
ENSLAFP00000017759  .......EH...........RGR.........ARDEAEMEYLKIAQDL---...........................
ENSLAFP00000005545  .......TY...........RGM.........TPGEAEIHFLENAKKLSMY...........................
ENSLAFP00000013233  .......QH...........TGL.........SPAEAEFNYLNTARTLELY...........................
ENSLAFP00000005072  .......SH...........RGM.........TPAEAEMHFLENAKKLSMY...........................
ENSLAFP00000019139  .......EY...........RGQ.........TPAQAETNYLNKAKWLEMY...........................
ENSLAFP00000020095  .......TH...........RGL.........SPAQADSQFLENVKRLSMY...........................
ENSLAFP00000006881  .......TL...........MGQ.........APSEAELNYLRTAKSLEMY...........................
ENSLAFP00000002150  .......SY...........RSM.........TPAQADLEFLENAKKLSMY...........................
ENSLAFP00000005735  .......EC...........RGK.........SPAQAELSYLNKAKWLEMY...........................
ENSLAFP00000001601  .......QH...........SGL.........KQSEAESCYINIARTLD--fy.........................
ENSLAFP00000012149  .......TY...........VGA.........SEKETELEFLKVCQRL---...........................
ENSLAFP00000006204  .......EL...........SGQ.........TPATSELNFLRKAQTLETY...........................
ENSLAFP00000020639  .......AN...........QNLvppgkkl..SALQAKVHYLKFLSDLRLY...........................
ENSLAFP00000028365  .......AH...........QTHpssgtkg..SAIQAKLQYLRILNELPTF...........................
ENSLAFP00000023682  .......NC...........GEM.........SEIEAKAKYVKLARSLRTY...........................
ENSLAFP00000000602  .......RN...........QNLleprqkqliSAAQLRLNYLQILGELKTY...........................
ENSLAFP00000006012  .......N-...........---.........-------------------elrgqsppvaefnlllkahalety...
ENSLAFP00000008039  .......KY...........RGL.........TAPDAEMLYMQEVE-----r..........................
ENSLAFP00000012210  .......KH...........TGQ.........TPAESDFQVLEIARKLEMY...........................
ENSLAFP00000006793  .......AH...........SGI.........LPAEAELMYINQVER----l..........................
ENSLAFP00000014923  .......DQ...........FAL.........TASEAHLKYIKE-------avrl.......................
ENSLAFP00000004389  .......NH...........IGQ.........TPAESDFQLLEIARRLEMY...........................
ENSLAFP00000002060  .......NC...........GQM.........SEIEAKVRYVKLARSLKTY...........................
ENSLAFP00000010057  .......KH...........IGR.........SPAESDILLLDIARKQDMY...........................
ENSLAFP00000026665  .......EQ...........RGL.........NPREAVLRFIRE-------acrl.......................
ENSLAFP00000003799  .......KL...........NGQ.........TRGQAIVNYMSIVESL---...........................
ENSLAFP00000001204  .......KI...........KGL.........TRGQAVVQYMKIVE-----a..........................
ENSLAFP00000004752  .......EL...........EGT.........SQASAEYQVLQIV------s..........................
ENSLAFP00000009845  .......LS...........PAL.........WGEDAELEFLRVTQQLPEY...........................
ENSLAFP00000007214  .......AL...........RGH.........STVDCVRIYLTVARKWPFF...........................
ENSLAFP00000008659  .......KH...........VDK.........TVEEAKVAFLKWICRWPTF...........................
ENSLAFP00000008751  .......AL...........QGC.........SSPECIRIYLTVARKWPFF...........................
ENSLAFP00000021921  .......--...........---.........-------------------rgqglfaalrgrgtkagpgeqgllnay
ENSLAFP00000010867  .......NL...........STS.........EGVSKEMHHL---------qrmflqncw..................
ENSLAFP00000003442  niidkwkKF...........QGL.........SQEQAMAKYMALIK-----ew.........................
ENSLAFP00000003110  .......DFlkefnnkticdSSV.........STHDLKVKYLATLETLTKH...........................
ENSLAFP00000008659  .......--...........---.........-------------------ka.........................
ENSLAFP00000007128  .......QL...........QRH.........SLQDAQISFIEAVSQLPLF...........................
ENSLAFP00000014229  .......NV...........AQM.........PLVEAKLRFIQAWQSLPEF...........................
ENSLAFP00000020352  .......--...........---.........-------------------i..........................
ENSLAFP00000005479  .......--...........---.........-------------------i..........................
ENSLAFP00000012997  .......QT...........QAL.........SPHQARAQFLGLLSALPMF...........................
ENSLAFP00000022414  .......RF...........IQQfsqcka...TARNLKLKYL---------i..........................
ENSLAFP00000003280  .......KFlrafqp.....SHL.........SQQLVMVKYLATLERL---...........................
ENSLAFP00000005479  .......NV...........AQM.........SLIEAKMRFIQAWQSLPEF...........................


                                                        
                                                        
d2al6a1               ..................................
ENSLAFP00000004369  ..................................
ENSLAFP00000012502  ..................................
ENSLAFP00000029102  ..................................
ENSLAFP00000007813  ..................................
ENSLAFP00000014469  ..................................
ENSLAFP00000017759  ..................................
ENSLAFP00000005545  ..................................
ENSLAFP00000013233  ..................................
ENSLAFP00000005072  ..................................
ENSLAFP00000019139  ..................................
ENSLAFP00000020095  ..................................
ENSLAFP00000006881  ..................................
ENSLAFP00000002150  ..................................
ENSLAFP00000005735  ..................................
ENSLAFP00000001601  ..................................
ENSLAFP00000012149  ..................................
ENSLAFP00000006204  ..................................
ENSLAFP00000020639  ..................................
ENSLAFP00000028365  ..................................
ENSLAFP00000023682  ..................................
ENSLAFP00000000602  ..................................
ENSLAFP00000006012  ..................................
ENSLAFP00000008039  ..................................
ENSLAFP00000012210  ..................................
ENSLAFP00000006793  ..................................
ENSLAFP00000014923  ..................................
ENSLAFP00000004389  ..................................
ENSLAFP00000002060  ..................................
ENSLAFP00000010057  ..................................
ENSLAFP00000026665  ..................................
ENSLAFP00000003799  ..................................
ENSLAFP00000001204  ..................................
ENSLAFP00000004752  ..................................
ENSLAFP00000009845  ..................................
ENSLAFP00000007214  ..................................
ENSLAFP00000008659  ..................................
ENSLAFP00000008751  ..................................
ENSLAFP00000021921  revkevvgsdgegenplsihyraylfkchelpfy
ENSLAFP00000010867  ..................................
ENSLAFP00000003442  ..................................
ENSLAFP00000003110  ..................................
ENSLAFP00000008659  ..................................
ENSLAFP00000007128  ..................................
ENSLAFP00000014229  ..................................
ENSLAFP00000020352  ..................................
ENSLAFP00000005479  ..................................
ENSLAFP00000012997  ..................................
ENSLAFP00000022414  ..................................
ENSLAFP00000003280  ..................................
ENSLAFP00000005479  ..................................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0051790 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Emiliania huxleyi CCMP1516
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Batrachochytrium dendrobatidis JEL423
NoYes   Batrachochytrium dendrobatidis JAM81
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Cyanobacterium aponinum PCC 10605
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Caenorhabditis elegans 69_215 - Roundworm
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Heliconius numata
NoYes   Loa loa v3.3 - Eye worm
NoYes   Wuchereria bancrofti v1.0 - Agent of lymphatic filariasis
NoYes   Brugia malayi v1.0 - Agent of lymphatic filariasis
NoYes   Lotus japonicus
NoYes   Malus x domestica - Apple
NoYes   Ricinus communis - Castor bean
NoYes   Nicotiana benthamiana 0.4.4
NoYes   Solanum pimpinellifolium A-1.0 - Currant tomato
NoYes   Solanum lycopersicum v2.3 - Tomato
NoYes   NCBI 2017_08 genome
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   STRING v9.0.5 (STRING)
NoYes   Uniprot 2018_03 genome
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]