SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

EF-hand alignments in Bos taurus 76_3.1

These alignments are sequences aligned to the 0035583 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1bjfa_               ..............................................................................
ENSBTAP00000019411  mad...........................................................................
ENSBTAP00000036057  mad...........................................................................
ENSBTAP00000038404  l.............................................................................
ENSBTAP00000010971  l.............................................................................
ENSBTAP00000019803  ggggggggtamrilggvisaiseaaaqynpepvpprthysniea..................................
ENSBTAP00000014038  le............................................................................
ENSBTAP00000002055  ad............................................................................
ENSBTAP00000049731  ad............................................................................
ENSBTAP00000005577  mgkq..........................................................................
ENSBTAP00000034949  l.............................................................................
ENSBTAP00000017447  vspmtclkkhwmklafmtntngkipvrsitrtfasgktekvifqalkelglpsgkndeiepa................
ENSBTAP00000010858  hpkmtelyqsladlnnvrfsayrtamklrrlqkalcldllslsaacdaldqhnlkqndqpmdilqiinclttiydrle
ENSBTAP00000046644  srdaflekaytklklqvtpegriplkniyrlfsadrkrvetaleacsl..............................
ENSBTAP00000022814  mgkq..........................................................................
ENSBTAP00000019758  ppcldseltefplrmrdwlknvlvtlyerdednnlltekqklrvkkihenekrleagdhpvellardfeknynmyifp
ENSBTAP00000019321  mgkt..........................................................................
ENSBTAP00000011677  pqlepg........................................................................
ENSBTAP00000011680  ntd...........................................................................
ENSBTAP00000021742  r.............................................................................
ENSBTAP00000005348  pactdfevtqfplrmrdwlknilvqlyepnpehsgylnekqrnkvkkiyldekrllagdhsidlllrdfkknyhmyvy
ENSBTAP00000016609  srntf.........................................................................
ENSBTAP00000012740  hpkmtelfqsladlnnvrfsayrtai....................................................
ENSBTAP00000018403  ae............................................................................
ENSBTAP00000026407  astdvagleesfrkfaihgdpkasghemngknwaklckdckva...................................
ENSBTAP00000052557  p.............................................................................
ENSBTAP00000054167  r.............................................................................
ENSBTAP00000010319  anm...........................................................................
ENSBTAP00000041545  erld..........................................................................
ENSBTAP00000055204  sf............................................................................
ENSBTAP00000003718  l.............................................................................
ENSBTAP00000011676  qedg..........................................................................
ENSBTAP00000049395  qklrhwihs.....................................................................
ENSBTAP00000054983  lsaleeafrkfavhgdarasgr........................................................
ENSBTAP00000052219  dp............................................................................
ENSBTAP00000025402  srstfldkilvklkm...............................................................
ENSBTAP00000011678  an............................................................................
ENSBTAP00000000433  ertfqrfavfgessssgt............................................................
ENSBTAP00000021491  sr............................................................................
ENSBTAP00000044733  se............................................................................
ENSBTAP00000010937  rth...........................................................................
ENSBTAP00000056439  rth...........................................................................
ENSBTAP00000055780  ave...........................................................................
ENSBTAP00000038002  makerg........................................................................
ENSBTAP00000034705  er............................................................................
ENSBTAP00000035936  qqfsweeveengavgaa.............................................................
ENSBTAP00000013699  gvppnvd.......................................................................
ENSBTAP00000002564  hpkmtelyqtlaadlnnikfsayrtam...................................................
ENSBTAP00000011496  y.............................................................................
ENSBTAP00000019111  ..............................................................................
ENSBTAP00000017036  e.............................................................................
ENSBTAP00000003213  rtrd..........................................................................
ENSBTAP00000055444  rtrd..........................................................................
ENSBTAP00000024550  pm............................................................................
ENSBTAP00000015248  ..............................................................................
ENSBTAP00000021328  ..............................................................................
ENSBTAP00000037091  ..............................................................................
ENSBTAP00000029967  e.............................................................................
ENSBTAP00000021449  giaek.........................................................................
ENSBTAP00000053176  ekwa..........................................................................
ENSBTAP00000042361  s.............................................................................
ENSBTAP00000016509  qqfsweeveengavgaa.............................................................
ENSBTAP00000026714  lr............................................................................
ENSBTAP00000004690  etdid.........................................................................
ENSBTAP00000010858  h.............................................................................
ENSBTAP00000013117  nmrts.........................................................................
ENSBTAP00000017574  kw............................................................................
ENSBTAP00000004885  ptaacqdveppt..................................................................
ENSBTAP00000008961  tfritkadaaefwrkafgekt.........................................................
ENSBTAP00000028063  emraqnfdvirlstyrtac...........................................................
ENSBTAP00000012740  leekyrylfkevagptemcdqrqlglllhdaiqiprqlgevaafggsn..............................
ENSBTAP00000006283  re............................................................................
ENSBTAP00000014306  ..............................................................................
ENSBTAP00000053252  tpr...........................................................................
ENSBTAP00000014304  ..............................................................................
ENSBTAP00000045669  qlfaemraqdldrirlstyrtac.......................................................
ENSBTAP00000041264  tyqltkvsahtfwrercgarc.........................................................
ENSBTAP00000006711  drwvs.........................................................................
ENSBTAP00000017358  fritkadaaefwrkffgdk...........................................................
ENSBTAP00000053274  qlfaemraqdldrirlstyrtac.......................................................
ENSBTAP00000055296  fritkadaaefwrkffgdk...........................................................
ENSBTAP00000016852  i.............................................................................
ENSBTAP00000036380  ..............................................................................
ENSBTAP00000041719  ..............................................................................
ENSBTAP00000049636  ..............................................................................
ENSBTAP00000024444  ..............................................................................
ENSBTAP00000004556  ctdkelrnlasrl.................................................................
ENSBTAP00000038767  mgsrastl......................................................................
ENSBTAP00000031285  tctgqdladlgdrlrdwfqllhenskqngsansgaspasgldks..................................
ENSBTAP00000011457  kn............................................................................
ENSBTAP00000011047  ..............................................................................
ENSBTAP00000002564  vkeklqylfsqvansgsqcdqrhlgvllheaiqvprqlgevaafggsnveps..........................
ENSBTAP00000037104  ..............................................................................
ENSBTAP00000002672  ..............................................................................
ENSBTAP00000028269  ..............................................................................
ENSBTAP00000016647  shaa..........................................................................
ENSBTAP00000004536  a.............................................................................
ENSBTAP00000042177  qgcpgakkrefltsvldalstdmvhavsdpsspgrlsepdpshtl.................................
ENSBTAP00000028063  m.............................................................................
ENSBTAP00000050283  tyv...........................................................................
ENSBTAP00000048539  eftk..........................................................................
ENSBTAP00000045669  k.............................................................................
ENSBTAP00000007972  iqgva.........................................................................
ENSBTAP00000040815  pgcpegkklefitslldalttdmvqainsaaptgggrfsepdpshtl...............................
ENSBTAP00000025661  eftk..........................................................................
ENSBTAP00000028350  k.............................................................................
ENSBTAP00000053274  k.............................................................................
ENSBTAP00000021537  mgnkqtv.......................................................................
ENSBTAP00000055481  pptaewavp.....................................................................
ENSBTAP00000039155  ..............................................................................
ENSBTAP00000029333  pptaewavp.....................................................................
ENSBTAP00000016315  stsypde.......................................................................
ENSBTAP00000021091  efftklfekype..................................................................
ENSBTAP00000021618  lsra..........................................................................
ENSBTAP00000055520  alnsienstyrtafklrsvqtlcqldligssliqhvlrhqslwea.................................
ENSBTAP00000055624  alnsienstyrtafklrsvqtlcqldligssliqhvlrhqslwea.................................
ENSBTAP00000016319  dd............................................................................
ENSBTAP00000034078  h.............................................................................
ENSBTAP00000006645  mgqclryqmh....................................................................
ENSBTAP00000021909  vrd...........................................................................
ENSBTAP00000001426  qqppylhlae....................................................................
ENSBTAP00000015802  elksifklsvfipsqefsty..........................................................
ENSBTAP00000032680  elksifklsvfipsqefsty..........................................................
ENSBTAP00000055007  ar............................................................................
ENSBTAP00000020148  pte...........................................................................
ENSBTAP00000052345  wivspa........................................................................
ENSBTAP00000029334  spktgtsewavpq.................................................................
ENSBTAP00000052345  isgtsaaelpw...................................................................
ENSBTAP00000056127  e.............................................................................
ENSBTAP00000012557  kt............................................................................
ENSBTAP00000011888  kw............................................................................
ENSBTAP00000017060  eahwavr.......................................................................
ENSBTAP00000031854  eeedin........................................................................
ENSBTAP00000031823  ard...........................................................................
ENSBTAP00000021603  lsra..........................................................................
ENSBTAP00000010838  sqle..........................................................................
ENSBTAP00000014575  liiqmpe.......................................................................
ENSBTAP00000011215  eeedin........................................................................
ENSBTAP00000053698  la............................................................................
ENSBTAP00000006806  seleta........................................................................
ENSBTAP00000029334  gpn...........................................................................
ENSBTAP00000044105  hle...........................................................................
ENSBTAP00000026904  mptqleiamni...................................................................
ENSBTAP00000017060  ptvswvvpvadkm.................................................................
ENSBTAP00000055520  pltkytalfqlyaennrgghdlgarmtrrvlrnlltdl........................................
ENSBTAP00000044226  seleta........................................................................
ENSBTAP00000055624  pltkytalfqlyaennrgghdlgarmtrrvlrnlltdl........................................
ENSBTAP00000042182  elqqlfqelageeeelgapqlqillsialeparahaqtpreiglr.................................
ENSBTAP00000010796  lrkkvqgcwrellre...............................................................
ENSBTAP00000021174  sq............................................................................
ENSBTAP00000006275  mselekav......................................................................
ENSBTAP00000020950  k.............................................................................
ENSBTAP00000053738  rkkvqgcwrellre................................................................
ENSBTAP00000004963  vn............................................................................
ENSBTAP00000023774  ..............................................................................
ENSBTAP00000020395  leqqiqa.......................................................................
ENSBTAP00000020150  mpsqmehamet...................................................................
ENSBTAP00000025561  plekal........................................................................
ENSBTAP00000053738  prrlkeffrd....................................................................
ENSBTAP00000034009  mtkle.........................................................................
ENSBTAP00000020539  dilve.........................................................................
ENSBTAP00000020778  t.............................................................................
ENSBTAP00000017461  rp............................................................................
ENSBTAP00000044096  msqmes........................................................................
ENSBTAP00000008523  msqmes........................................................................
ENSBTAP00000035196  hptgplyc......................................................................
ENSBTAP00000041997  rdkpmyd.......................................................................
ENSBTAP00000025499  mtdllhaedikkavgaftavdsfd......................................................
ENSBTAP00000055481  pfggsl........................................................................
ENSBTAP00000002174  kdkptyd.......................................................................
ENSBTAP00000000589  spleqalavmvatfhkysgqe.........................................................
ENSBTAP00000028239  tkd...........................................................................
ENSBTAP00000014894  enqiltrd......................................................................
ENSBTAP00000026544  v.............................................................................
ENSBTAP00000029333  pfggsl........................................................................
ENSBTAP00000041966  sqqsifykyaqqgld...............................................................
ENSBTAP00000008933  akdkpvydelfytlspi.............................................................
ENSBTAP00000056088  mtkle.........................................................................
ENSBTAP00000033794  tpveesl.......................................................................
ENSBTAP00000012786  etqiltrd......................................................................
ENSBTAP00000030018  enqvltrd......................................................................
ENSBTAP00000040233  d.............................................................................
ENSBTAP00000003365  prskkfl.......................................................................
ENSBTAP00000053176  v.............................................................................
ENSBTAP00000024301  rda...........................................................................
ENSBTAP00000022292  dp............................................................................
ENSBTAP00000015611  mtnllrsvvtvi..................................................................
ENSBTAP00000012770  eelske........................................................................
ENSBTAP00000000847  etplekalttmvttfhkysgregskl....................................................
ENSBTAP00000053738  d.............................................................................
ENSBTAP00000054975  pdtfepqkffqtsglakms...........................................................
ENSBTAP00000046639  khlqq.........................................................................
ENSBTAP00000052345  np............................................................................
ENSBTAP00000053164  hhlkkvnyq.....................................................................
ENSBTAP00000016774  mltdlecains...................................................................
ENSBTAP00000022630  k.............................................................................
ENSBTAP00000010796  al............................................................................
ENSBTAP00000021909  s.............................................................................
ENSBTAP00000033974  mfs...........................................................................
ENSBTAP00000006711  vy............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000004912  llf...........................................................................
ENSBTAP00000005979  hptaplydpea...................................................................
ENSBTAP00000053738  al............................................................................
ENSBTAP00000053746  pirskivraffdnrnlrkgtsgla......................................................
ENSBTAP00000023221  kevweeadgldpndf...............................................................
ENSBTAP00000019429  hp............................................................................
ENSBTAP00000052019  mtellnsil.....................................................................
ENSBTAP00000042244  q.............................................................................
ENSBTAP00000053738  lkkallli......................................................................
ENSBTAP00000018877  ytelekavvvlvenfykyvskhslvk....................................................
ENSBTAP00000053019  t.............................................................................
ENSBTAP00000003073  kevweeldgldpnrfn..............................................................
ENSBTAP00000012886  sll...........................................................................
ENSBTAP00000044222  slleqalatlvrtfqeysqfsgnplcqakfkellekelptwapttlr...............................
ENSBTAP00000028499  aeplteleaaietvvttfft..........................................................
ENSBTAP00000047378  yv............................................................................
ENSBTAP00000009308  svsde.........................................................................
ENSBTAP00000017060  pl............................................................................
ENSBTAP00000050406  a.............................................................................
ENSBTAP00000031879  a.............................................................................
ENSBTAP00000031854  qtlsrieaafmdied...............................................................
ENSBTAP00000001250  rllrglglkpekleqdldrhaesarmtqgr................................................
ENSBTAP00000026035  mpqllrn.......................................................................
ENSBTAP00000011215  tlsrieaafmdied................................................................
ENSBTAP00000002128  algnvcetikklq.................................................................
ENSBTAP00000053194  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000033188  wrk...........................................................................
ENSBTAP00000053548  wrk...........................................................................
ENSBTAP00000011687  l.............................................................................
ENSBTAP00000007636  c.............................................................................
ENSBTAP00000020950  peeqhk........................................................................
ENSBTAP00000009115  rk............................................................................
ENSBTAP00000023873  q.............................................................................
ENSBTAP00000054471  mlr...........................................................................
ENSBTAP00000039694  gkaelnfedfyrfmdn..............................................................
ENSBTAP00000025205  mlr...........................................................................
ENSBTAP00000047882  eaems.........................................................................
ENSBTAP00000001368  eewtsaakpkldqaimvehi..........................................................
ENSBTAP00000029786  t.............................................................................
ENSBTAP00000028993  ..............................................................................
ENSBTAP00000023678  dpgvrdl.......................................................................
ENSBTAP00000034710  pltarqla......................................................................
ENSBTAP00000031823  tpe...........................................................................
ENSBTAP00000038002  sc............................................................................
ENSBTAP00000021074  qllr..........................................................................
ENSBTAP00000026544  gf............................................................................
ENSBTAP00000007217  qlv...........................................................................
ENSBTAP00000029792  a.............................................................................
ENSBTAP00000044088  dl............................................................................
ENSBTAP00000017319  sdlekaiataal..................................................................
ENSBTAP00000044100  nkhir.........................................................................
ENSBTAP00000033594  gk............................................................................
ENSBTAP00000026766  t.............................................................................
ENSBTAP00000055894  lcdqkysdeenlp.................................................................
ENSBTAP00000015220  ah............................................................................
ENSBTAP00000033613  evsa..........................................................................
ENSBTAP00000056320  k.............................................................................
ENSBTAP00000025249  s.............................................................................
ENSBTAP00000029159  vspkpdpktiskh.................................................................
ENSBTAP00000044088  fgkrg.........................................................................
ENSBTAP00000016319  ltl...........................................................................
ENSBTAP00000017662  eraeeh........................................................................
ENSBTAP00000012479  plssglldklqkelkv..............................................................
ENSBTAP00000029886  kgsnys........................................................................
ENSBTAP00000027388  flddpkyssdedlpsk..............................................................
ENSBTAP00000039694  s.............................................................................
ENSBTAP00000023673  l.............................................................................
ENSBTAP00000041488  l.............................................................................
ENSBTAP00000001452  v.............................................................................
ENSBTAP00000028498  sdvera........................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000020240  nvemilkffdmflklkdlt...........................................................
ENSBTAP00000053650  nvemilkffdmflklkdlt...........................................................
ENSBTAP00000041651  epeh..........................................................................
ENSBTAP00000005154  al............................................................................
ENSBTAP00000021174  nfllkfqgvkm...................................................................
ENSBTAP00000022068  edsp..........................................................................
ENSBTAP00000026682  gdinfaeieeanrvlgpiyfttfvffmffillnmflaiindtysevksdlaqqkaemelsdlirkgyhkaliklklkk
ENSBTAP00000007636  hdvlkleferhdpv................................................................
ENSBTAP00000027954  q.............................................................................
ENSBTAP00000020778  v.............................................................................
ENSBTAP00000013601  idtaklypil....................................................................
ENSBTAP00000005477  e.............................................................................
ENSBTAP00000055305  nvemilkffdmflklkdlt...........................................................
ENSBTAP00000036054  nvemilkffdmflklkdlt...........................................................
ENSBTAP00000004912  q.............................................................................
ENSBTAP00000022292  nwdcefir......................................................................
ENSBTAP00000002717  s.............................................................................
ENSBTAP00000036015  ell...........................................................................
ENSBTAP00000051638  t.............................................................................
ENSBTAP00000026766  kg............................................................................
ENSBTAP00000053738  eyfnfmghftkpqqvqeelkelqqstekampardkl..........................................
ENSBTAP00000016306  k.............................................................................
ENSBTAP00000013714  malvap........................................................................
ENSBTAP00000036550  kq............................................................................
ENSBTAP00000053738  mtkdevieklksciqqq.............................................................
ENSBTAP00000023383  er............................................................................
ENSBTAP00000027030  wiee..........................................................................
ENSBTAP00000053270  wiee..........................................................................
ENSBTAP00000054640  wiee..........................................................................
ENSBTAP00000012770  eelqnlwflldkhqtppmigee........................................................
ENSBTAP00000009967  ngt...........................................................................
ENSBTAP00000015183  len...........................................................................
ENSBTAP00000014222  hlrkeqvsdvqkvlqa..............................................................
ENSBTAP00000026288  phlflr........................................................................
ENSBTAP00000002128  ssvirydvfinrlwdlr.............................................................
ENSBTAP00000003365  st............................................................................
ENSBTAP00000053738  sldeie........................................................................
ENSBTAP00000009228  nvemilkffdmflklkdivgs.........................................................
ENSBTAP00000026785  get...........................................................................
ENSBTAP00000002578  sl............................................................................
ENSBTAP00000000106  pvslpgis......................................................................
ENSBTAP00000028840  lhcrki........................................................................
ENSBTAP00000053594  ge............................................................................
ENSBTAP00000055414  dpkgmipmvviqnvlyeffqnpdlqletcclpvdiadsmkprlnktefiqlislhiagfksetfekllkhlchcaaef
ENSBTAP00000026698  qs............................................................................
ENSBTAP00000017015  ..............................................................................
ENSBTAP00000049908  d.............................................................................
ENSBTAP00000021395  isl...........................................................................
ENSBTAP00000007194  semefstlqdmpkelepsa...........................................................
ENSBTAP00000025455  srirre........................................................................


                                                                                                    
                                                                                                    
d1bjfa_               .........................................................................NSKLR
ENSBTAP00000019411  .........................................................................-----
ENSBTAP00000036057  .........................................................................-----
ENSBTAP00000038404  .........................................................................----R
ENSBTAP00000010971  .........................................................................----R
ENSBTAP00000019803  .........................................................................-----
ENSBTAP00000014038  .........................................................................-----
ENSBTAP00000002055  .........................................................................-----
ENSBTAP00000049731  .........................................................................-----
ENSBTAP00000005577  .........................................................................NSKLR
ENSBTAP00000034949  .........................................................................----S
ENSBTAP00000017447  .........................................................................-----
ENSBTAP00000010858  ...................................................................qehnnl-----
ENSBTAP00000046644  .........................................................................-----
ENSBTAP00000022814  .........................................................................NSKLA
ENSBTAP00000019758  ............................................................vhwqfgqldqhpi-----
ENSBTAP00000019321  .........................................................................NSKLA
ENSBTAP00000011677  .........................................................................-----
ENSBTAP00000011680  .........................................................................-----
ENSBTAP00000021742  .........................................................................-----
ENSBTAP00000005348  ........................................................................p-----
ENSBTAP00000016609  .........................................................................-----
ENSBTAP00000012740  .........................................................................-----
ENSBTAP00000018403  .........................................................................-----
ENSBTAP00000026407  .........................................................................-----
ENSBTAP00000052557  .........................................................................-----
ENSBTAP00000054167  .........................................................................-----
ENSBTAP00000010319  .........................................................................---AS
ENSBTAP00000041545  .........................................................................-----
ENSBTAP00000055204  .........................................................................-----
ENSBTAP00000003718  .........................................................................-----
ENSBTAP00000011676  .........................................................................-----
ENSBTAP00000049395  .........................................................................-----
ENSBTAP00000054983  .........................................................................-----
ENSBTAP00000052219  .........................................................................-----
ENSBTAP00000025402  .........................................................................-----
ENSBTAP00000011678  .........................................................................-----
ENSBTAP00000000433  .........................................................................-----
ENSBTAP00000021491  .........................................................................---PS
ENSBTAP00000044733  .........................................................................-----
ENSBTAP00000010937  .........................................................................-----
ENSBTAP00000056439  .........................................................................-----
ENSBTAP00000055780  .........................................................................-----
ENSBTAP00000038002  .........................................................................--LIS
ENSBTAP00000034705  .........................................................................-----
ENSBTAP00000035936  .........................................................................-----
ENSBTAP00000013699  .........................................................................-----
ENSBTAP00000002564  .........................................................................-----
ENSBTAP00000011496  .........................................................................-----
ENSBTAP00000019111  .........................................................................-----
ENSBTAP00000017036  .........................................................................-----
ENSBTAP00000003213  .........................................................................-----
ENSBTAP00000055444  .........................................................................-----
ENSBTAP00000024550  .........................................................................-----
ENSBTAP00000015248  .........................................................................-----
ENSBTAP00000021328  .........................................................................-----
ENSBTAP00000037091  .........................................................................-----
ENSBTAP00000029967  .........................................................................-----
ENSBTAP00000021449  .........................................................................-----
ENSBTAP00000053176  .........................................................................--HLS
ENSBTAP00000042361  .........................................................................-----
ENSBTAP00000016509  .........................................................................-----
ENSBTAP00000026714  .........................................................................-----
ENSBTAP00000004690  .........................................................................-----
ENSBTAP00000010858  .........................................................................-----
ENSBTAP00000013117  .........................................................................-----
ENSBTAP00000017574  .........................................................................-----
ENSBTAP00000004885  .........................................................................-----
ENSBTAP00000008961  .........................................................................-----
ENSBTAP00000028063  .........................................................................-----
ENSBTAP00000012740  .........................................................................-----
ENSBTAP00000006283  .........................................................................-----
ENSBTAP00000014306  .........................................................................-----
ENSBTAP00000053252  .........................................................................-----
ENSBTAP00000014304  .........................................................................-----
ENSBTAP00000045669  .........................................................................-----
ENSBTAP00000041264  .........................................................................-----
ENSBTAP00000006711  .........................................................................---LT
ENSBTAP00000017358  .........................................................................-----
ENSBTAP00000053274  .........................................................................-----
ENSBTAP00000055296  .........................................................................-----
ENSBTAP00000016852  .........................................................................-----
ENSBTAP00000036380  .........................................................................-----
ENSBTAP00000041719  .........................................................................-----
ENSBTAP00000049636  .........................................................................-----
ENSBTAP00000024444  .........................................................................-----
ENSBTAP00000004556  .........................................................................-----
ENSBTAP00000038767  .........................................................................---LR
ENSBTAP00000031285  .........................................................................-----
ENSBTAP00000011457  .........................................................................-----
ENSBTAP00000011047  .........................................................................-----
ENSBTAP00000002564  .........................................................................-----
ENSBTAP00000037104  .........................................................................-----
ENSBTAP00000002672  .........................................................................-----
ENSBTAP00000028269  .........................................................................-----
ENSBTAP00000016647  .........................................................................----R
ENSBTAP00000004536  .........................................................................-----
ENSBTAP00000042177  .........................................................................-----
ENSBTAP00000028063  .........................................................................-----
ENSBTAP00000050283  .........................................................................-----
ENSBTAP00000048539  .........................................................................-----
ENSBTAP00000045669  .........................................................................-----
ENSBTAP00000007972  .........................................................................-----
ENSBTAP00000040815  .........................................................................-----
ENSBTAP00000025661  .........................................................................-----
ENSBTAP00000028350  .........................................................................-----
ENSBTAP00000053274  .........................................................................-----
ENSBTAP00000021537  .........................................................................---FT
ENSBTAP00000055481  .........................................................................-----
ENSBTAP00000039155  .........................................................................-----
ENSBTAP00000029333  .........................................................................-----
ENSBTAP00000016315  .........................................................................-----
ENSBTAP00000021091  .........................................................................-----
ENSBTAP00000021618  .........................................................................-----
ENSBTAP00000055520  .........................................................................-----
ENSBTAP00000055624  .........................................................................-----
ENSBTAP00000016319  .........................................................................-----
ENSBTAP00000034078  .........................................................................-----
ENSBTAP00000006645  .........................................................................-----
ENSBTAP00000021909  .........................................................................-----
ENSBTAP00000001426  .........................................................................-----
ENSBTAP00000015802  .........................................................................-----
ENSBTAP00000032680  .........................................................................-----
ENSBTAP00000055007  .........................................................................-----
ENSBTAP00000020148  .........................................................................-----
ENSBTAP00000052345  .........................................................................-----
ENSBTAP00000029334  .........................................................................-----
ENSBTAP00000052345  .........................................................................-----
ENSBTAP00000056127  .........................................................................-----
ENSBTAP00000012557  .........................................................................-----
ENSBTAP00000011888  .........................................................................-----
ENSBTAP00000017060  .........................................................................-----
ENSBTAP00000031854  .........................................................................-----
ENSBTAP00000031823  .........................................................................-----
ENSBTAP00000021603  .........................................................................-----
ENSBTAP00000010838  .........................................................................-----
ENSBTAP00000014575  .........................................................................-----
ENSBTAP00000011215  .........................................................................-----
ENSBTAP00000053698  .........................................................................-----
ENSBTAP00000006806  .........................................................................-----
ENSBTAP00000029334  .........................................................................-----
ENSBTAP00000044105  .........................................................................-----
ENSBTAP00000026904  .........................................................................-----
ENSBTAP00000017060  .........................................................................-----
ENSBTAP00000055520  .........................................................................-----
ENSBTAP00000044226  .........................................................................-----
ENSBTAP00000055624  .........................................................................-----
ENSBTAP00000042182  .........................................................................-----
ENSBTAP00000010796  .........................................................................-----
ENSBTAP00000021174  .........................................................................-----
ENSBTAP00000006275  .........................................................................-----
ENSBTAP00000020950  .........................................................................-----
ENSBTAP00000053738  .........................................................................-----
ENSBTAP00000004963  .........................................................................-----
ENSBTAP00000023774  .........................................................................-----
ENSBTAP00000020395  .........................................................................-----
ENSBTAP00000020150  .........................................................................-----
ENSBTAP00000025561  .........................................................................-----
ENSBTAP00000053738  .........................................................................-----
ENSBTAP00000034009  .........................................................................-----
ENSBTAP00000020539  .........................................................................-----
ENSBTAP00000020778  .........................................................................-----
ENSBTAP00000017461  .........................................................................-----
ENSBTAP00000044096  .........................................................................-----
ENSBTAP00000008523  .........................................................................-----
ENSBTAP00000035196  .........................................................................-----
ENSBTAP00000041997  .........................................................................-----
ENSBTAP00000025499  .........................................................................-----
ENSBTAP00000055481  .........................................................................-----
ENSBTAP00000002174  .........................................................................-----
ENSBTAP00000000589  .........................................................................-----
ENSBTAP00000028239  .........................................................................-----
ENSBTAP00000014894  .........................................................................-----
ENSBTAP00000026544  .........................................................................-----
ENSBTAP00000029333  .........................................................................-----
ENSBTAP00000041966  .........................................................................-----
ENSBTAP00000008933  .........................................................................-----
ENSBTAP00000056088  .........................................................................-----
ENSBTAP00000033794  .........................................................................-----
ENSBTAP00000012786  .........................................................................-----
ENSBTAP00000030018  .........................................................................-----
ENSBTAP00000040233  .........................................................................-----
ENSBTAP00000003365  .........................................................................-----
ENSBTAP00000053176  .........................................................................-----
ENSBTAP00000024301  .........................................................................-----
ENSBTAP00000022292  .........................................................................-----
ENSBTAP00000015611  .........................................................................-----
ENSBTAP00000012770  .........................................................................-----
ENSBTAP00000000847  .........................................................................-----
ENSBTAP00000053738  .........................................................................-----
ENSBTAP00000054975  .........................................................................-----
ENSBTAP00000046639  .........................................................................-----
ENSBTAP00000052345  .........................................................................-----
ENSBTAP00000053164  .........................................................................-----
ENSBTAP00000016774  .........................................................................-----
ENSBTAP00000022630  .........................................................................-----
ENSBTAP00000010796  .........................................................................-----
ENSBTAP00000021909  .........................................................................-----
ENSBTAP00000033974  .........................................................................-----
ENSBTAP00000006711  .........................................................................-----
ENSBTAP00000010796  .........................................................................-----
ENSBTAP00000004912  .........................................................................-----
ENSBTAP00000005979  .........................................................................-----
ENSBTAP00000053738  .........................................................................-----
ENSBTAP00000053746  .........................................................................-----
ENSBTAP00000023221  .........................................................................-----
ENSBTAP00000019429  .........................................................................-----
ENSBTAP00000052019  .........................................................................-----
ENSBTAP00000042244  .........................................................................--SPS
ENSBTAP00000053738  .........................................................................-----
ENSBTAP00000018877  .........................................................................-----
ENSBTAP00000053019  .........................................................................-----
ENSBTAP00000003073  .........................................................................-----
ENSBTAP00000012886  .........................................................................-----
ENSBTAP00000044222  .........................................................................-----
ENSBTAP00000028499  .........................................................................-----
ENSBTAP00000047378  .........................................................................-----
ENSBTAP00000009308  .........................................................................-----
ENSBTAP00000017060  .........................................................................-----
ENSBTAP00000050406  .........................................................................-----
ENSBTAP00000031879  .........................................................................-----
ENSBTAP00000031854  .........................................................................-----
ENSBTAP00000001250  .........................................................................-----
ENSBTAP00000026035  .........................................................................-----
ENSBTAP00000011215  .........................................................................-----
ENSBTAP00000002128  .........................................................................-----
ENSBTAP00000053194  .........................................................................-----
ENSBTAP00000056127  .........................................................................-----
ENSBTAP00000033188  .........................................................................-----
ENSBTAP00000053548  .........................................................................-----
ENSBTAP00000011687  .........................................................................-----
ENSBTAP00000007636  .........................................................................-----
ENSBTAP00000020950  .........................................................................-----
ENSBTAP00000009115  .........................................................................-----
ENSBTAP00000023873  .........................................................................-----
ENSBTAP00000054471  .........................................................................-----
ENSBTAP00000039694  .........................................................................-----
ENSBTAP00000025205  .........................................................................-----
ENSBTAP00000047882  .........................................................................-----
ENSBTAP00000001368  .........................................................................-----
ENSBTAP00000029786  .........................................................................----K
ENSBTAP00000028993  .........................................................................-----
ENSBTAP00000023678  .........................................................................-----
ENSBTAP00000034710  .........................................................................-----
ENSBTAP00000031823  .........................................................................-----
ENSBTAP00000038002  .........................................................................-----
ENSBTAP00000021074  .........................................................................-----
ENSBTAP00000026544  .........................................................................-----
ENSBTAP00000007217  .........................................................................-----
ENSBTAP00000029792  .........................................................................----K
ENSBTAP00000044088  .........................................................................-----
ENSBTAP00000017319  .........................................................................-----
ENSBTAP00000044100  .........................................................................-----
ENSBTAP00000033594  .........................................................................-----
ENSBTAP00000026766  .........................................................................-----
ENSBTAP00000055894  .........................................................................-----
ENSBTAP00000015220  .........................................................................-----
ENSBTAP00000033613  .........................................................................-----
ENSBTAP00000056320  .........................................................................-----
ENSBTAP00000025249  .........................................................................-----
ENSBTAP00000029159  .........................................................................-----
ENSBTAP00000044088  .........................................................................-----
ENSBTAP00000016319  .........................................................................-----
ENSBTAP00000017662  .........................................................................-----
ENSBTAP00000012479  .........................................................................-----
ENSBTAP00000029886  .........................................................................-----
ENSBTAP00000027388  .........................................................................-----
ENSBTAP00000039694  .........................................................................-----
ENSBTAP00000023673  .........................................................................-----
ENSBTAP00000041488  .........................................................................-----
ENSBTAP00000001452  .........................................................................-----
ENSBTAP00000028498  .........................................................................-----
ENSBTAP00000001426  .........................................................................-----
ENSBTAP00000020240  .........................................................................-----
ENSBTAP00000053650  .........................................................................-----
ENSBTAP00000041651  .........................................................................-----
ENSBTAP00000005154  .........................................................................-----
ENSBTAP00000021174  .........................................................................-----
ENSBTAP00000022068  .........................................................................-----
ENSBTAP00000026682  .......................................................................nt-----
ENSBTAP00000007636  .........................................................................-----
ENSBTAP00000027954  .........................................................................-----
ENSBTAP00000020778  .........................................................................-----
ENSBTAP00000013601  .........................................................................-----
ENSBTAP00000005477  .........................................................................-----
ENSBTAP00000055305  .........................................................................-----
ENSBTAP00000036054  .........................................................................-----
ENSBTAP00000004912  .........................................................................-----
ENSBTAP00000022292  .........................................................................-----
ENSBTAP00000002717  .........................................................................-----
ENSBTAP00000036015  .........................................................................-----
ENSBTAP00000051638  .........................................................................-----
ENSBTAP00000026766  .........................................................................-----
ENSBTAP00000053738  .........................................................................-----
ENSBTAP00000016306  .........................................................................-----
ENSBTAP00000013714  .........................................................................-----
ENSBTAP00000036550  .........................................................................-----
ENSBTAP00000053738  .........................................................................-----
ENSBTAP00000023383  .........................................................................-----
ENSBTAP00000027030  .........................................................................-----
ENSBTAP00000053270  .........................................................................-----
ENSBTAP00000054640  .........................................................................-----
ENSBTAP00000012770  .........................................................................-----
ENSBTAP00000009967  .........................................................................-----
ENSBTAP00000015183  .........................................................................-----
ENSBTAP00000014222  .........................................................................-----
ENSBTAP00000026288  .........................................................................-----
ENSBTAP00000002128  .........................................................................-----
ENSBTAP00000003365  .........................................................................-----
ENSBTAP00000053738  .........................................................................-----
ENSBTAP00000009228  .........................................................................-----
ENSBTAP00000026785  .........................................................................-----
ENSBTAP00000002578  .........................................................................-----
ENSBTAP00000000106  .........................................................................-----
ENSBTAP00000028840  .........................................................................-----
ENSBTAP00000053594  .........................................................................-----
ENSBTAP00000055414  reviktdmrrqmfadlflhcdrgkvgfldrqrtlalletfydqsskvlrgtlrnprqwpfvefgeidlpefwg-----
ENSBTAP00000026698  .........................................................................-----
ENSBTAP00000017015  .........................................................................-----
ENSBTAP00000049908  .........................................................................-----
ENSBTAP00000021395  .........................................................................-----
ENSBTAP00000007194  .........................................................................-----
ENSBTAP00000025455  .........................................................................-----


                         10        20          30                                                   
                          |         |           |                                                   
d1bjfa_               PEVMQDLLESTDFTEHEIQE..WYKGF...........LRDCPS...................G..............
ENSBTAP00000019411  -----------QLTEEQIAE..FKEAFsl.........FDKDGD...................G..............
ENSBTAP00000036057  -----------QLTEEQIAE..FKEAFsl.........FDKDGD...................G..............
ENSBTAP00000038404  PEVMQDLLESTDFTEHEIQE..WYKGF...........LRDCPS...................G..............
ENSBTAP00000010971  PEMLQDLRENTEFSELELQE..WYKGF...........LKDCPT...................G..............
ENSBTAP00000019803  ------------NESEEVRQ..FRRLFa..........QLAGDD...................M..............
ENSBTAP00000014038  --------MCSHFDADEIKR..LGKRFkk.........LDLDNS...................G..............
ENSBTAP00000002055  -----------QLTEEQIAE..FKEAFsl.........FDKDGD...................G..............
ENSBTAP00000049731  -----------QLTEEQIAE..FQEAFsl.........FDKDGD...................G..............
ENSBTAP00000005577  PEVLQDLRENTEFTDHELQE..WYKGF...........LKDCPT...................G..............
ENSBTAP00000034949  KEILEELQLNTKFTEEELSS..WYQSF...........LKECPS...................G..............
ENSBTAP00000017447  --------------------..-----...........------...................-..............
ENSBTAP00000010858  --------------------..-----...........------...................-..............
ENSBTAP00000046644  --------------------..-----...........------...................-..............
ENSBTAP00000022814  PEVMEDLVKSTEFNEHELKQ..WYKGF...........LKDCPS...................G..............
ENSBTAP00000019758  --------------------..-----...........-----D...................G..............
ENSBTAP00000019321  PEVLEDLVQNTEFSEQELKQ..WYKGF...........LKDCPS...................G..............
ENSBTAP00000011677  ---------NTDQESEEQRQ..FRNIFr..........QIAGDD...................M..............
ENSBTAP00000011680  ------------QESEEQRQ..FRNIFr..........QIAGDD...................M..............
ENSBTAP00000021742  PEGLEQLQEQTKFTRKELQV..LYRGF...........KNECPS...................G..............
ENSBTAP00000005348  --------------------..-----...........------...................-..............
ENSBTAP00000016609  --------------------..LRKAYtklk.......LQVNQD...................G..............
ENSBTAP00000012740  --KIRRLQKALCLDLLELNT..TNEVFeqh........KLNQND...................Q..............
ENSBTAP00000018403  -----------KLSEEQVAE..FKEAFdr.........FDKNKD...................G..............
ENSBTAP00000026407  --------------------..-----...........------...................-..............
ENSBTAP00000052557  -----------ELTEEQKQE..VREAFdl.........FDADGS...................G..............
ENSBTAP00000054167  PEALELLEAQSKFTKKELQI..LYRGF...........KNECPS...................G..............
ENSBTAP00000010319  TTQRKRMSPKPELTEEQKQE..IREAFdl.........FDADGT...................G..............
ENSBTAP00000041545  ------------------QW..LSDWFqr.........GDKNQD...................G..............
ENSBTAP00000055204  --------------------..LWNVFqr.........VDKDRS...................G..............
ENSBTAP00000003718  ----EQLEAQTNFTKRELQV..LYRGF...........KNECPS...................G..............
ENSBTAP00000011676  -------------------Q..LRSLFe..........KFAGKD...................S..............
ENSBTAP00000049395  --------------------..----Clrk........ADKNKD...................N..............
ENSBTAP00000054983  --------------------..-----...........------...................-..............
ENSBTAP00000052219  --------------------..LYGYFa..........AVAGQD...................G..............
ENSBTAP00000025402  --------------------..-----...........-QLNPE...................G..............
ENSBTAP00000011678  ------LPDEQVLSEEEIDEn.FKSLFr..........QLAGED...................M..............
ENSBTAP00000000433  --------------------..-----...........------...................-..............
ENSBTAP00000021491  SDQWKKNAAKIELNETQKQE..IKEAFdl.........FDVDGS...................G..............
ENSBTAP00000044733  ---------------DDIDDg.FRRLFa..........QLAGED...................A..............
ENSBTAP00000010937  -----------------DQW..VKQTFee.........ADKNGD...................G..............
ENSBTAP00000056439  -----------------DQW..VKQTFee.........ADKNGD...................G..............
ENSBTAP00000055780  -----------QLTEEQKNE..FKAAFdif........VLGAED...................G..............
ENSBTAP00000038002  PSDFAQLQKYMEYSTKKVSD..VLKLFedgem......AEYLQG...................D..............
ENSBTAP00000034705  -----------------LDH..WIHSYlhr........ADSNQD...................S..............
ENSBTAP00000035936  -------------DAAQLQE..WYKKF...........LEECPS...................G..............
ENSBTAP00000013699  ------------------PE..AYSWFqs.........VDSDHS...................G..............
ENSBTAP00000002564  --KLRRVQKALRLDLVTLTT..ALEIFne.........HDLQAS...................Eh.............
ENSBTAP00000011496  --------------------..--KGF...........IKDCPS...................G..............
ENSBTAP00000019111  ------------LSEEQKQE..IKDAFel.........FDTDKD...................E..............
ENSBTAP00000017036  ------------LSSTECHQ..WYKKF...........MTECPS...................G..............
ENSBTAP00000003213  ------------------QW..LKQTFde.........ADKNGD...................G..............
ENSBTAP00000055444  ------------------QW..LKQTFde.........ADKNGD...................G..............
ENSBTAP00000024550  --------------------..-WKCFl..........AIAGQD...................G..............
ENSBTAP00000015248  ------------FDQSQIQE..FKEAFnm.........IDQNRD...................G..............
ENSBTAP00000021328  ------------FDQSQIQE..FKEAFnm.........IDQNRD...................G..............
ENSBTAP00000037091  ------------FDQSQIQE..FKEAFnm.........IDQNRD...................G..............
ENSBTAP00000029967  ------------LRPEEIEE..LQAAFqe.........FDRDRD...................G..............
ENSBTAP00000021449  -------QRERPLGPDEIEE..LREAFle.........FDKDRD...................G..............
ENSBTAP00000053176  PSEFSQLQKYAEYSTKKLKD..VLEEFhgngvl.....AKYNPE...................Gkqdilnq.......
ENSBTAP00000042361  ------------LRPEEIEE..LREAFre.........FDKDKD...................G..............
ENSBTAP00000016509  -------------DAAQLQE..WYKKF...........LEECPS...................G..............
ENSBTAP00000026714  --------------PEEIEE..LREAFre.........FDKDKD...................G..............
ENSBTAP00000004690  ------------------QD..FVRLFh..........IVAGGE...................Gk.............
ENSBTAP00000010858  --------------------..-----...........------...................-..............
ENSBTAP00000013117  -------------------W..VSQMFse.........IDVDDL...................G..............
ENSBTAP00000017574  --------------------..----Fllmv.......RDDFKG...................G..............
ENSBTAP00000004885  -------------------R..YETLFqk.........LDRNGD...................G..............
ENSBTAP00000008961  --------------------..-----...........------...................-..............
ENSBTAP00000028063  --KLRFVQKRCNLHLVDIWN..MIEAFrdngl......NTLDHS...................T..............
ENSBTAP00000012740  --------------------..-----...........------...................-..............
ENSBTAP00000006283  ------------LGPEELDE..LQAAFee.........FDTDHD...................G..............
ENSBTAP00000014306  ------------FTEDQTAE..FKEAFql.........FDRTGD...................G..............
ENSBTAP00000053252  -----------------FMW..LKTVFea.........ADIDGN...................G..............
ENSBTAP00000014304  ------------FTEDQTAE..FKEAFql.........FDRTGD...................G..............
ENSBTAP00000045669  --KLRFVQKKCNLHLVDIWN..VIEALrenal......NNVDPN...................M..............
ENSBTAP00000041264  --------------------..-----...........------...................-..............
ENSBTAP00000006711  PEEFGQLQKYAEYSSKKIKY..VLAEFneggsl.....KQYGPH...................E..............
ENSBTAP00000017358  --------------------..-----...........------...................T..............
ENSBTAP00000053274  --KLRFVQKKCNLHLVDIWN..VIEALrenal......NNVDPN...................M..............
ENSBTAP00000055296  --------------------..-----...........------...................T..............
ENSBTAP00000016852  ------------------KG..LGRVFri.........MDDNNN...................R..............
ENSBTAP00000036380  ------------LSQDQINE..YKECFsl.........YDKQQR...................G..............
ENSBTAP00000041719  ------------FNKDQLEE..FKEAFel.........YDRVGD...................G..............
ENSBTAP00000049636  ------------FSKQQQDE..FKEAFll.........FDRTGE...................C..............
ENSBTAP00000024444  ------------FEQTQIQE..FKEAFti.........MDQNRD...................G..............
ENSBTAP00000004556  --------------------..-----...........------...................-..............
ENSBTAP00000038767  DEELEEIKKETGFSHSQITR..LYSRFts.........LDKGEN...................G..............
ENSBTAP00000031285  --------------------..-----...........------...................-..............
ENSBTAP00000011457  ---------CKHFSKFEVKC..LINLFynlvg......EVTERQ...................Gvii...........
ENSBTAP00000011047  ------------FTPEQIEE..FKEAFtl.........FDRTPK...................Cem............
ENSBTAP00000002564  --------------------..-----...........------...................-..............
ENSBTAP00000037104  ------------FDQSQIQE..FKEAFti.........MDQNRD...................G..............
ENSBTAP00000002672  ------------FEQAQIQE..FKEAFsc.........IDQNRD...................G..............
ENSBTAP00000028269  ------------FDQTQIQE..FKEAFtv.........IDQNRD...................G..............
ENSBTAP00000016647  IPDVDSLRQETGFSQASLRR..LYDRFna.........LDRTGK...................G..............
ENSBTAP00000004536  ---------------ERRQR..WGRLFee.........LDSNKD...................G..............
ENSBTAP00000042177  --------------------..-----...........------...................-..............
ENSBTAP00000028063  --------------------..-----...........------...................-..............
ENSBTAP00000050283  ------------------TE..FKEAFsl.........FDRTPT...................Gel............
ENSBTAP00000048539  ------ISQNLKLDWDNIHQ..CLDKYaei........AVASKG...................G..............
ENSBTAP00000045669  --------------------..-----...........------...................-..............
ENSBTAP00000007972  --------------------..--RFFrr.........LDQDGS...................R..............
ENSBTAP00000040815  ----------------EERV..VHWYFsq.........LDSNSS...................S..............
ENSBTAP00000025661  ------ISRKLKLDWDGIRK..HLDEYaai........ASSSKG...................G..............
ENSBTAP00000028350  -ELLAEYQDLTFLTKQEILL..AHRRFcel........LPQEHR...................Sveeslqa.......
ENSBTAP00000053274  --------------------..-----...........------...................-..............
ENSBTAP00000021537  HEQLEAYQDCTFFTRKEIMR..LFYRYqdlapqlvpldYTSCPD...................V..............
ENSBTAP00000055481  --------------------..-----...........------...................-..............
ENSBTAP00000039155  --------------------..--EAFsl.........FHSDSN...................S..............
ENSBTAP00000029333  --------------------..-----...........------...................-..............
ENSBTAP00000016315  ---------PWRITEEQREY..YVNQFrs.........LQPDPS...................S..............
ENSBTAP00000021091  --------------------..-----...........------...................-..............
ENSBTAP00000021618  --------------------..-----...........------...................-..............
ENSBTAP00000055520  --------------------..-----...........----GE...................S..............
ENSBTAP00000055624  --------------------..-----...........----GE...................S..............
ENSBTAP00000016319  ---------PWKITDEQRQY..YVNQFkt.........IQPDLN...................G..............
ENSBTAP00000034078  ------------------KK..IKEAFev.........FDHESN...................N..............
ENSBTAP00000006645  WEDLEEYQALTFLTRNEILC..IHDSF...........LKLCPP...................Gkyykea........
ENSBTAP00000021909  --------------------..-ERRFkm.........ADKDGD...................L..............
ENSBTAP00000001426  ---------------LTATQ..FLEIWkh.........FDADGN...................G..............
ENSBTAP00000015802  --------------------..-----...........------...................-..............
ENSBTAP00000032680  --------------------..-----...........------...................-..............
ENSBTAP00000055007  ----------SYLSEEMIAE..FKAAFdm.........FDADGG...................G..............
ENSBTAP00000020148  -------------TERCIES..LIAVFqkh........AGRDGN...................Ns.............
ENSBTAP00000052345  --------------------..-----...........------...................-..............
ENSBTAP00000029334  --------------------..-----...........------...................-..............
ENSBTAP00000052345  -----------AVKPEDKAK..YDAIFd..........SLCPVN...................G..............
ENSBTAP00000056127  --------------------..--RRFka.........ADLDSD...................Q..............
ENSBTAP00000012557  -------------------D..LIRAFql.........QDRNKS...................G..............
ENSBTAP00000011888  -----------------LQW..VTHQFk..........TIAGED...................G..............
ENSBTAP00000017060  --------------VEEKAK..FDGIFe..........SLLPVN...................G..............
ENSBTAP00000031854  -------QITDYFSYEHFYV..IYCKFwe.........LDSDHD...................L..............
ENSBTAP00000031823  --------------------..-ERRFrv.........ADQDGD...................S..............
ENSBTAP00000021603  --------------------..-----...........------...................-..............
ENSBTAP00000010838  ---------------QAITD..LINLFh..........KYSGSD...................D..............
ENSBTAP00000014575  --------------------..-----...........------...................-..............
ENSBTAP00000011215  -------QITDYFSYEHFYV..IYCKFwe.........LDSDHD...................L..............
ENSBTAP00000053698  -----------NISVEELDE..IREAFrv.........LDRDGN...................G..............
ENSBTAP00000006806  -----------------MET..LINVFh..........AHSGKE...................Gdky...........
ENSBTAP00000029334  ---------MWAITSEERTK..HDKQFd..........NLKPSG...................G..............
ENSBTAP00000044105  ---------------QAITD..LINLFh..........KYSGSD...................D..............
ENSBTAP00000026904  --------------------..MIRTFh..........RYSCRE...................Gdrf...........
ENSBTAP00000017060  --------------------..-----...........------...................-..............
ENSBTAP00000055520  --------------------..-----...........------...................-..............
ENSBTAP00000044226  -----------------MET..LINVFh..........AHSGKE...................Gdky...........
ENSBTAP00000055624  --------------------..-----...........------...................-..............
ENSBTAP00000042182  --------------------..-----...........------...................-..............
ENSBTAP00000010796  --------------------..----Cke.........RDFNKQ...................G..............
ENSBTAP00000021174  --------------------..FFEIWlh.........FDADGS...................G..............
ENSBTAP00000006275  ------------------VA..LIDVFh..........QYSGRE...................Gdkh...........
ENSBTAP00000020950  --------------------..--KRFek.........ANQDSG...................P..............
ENSBTAP00000053738  --------------------..----Cke.........RDFNKQ...................G..............
ENSBTAP00000004963  -----------SFKKSEIEC..LIRIFhn.........V-VGRG...................Dvklanv........
ENSBTAP00000023774  -------------------E..IREAFkv.........FDRDGN...................G..............
ENSBTAP00000020395  -------RNTTGVTEEALKE..FSMMFkh.........FDKDKS...................G..............
ENSBTAP00000020150  --------------------..MMFTFh..........KFAGDK...................G..............
ENSBTAP00000025561  ------------------DV..MVSTFh..........KYSGKE...................Gdkf...........
ENSBTAP00000053738  --------------------..PYAAFfk.........MDTDRD...................G..............
ENSBTAP00000034009  ---------------DHLEG..IINIFhqys.......VRVGHF...................D..............
ENSBTAP00000020539  --------------------..-----...........------...................-..............
ENSBTAP00000020778  --------------QEVLEN..LKDRWyqa........DNPPPD...................L..............
ENSBTAP00000017461  --------RTWEASPPEHKK..WVEVFka.........CDEDNK...................G..............
ENSBTAP00000044096  -------------SIETIIN..IFHQYs..........VRLGHY...................D..............
ENSBTAP00000008523  -------------SIETIIN..IFHQYs..........VRLGHY...................D..............
ENSBTAP00000035196  -------PEEKEMKPACIKA..LTRIFki.........SDQDND...................G..............
ENSBTAP00000041997  --------------------..--EIFy..........TLSPVD...................G..............
ENSBTAP00000025499  --------------------..-----...........------...................-..............
ENSBTAP00000055481  --------DIWAITVEERAK..HDQQFh..........SLKPIS...................G..............
ENSBTAP00000002174  --------------------..--EIFy..........TLSPVN...................G..............
ENSBTAP00000000589  --------------------..-----...........------...................Gdkf...........
ENSBTAP00000028239  -----------------KSK..YDEIFy..........NLAPAD...................G..............
ENSBTAP00000014894  ---------AKGISQEQMQE..FRASFnh.........FDKDHG...................G..............
ENSBTAP00000026544  -------------------E..FMRIWrk.........YDADSS...................G..............
ENSBTAP00000029333  --------DIWAITVEERAK..HDQQFh..........SLKPIS...................G..............
ENSBTAP00000041966  --------------------..-----...........------...................-..............
ENSBTAP00000008933  --------------------..-----...........-----N...................G..............
ENSBTAP00000056088  ---------------DHLEG..IINIFhqys.......VRVGHF...................D..............
ENSBTAP00000033794  ---------------FQIIH..CYHEYa..........AREGDA...................E..............
ENSBTAP00000012786  ---------AKGITQEQMNE..FRASFnh.........FDRRKN...................G..............
ENSBTAP00000030018  ---------AKGLSQEQLNE..FRASFnh.........FDRKRN...................G..............
ENSBTAP00000040233  -------------------E..LKRAFhl.........LDTANN...................M..............
ENSBTAP00000003365  ------------LTEEEIFYmnCRAAYltv........FKSSLD...................N..............
ENSBTAP00000053176  --------------------..-----...........------...................-..............
ENSBTAP00000024301  ----------KGISQEQMNE..FRASFnh.........FDRDHS...................G..............
ENSBTAP00000022292  ------------------QE..LRNIFlqyas......TEVDGE...................H..............
ENSBTAP00000015611  --------------------..--DTFykyt.......KQDGEC...................G..............
ENSBTAP00000012770  ------SQETNWFSAPSALR..VYGQYln.........LDKDHN...................G..............
ENSBTAP00000000847  --------------------..-----...........------...................-..............
ENSBTAP00000053738  -------------------E..LKRAFhl.........LDTANN...................M..............
ENSBTAP00000054975  --------------------..-----...........------...................-..............
ENSBTAP00000046639  --------------------..-----...........LDKEGN...................G..............
ENSBTAP00000052345  --------------------..LYEKYyrq........VDTGNT...................G..............
ENSBTAP00000053164  --------------------..-----...........------...................-..............
ENSBTAP00000016774  -----------------LID..VYHKYs..........LKKGNY...................H..............
ENSBTAP00000022630  -------------SPEELKG..IFEKYa..........AKEGDP...................N..............
ENSBTAP00000010796  --------------------..-STAFsa.........LDKEDT...................G..............
ENSBTAP00000021909  --------------------..-----...........FDYDHD...................A..............
ENSBTAP00000033974  --------------------..-----...........--EEGK...................G..............
ENSBTAP00000006711  --------------------..-----...........------...................-..............
ENSBTAP00000010796  --------------------..----Fie.........TDSEGN...................G..............
ENSBTAP00000004912  --------------------..--KQYas.........IEKNGE...................F..............
ENSBTAP00000005979  ----------KQLRPACAQA..LTRIFrl.........SDQDMD...................Q..............
ENSBTAP00000053738  --------------------..-STAFsa.........LDKEDT...................G..............
ENSBTAP00000053746  --------------------..-----...........------...................-..............
ENSBTAP00000023221  --------------------..-----...........------...................-..............
ENSBTAP00000019429  ------YSEFPEFSRRLIKD..LESMFkl.........YDAGRD...................G..............
ENSBTAP00000052019  -------------------T..VIRVFqky........AKENGD...................St.............
ENSBTAP00000042244  RRVFNPYTEFKEFSRKQIKD..MEKMFke.........YDAGRD...................G..............
ENSBTAP00000053738  --------------------..-----...........-KSKPD...................G..............
ENSBTAP00000018877  --------------------..-----...........------...................N..............
ENSBTAP00000053019  ----------TTISREELEE..LQEAFnk.........IDIDNS...................G..............
ENSBTAP00000003073  --------------------..-----...........------...................-..............
ENSBTAP00000012886  --------------PSDIDR..YKKRFhk.........FDADQK...................G..............
ENSBTAP00000044222  --------------------..-----...........------...................-..............
ENSBTAP00000028499  --------------------..----Fa..........GREGRK...................G..............
ENSBTAP00000047378  ------------------SQ..LRDVYss.........CDTTGT...................G..............
ENSBTAP00000009308  ----------------EM--..-----...........------...................-..............
ENSBTAP00000017060  --------------------..-YESYykq........VDPAYT...................G..............
ENSBTAP00000050406  ---------TTQISKDELDE..LKEAFak.........VDLNSN...................G..............
ENSBTAP00000031879  ---------TTQISKDELDE..LKEAFak.........VDLNSN...................G..............
ENSBTAP00000031854  --------------------..-----...........------...................Q..............
ENSBTAP00000001250  --------------------..-----...........------...................-..............
ENSBTAP00000026035  -----------------ING..IIEAFrry........ARMEGD...................Ca.............
ENSBTAP00000011215  --------------------..-----...........------...................Q..............
ENSBTAP00000002128  --------------------..-----...........-----E...................N..............
ENSBTAP00000053194  ----------TGLSEETRQE..FETTFrh.........FDENLT...................G..............
ENSBTAP00000056127  --------------------..-----...........------...................-..............
ENSBTAP00000033188  --------------------..-----...........------...................-..............
ENSBTAP00000053548  --------------------..-----...........------...................-..............
ENSBTAP00000011687  -------------SVRNVKA..LVEYFhl.........LDVHHK...................K..............
ENSBTAP00000007636  --------------------..-----...........------...................-..............
ENSBTAP00000020950  --------------------..-----...........------...................-..............
ENSBTAP00000009115  ------------LSPSQMRA..FQDAYnf.........FNKDKT...................G..............
ENSBTAP00000023873  PEGLDQLQAQTKFTKKELQS..LYRGF...........KNECPT...................G..............
ENSBTAP00000054471  --------------------..-----...........------...................-..............
ENSBTAP00000039694  ---------------LQTEV..LEIEFl..........SYSNGM...................N..............
ENSBTAP00000025205  --------------------..-----...........------...................-..............
ENSBTAP00000047882  --------------------..-----...........------...................-..............
ENSBTAP00000001368  --------------------..-----...........------...................-..............
ENSBTAP00000029786  RNVVRTIVTETSFTTDELEE..LYALFkaeh.......LTSCYW...................Ggnsnaldrhdpslp
ENSBTAP00000028993  ---------------EELAR..LRSVFaa.........CDANRS...................G..............
ENSBTAP00000023678  --------------------..-----...........------...................-..............
ENSBTAP00000034710  --------------------..-----...........------...................-..............
ENSBTAP00000031823  --------------------..-----...........------...................-..............
ENSBTAP00000038002  --------------------..-----...........------...................-..............
ENSBTAP00000021074  ----------------DILC..VIETFhk.........YAREDA...................A..............
ENSBTAP00000026544  --------------------..-WQVWqr.........FDVEEK...................G..............
ENSBTAP00000007217  --------------------..-----...........--ADRD...................H..............
ENSBTAP00000029792  RSVVRAIPGDIGFSIEELED..LYMVFkakhla.....S--QYWgssrpaavrrdpslpyleqY..............
ENSBTAP00000044088  --------------------..-----...........------...................-..............
ENSBTAP00000017319  --------------------..---VFr..........NSSDPD...................G..............
ENSBTAP00000044100  --------------------..-----...........------...................-..............
ENSBTAP00000033594  --------------------..-----...........------...................-..............
ENSBTAP00000026766  PTFYQTLAGVTHLEESDIID..LEKRYwll........KAQSRT...................G..............
ENSBTAP00000055894  ---------------EKLTA..FKEKYme.........FDLNNE...................G..............
ENSBTAP00000015220  --------------------..-----...........------...................-..............
ENSBTAP00000033613  --------------------..-----...........------...................-..............
ENSBTAP00000056320  --------------------..----Fwe.........LDTDHD...................L..............
ENSBTAP00000025249  --------------------..-----...........------...................-..............
ENSBTAP00000029159  --------------------..-----...........------...................-..............
ENSBTAP00000044088  --------------------..-----...........-----E...................R..............
ENSBTAP00000016319  -------------SDAEQKY..YSDLFsy.........CDIEST...................K..............
ENSBTAP00000017662  --------------------..-----...........------...................-..............
ENSBTAP00000012479  --------------------..-----...........LDPVSS...................G..............
ENSBTAP00000029886  --------------------..-----...........------...................-..............
ENSBTAP00000027388  --------------------..-----...........------...................-..............
ENSBTAP00000039694  --------------------..-----...........------...................-..............
ENSBTAP00000023673  --------------------..-----...........------...................-..............
ENSBTAP00000041488  --------------------..-----...........------...................-..............
ENSBTAP00000001452  --------------------..-----...........------...................-..............
ENSBTAP00000028498  -----------------IET..LIKNFhqy........SVEGGK...................E..............
ENSBTAP00000001426  --------------------..-----...........------...................-..............
ENSBTAP00000020240  --------------------..-----...........------...................-..............
ENSBTAP00000053650  --------------------..-----...........------...................-..............
ENSBTAP00000041651  --------------------..-----...........------...................-..............
ENSBTAP00000005154  --------------------..-----...........------...................-..............
ENSBTAP00000021174  --------------------..-----...........------...................-..............
ENSBTAP00000022068  --------------------..-----...........------...................-..............
ENSBTAP00000026682  --------------------..-----...........------...................-..............
ENSBTAP00000007636  --------------------..-----...........-----D...................G..............
ENSBTAP00000027954  --------------------..-----...........------...................-..............
ENSBTAP00000020778  --------------------..-----...........------...................-..............
ENSBTAP00000013601  --------------------..-----...........------...................-..............
ENSBTAP00000005477  --------------------..-----...........------...................-..............
ENSBTAP00000055305  --------------------..-----...........------...................-..............
ENSBTAP00000036054  --------------------..-----...........------...................-..............
ENSBTAP00000004912  -----------------LEH..AKQAFvq.........RDSART...................G..............
ENSBTAP00000022292  --------------------..-----...........------...................-..............
ENSBTAP00000002717  --------------------..-----...........------...................-..............
ENSBTAP00000036015  ------------------KS..IWYAFta.........LDVEKS...................G..............
ENSBTAP00000051638  --------------------..-----...........------...................-..............
ENSBTAP00000026766  --------------------..-----...........------...................-..............
ENSBTAP00000053738  --------------------..-----...........------...................-..............
ENSBTAP00000016306  --------------------..-----...........------...................-..............
ENSBTAP00000013714  --------------------..-----...........------...................-..............
ENSBTAP00000036550  -NVLRVVIPEVSVLPEDLEE..LYDLFkreh.......MMSCYWeqprpmaprhdpsrpyaeqY..............
ENSBTAP00000053738  -----------------DPA..FRKRFld.........FTKEPN...................G..............
ENSBTAP00000023383  -------------------W..LRKQFys.........VDRNRE...................D..............
ENSBTAP00000027030  -------------------K..LQEVCed.........LGITRD...................G..............
ENSBTAP00000053270  -------------------K..LQEVCed.........LGITRD...................G..............
ENSBTAP00000054640  -------------------K..LQEVCed.........LGITRD...................G..............
ENSBTAP00000012770  --------------------..-----...........------...................A..............
ENSBTAP00000009967  ------------LTIEQLDN..LRDQF...........LDIAPK...................G..............
ENSBTAP00000015183  --------------------..-----...........------...................-..............
ENSBTAP00000014222  --------------------..-----...........------...................-..............
ENSBTAP00000026288  ---------LHDWSVEHETF..LREAFs..........FVDRGD...................G..............
ENSBTAP00000002128  --------------------..-----...........------...................-..............
ENSBTAP00000003365  --------------------..-----...........------...................-..............
ENSBTAP00000053738  --------------------..-----...........------...................-..............
ENSBTAP00000009228  --------------------..-----...........------...................-..............
ENSBTAP00000026785  --------------------..-----...........------...................-..............
ENSBTAP00000002578  -------------KDELLKG..IWHAFta.........LDLDHS...................G..............
ENSBTAP00000000106  ----------------SIED..LQGLFhk.........TGQDVD...................G..............
ENSBTAP00000028840  -------------------K..ILELFh..........KVDQGK...................H..............
ENSBTAP00000053594  --------------------..-----...........------...................-..............
ENSBTAP00000055414  --------------------..-----...........------...................-..............
ENSBTAP00000026698  --------------------..-----...........------...................R..............
ENSBTAP00000017015  ------------LTEEEMYS..LTETFqq.........CKVIPD...................C..............
ENSBTAP00000049908  --------------------..-----...........------...................-..............
ENSBTAP00000021395  --------------------..-----...........---NPS...................V..............
ENSBTAP00000007194  --------------------..-----...........------...................-..............
ENSBTAP00000025455  --------------------..-----...........------...................-..............


                            40        50                                                            
                             |         |                                                            
d1bjfa_               .....HLSMEEFKKIYGN............F.............F....PYG.......DASK...............
ENSBTAP00000019411  .....TITTKELGTVMRS............L.............G....QNP.......TEAE...............
ENSBTAP00000036057  .....TITTKELGTVMRS............L.............G....QNP.......TEAE...............
ENSBTAP00000038404  .....HLSMEEFKKIYGN............F.............F....PYG.......DASK...............
ENSBTAP00000010971  .....ILNVDEFKKIYAN............F.............F....PYG.......DASK...............
ENSBTAP00000019803  .....EVSATELMNILNKvvtrhpd.....L.............K....TDG.......FGID...............
ENSBTAP00000014038  .....SLSVEEFMSL---............-.............-....PEL.......QQNP...............
ENSBTAP00000002055  .....TITTKELGTVMRS............L.............G....QNP.......TEAE...............
ENSBTAP00000049731  .....TITTKELGTVMRS............L.............G....QNP.......TEAE...............
ENSBTAP00000005577  .....HLTVDEFKKIYAN............F.............F....PYG.......DASK...............
ENSBTAP00000034949  .....RITRQEFQTIYSK............F.............F....PEA.......DPKA...............
ENSBTAP00000017447  .....-------------............-.............-....---.......----...............
ENSBTAP00000010858  .....-------------............V.............N....VPL.......CVDM...............
ENSBTAP00000046644  .....-------------............-.............-....---.......----...............
ENSBTAP00000022814  .....RLNLEEFQQLYVK............F.............F....PYG.......DASK...............
ENSBTAP00000019758  .....YLSHTELAPLRAP............L.............I....PME.......HC--...............
ENSBTAP00000019321  .....ILNLEEFQQLYIK............F.............F....PYG.......DASK...............
ENSBTAP00000011677  .....EICADELKNVLNRvvnkhkd.....L.............K....TQG.......FTLE...............
ENSBTAP00000011680  .....EICADELKNVLNRvvnkhkd.....L.............K....TQG.......FTLE...............
ENSBTAP00000021742  .....IVNEENFKQIYSQ............F.............F....PQG.......DSST...............
ENSBTAP00000005348  .....-------------............-.............-....---.......----...............
ENSBTAP00000016609  .....RIPVKNILKMFSA............-.............-....---.......DKKR...............
ENSBTAP00000012740  .....LLSVPDVINCLTTtydgleqmhknlV.............N....VPL.......CVDM...............
ENSBTAP00000018403  .....TISVQELGTVMQE............V.............G....LKL.......SEAE...............
ENSBTAP00000026407  .....-------------............D.............G....KAV.......TGTD...............
ENSBTAP00000052557  .....TIDVKELKVAMRA............L.............G....FEP.......RKEE...............
ENSBTAP00000054167  .....VVNEDTFKEIYSQ............F.............F....PQG.......DSTT...............
ENSBTAP00000010319  .....TIDVKELKVAMRA............L.............G....FEP.......KKEE...............
ENSBTAP00000041545  .....RMSFGEVQRLLHL............M.............N....VEM.......DQEY...............
ENSBTAP00000055204  .....VISDNELQQALSN............G.............T....WTP.......FNPV...............
ENSBTAP00000003718  .....VVNEETFKQIYAQ............F.............F....PHG.......DASM...............
ENSBTAP00000011676  .....EIRANELRTALNE............V.............F....SKR.......TDIKfdgfdin........
ENSBTAP00000049395  .....KMSFKELQNFLKE............L.............N....IQV.......DDSY...............
ENSBTAP00000054983  .....EMHGKNWSKLCRDcqvi........D.............G....RSV.......TVTD...............
ENSBTAP00000052219  .....QIDADELQRCLTQsgia........G.............G....YKP.......FNLE...............
ENSBTAP00000025402  .....KIPVKNFQMF---............-.............-....-PA.......DRKR...............
ENSBTAP00000011678  .....EISVKELRTILNRiiskhkd.....L.............R....TTG.......FSLE...............
ENSBTAP00000000433  .....EMNNKNFSKLCKDcgim........D.............G....KTV.......TSTD...............
ENSBTAP00000021491  .....TIDVKELKIAMRA............L.............G....FEP.......KKEE...............
ENSBTAP00000044733  .....EISAFELQTILRRvlakrqd.....I.............K....SDG.......FSIE...............
ENSBTAP00000010937  .....LLNIEEIHQLMHK............L.............N....VNL.......PRRK...............
ENSBTAP00000056439  .....LLNIEEIHQLMHK............L.............N....VNL.......PRRK...............
ENSBTAP00000055780  .....CISTKELGKVMRM............L.............G....QNP.......TPEE...............
ENSBTAP00000038002  .....AIGYEGFQQFLKIy...........L.............E....VDN.......VPDH...............
ENSBTAP00000034705  .....KMSFKEIKNLLRM............V.............N....LDM.......NDMY...............
ENSBTAP00000035936  .....TLFMHEFKRFFKV............P.............D....NEE.......ATQY...............
ENSBTAP00000013699  .....YISIKELKQALVN............S.............N....WSS.......FNDE...............
ENSBTAP00000002564  .....VMDVVEVIHCLTA............Lyerleeergilv.N....VPL.......CVDM...............
ENSBTAP00000011496  .....QLDAAGFQKIYKQ............F.............F....PFG.......DPTK...............
ENSBTAP00000019111  .....AIDYHELKVAMRA............L.............G....FDV.......KKAD...............
ENSBTAP00000017036  .....QLTLYEFRQFFGL............K.............N....LSP.......WASQ...............
ENSBTAP00000003213  .....SLSIGEVLQLLHK............L.............N....VNL.......PRQR...............
ENSBTAP00000055444  .....SLSIGEVLQLLHK............L.............N....VNL.......PRQR...............
ENSBTAP00000024550  .....EVDAEELQKCLTQ............S.............G....ISG.......TYSPfsle...........
ENSBTAP00000015248  .....FIDKEDLHDMLAS............M.............G....KNP.......TDEY...............
ENSBTAP00000021328  .....FIDKEDLHDMLAS............L.............G....KNP.......TDEY...............
ENSBTAP00000037091  .....FIDKEDLHDMLAS............L.............G....KNP.......TDAY...............
ENSBTAP00000029967  .....YIGYQELGACMRT............L.............G....YMP.......TEME...............
ENSBTAP00000021449  .....FISCKDLGNLMRT............M.............G....YMP.......TEME...............
ENSBTAP00000053176  .....TIDFEGFKLFMKT............F.............L....EAE.......LPDD...............
ENSBTAP00000042361  .....YINCRDLGNCMRT............M.............G....YMP.......TEME...............
ENSBTAP00000016509  .....TLFMHEFKRFFKV............P.............D....NEE.......ATQY...............
ENSBTAP00000026714  .....YINCRDLGNCMRT............M.............G....YMP.......TEME...............
ENSBTAP00000004690  .....EIGMYELQKLLNKvvsrfkn.....F.............K....TKG.......FSLD...............
ENSBTAP00000010858  .....-------------............-.............-....---.......----...............
ENSBTAP00000013117  .....HITLCSAVQCIRN............L.............N....PGL.......KTSK...............
ENSBTAP00000017574  .....KITLEKALKLLEK............L.............D....IQC.......NTIH...............
ENSBTAP00000004885  .....VVDISELQEGLKS............L.............G....IPL.......GQDA...............
ENSBTAP00000008961  .....IVPWKSFRQALHE............V.............H....PIS.......SGLE...............
ENSBTAP00000028063  .....EISVSRLETVISS............I.............Y....YQL.......NKRLpsthqisveqsisl.
ENSBTAP00000012740  .....-------------............-.............-....---.......----...............
ENSBTAP00000006283  .....YIGYRDLGECMRT............L.............G....YMP.......TEME...............
ENSBTAP00000014306  .....KILYSQCGDVMRA............L.............G....QNP.......TNAE...............
ENSBTAP00000053252  .....IMLEDTSVELIKQ............L.............N....PTL.......KESK...............
ENSBTAP00000014304  .....KILYSQCGDVMRA............L.............G....QNP.......TNAE...............
ENSBTAP00000045669  .....ELNVARLEAVLST............I.............F....YQL.......NKRMptthqiqveqsisl.
ENSBTAP00000041264  .....VLPWAEFEAVLCI............C.............H....PVE.......PGST...............
ENSBTAP00000006711  .....PISYDVFKLFMKAy...........L.............E....VDL.......PQPL...............
ENSBTAP00000017358  .....IVPWKVFRQCLHE............V.............H....QIS.......SGLE...............
ENSBTAP00000053274  .....ELNVARLEAVLST............I.............F....YQL.......NKRMptthqiqveqsisl.
ENSBTAP00000055296  .....IVPWKVFRQCLHE............V.............H....QIS.......SGLE...............
ENSBTAP00000016852  .....TLDFKEFVKGLND............Y.............A....VVM.......EKEE...............
ENSBTAP00000036380  .....KIKATDLLTVMRC............L.............G....ASP.......TPGE...............
ENSBTAP00000041719  .....KIQFSQCGDVMRA............L.............G....QNP.......TNAE...............
ENSBTAP00000049636  .....KITLSQVGDVLRA............L.............G....TNP.......TNAE...............
ENSBTAP00000024444  .....FIDKNDLRDTFAA............L.............G....RVN.......VKNE...............
ENSBTAP00000004556  .....-------------............-.............-....---.......----...............
ENSBTAP00000038767  .....TLSREDFQRI---............-.............-....PEL.......AINP...............
ENSBTAP00000031285  .....-------------............-.............-....---.......----...............
ENSBTAP00000011457  .....GLDRNAFRNILHM............T.............F....GMT.......DDMI...............
ENSBTAP00000011047  .....KITYGQCGDVLRA............L.............G....QNP.......TQAE...............
ENSBTAP00000002564  .....-------------............-.............-....---.......----...............
ENSBTAP00000037104  .....FIDKEDLRDTFAApg..........C.............R....INV.......KNEE...............
ENSBTAP00000002672  .....IICKSDLRETYSQ............L.............G....KVN.......VPEE...............
ENSBTAP00000028269  .....IIDKEDLRDTFAA............M.............G....RLN.......VKNE...............
ENSBTAP00000016647  .....YLSRMDLQQI---............-.............-....GAL.......AVNP...............
ENSBTAP00000004536  .....RVDIRELRQGLAR............L.............G....GGD.......PDRG...............
ENSBTAP00000042177  .....-------------............-.............-....---.......----...............
ENSBTAP00000028063  .....-------------............-.............-....---.......----...............
ENSBTAP00000050283  .....KIAYGQCGDVLRA............L.............G....QNP.......TNAE...............
ENSBTAP00000048539  .....KIGIEEFANY---............-.............-....LKL.......PISK...............
ENSBTAP00000045669  .....-------------............-.............-....---.......----...............
ENSBTAP00000007972  .....SLDVRELQRGLAE............L.............G....LVL.......DTAE...............
ENSBTAP00000040815  .....DINKREMKPFKRY............V.............K....KKA.......KPKK...............
ENSBTAP00000025661  .....RIGIEEFAEY---............-.............-....LKL.......PVSD...............
ENSBTAP00000028350  .....RVSLEQILSL---............-.............-....PEL.......KANP...............
ENSBTAP00000053274  .....-------------............-.............-....---.......----...............
ENSBTAP00000021537  .....KVPYELIGSM---............-.............-....PEL.......KDNP...............
ENSBTAP00000055481  .....-------------............-.............-....---.......----...............
ENSBTAP00000039155  .....TIPMQELGTVLWP............L.............G....PNP.......TKAE...............
ENSBTAP00000029333  .....-------------............-.............-....---.......----...............
ENSBTAP00000016315  .....FISGSVAKNFFTK............S.............K....LSI.......PE--...............
ENSBTAP00000021091  .....-INAIQLQNILNHmpwsglg.....S.............K....QPL.......FSLE...............
ENSBTAP00000021618  .....-----E---FAES............L.............G....LKP.......QDMF...............
ENSBTAP00000055520  .....TLSVQQLFQA---............-.............-....---.......----...............
ENSBTAP00000055624  .....TLSVQQLFQA---............-.............-....---.......----...............
ENSBTAP00000016319  .....FIPGSAAKEFFTK............S.............K....LPI.......LE--...............
ENSBTAP00000034078  .....TVDVREVGTIIRS............L.............G....CCP.......SEGE...............
ENSBTAP00000006645  .....TLTVDQVSSL---............-.............-....PAL.......RVNP...............
ENSBTAP00000021909  .....IATKEEFTAFLHP............E.............E....YDY.......MKDI...............
ENSBTAP00000001426  .....YIEGKELENFFQE............Lekarkgsgmv...S....KSD.......NLGE...............
ENSBTAP00000015802  .....-------------............-.............-....---.......--RQ...............
ENSBTAP00000032680  .....-------------............-.............-....---.......--RQ...............
ENSBTAP00000055007  .....DISVKELGTVMRM............L.............G....QTP.......TKEE...............
ENSBTAP00000020148  .....KLSKAEFLIFMNTelga........F.............T....KNQ.......KDPG...............
ENSBTAP00000052345  .....-------------............-.............-....---.......----...............
ENSBTAP00000029334  .....-------------............-.............-....---.......----...............
ENSBTAP00000052345  .....FLSGDKVKPVLLN............S.............K....LPV.......DI--...............
ENSBTAP00000056127  .....TATREEFTAFLHP............E.............E....FEH.......MKEI...............
ENSBTAP00000012557  .....KLSMGQWAFSMENv...........L.............G....LNL.......PWRS...............
ENSBTAP00000011888  .....EINLQDFKKA---............-.............-....LKV.......KESF...............
ENSBTAP00000017060  .....LLSGDKVKPVLMN............S.............K....LPL.......DV--...............
ENSBTAP00000031854  .....YISQADLSRY---............-.............N....DQA.......SSNR...............
ENSBTAP00000031823  .....MATREELTAFLHP............E.............E....FPH.......MRDI...............
ENSBTAP00000021603  .....-----E---FAES............L.............G....LKP.......QDMF...............
ENSBTAP00000010838  .....TIEKEDLLRLMKD............N.............F....PNFlgacek.RGRD...............
ENSBTAP00000014575  .....-------------............-.............-....--L.......RENP...............
ENSBTAP00000011215  .....YISQADLSRY---............-.............N....DQA.......SSNR...............
ENSBTAP00000053698  .....FISKQELGMAMRS............L.............G....YMP.......SEVE...............
ENSBTAP00000006806  .....KLSKKELKELLQTelsgf.......L.............D....AQK.......DADA...............
ENSBTAP00000029334  .....YITGDQARTFFLQ............S.............G....LPA.......PV--...............
ENSBTAP00000044105  .....TIEKEDLLRLMKE............N.............F....PNF.......LSACekrgrq.........
ENSBTAP00000026904  .....KLNKGELKMLLQReltef.......L.............S....CQK.......DPEL...............
ENSBTAP00000017060  .....-------------............-.............-....---.......----...............
ENSBTAP00000055520  .....-------------............-.............Q....---.......----...............
ENSBTAP00000044226  .....KLSKKELKELLQTelsgf.......L.............D....AQK.......DADA...............
ENSBTAP00000055624  .....-------------............-.............Q....---.......----...............
ENSBTAP00000042182  .....-------------............-.............-....---.......----...............
ENSBTAP00000010796  .....EIPGPEFLALVEK............F.............N....LDI.......SRDE...............
ENSBTAP00000021174  .....YLEGKELQNLIQE............Lqqarkka......G....LEL.......SPE-...............
ENSBTAP00000006275  .....KLKKSELKELINNelsh........F.............L....EEI.......KEQE...............
ENSBTAP00000020950  .....GLNLEEFIAFEHP............E.............E....VDY.......MTEF...............
ENSBTAP00000053738  .....EIPGPEFLALVEK............F.............N....LDI.......SRDE...............
ENSBTAP00000004963  .....GLDRNTFRVILHS............I.............F....GMT.......DDVL...............
ENSBTAP00000023774  .....FISKQELGTAMRS............L.............G....YMP.......NEVE...............
ENSBTAP00000020395  .....RLNHQEFKSCLRS............L.............G....YDLpmveegePDPE...............
ENSBTAP00000020150  .....YLTKEDLRVLMEK............E.............F....PGF.......LENQkdpl...........
ENSBTAP00000025561  .....KLNKSELKELLTRelpsf.......L.............G....KRT.......DETA...............
ENSBTAP00000053738  .....ILTMHDLHRLLQH............L.............L....FNL.......KDEE...............
ENSBTAP00000034009  .....TLNKRELKQLITKelpk........T.............L....QNT.......KDQP...............
ENSBTAP00000020539  .....-------------............-.............-....---.......----...............
ENSBTAP00000020778  .....LLTESEFLSFLHP............E.............H....SRG.......MLQF...............
ENSBTAP00000017461  .....YLSREDFKVAVVMl...........F.............G....YKP.......SKIE...............
ENSBTAP00000044096  .....TLIQKEFKQLVQKelpnf.......L.............K....KQK.......KNEA...............
ENSBTAP00000008523  .....TLIQKEFKQLVQKelpnf.......L.............K....KQK.......KNEA...............
ENSBTAP00000035196  .....TLNDAELNFFQRI............C.............F....NTP.......LAPQ...............
ENSBTAP00000041997  .....KITGANAKKEMVR............S.............K....LPN.......SV--...............
ENSBTAP00000025499  .....-------------............-.............-....---.......----...............
ENSBTAP00000055481  .....FITGNWIEKLFFQ............S.............G....LPQ.......PV--...............
ENSBTAP00000002174  .....KITGANAKKEMVK............S.............K....LPN.......TV--...............
ENSBTAP00000000589  .....KLSKGEMKELLHKelpsf.......V.............G....EKV.......DEEG...............
ENSBTAP00000028239  .....KLSGTKAKTWMVG............T.............K....LPN.......SV--...............
ENSBTAP00000014894  .....ALGPEEFKACLIS............L.............G....YDVendrq..GDAE...............
ENSBTAP00000026544  .....FISAAELCNFLRD............L.............F....LHH.......KKAIseaklee........
ENSBTAP00000029333  .....FITGNWIEKLFFQ............S.............G....LPQ.......PV--...............
ENSBTAP00000041966  .....-IDATQLQSLLNReflrgp......P.............G....DPF.......SLDE...............
ENSBTAP00000008933  .....KISGINAKKEMVT............S.............K....LPN.......SV--...............
ENSBTAP00000056088  .....TLNKRELKQLITKelpkt.......L.............Q....QNT.......KDQP...............
ENSBTAP00000033794  .....TLSLEELKALLMDnvprfm......E.............T....LGR.......KEPY...............
ENSBTAP00000012786  .....LMDHEDFRACLIS............M.............G....YDL.......GEAE...............
ENSBTAP00000030018  .....MMEPDDFRACLIS............M.............G....YDL.......GEVE...............
ENSBTAP00000040233  .....TVTKSELRRVITT............F.............L....LPL.......TREQ...............
ENSBTAP00000003365  .....IISKDQLYLALQH............A.............G....RNP.......SQKT...............
ENSBTAP00000053176  .....-------------............-.............-....---.......----...............
ENSBTAP00000024301  .....TLGPEEFKACLIS............L.............G....YDIgndpq..GEAE...............
ENSBTAP00000022292  .....YMTPEDFVQRYLG............L.............Y....NDPn......SNPK...............
ENSBTAP00000015611  .....TLSKDELKELLEKefrp........I.............L....KNP.......DDPD...............
ENSBTAP00000012770  .....MLSKEELSRY---............-.............G....TAT.......MTNV...............
ENSBTAP00000000847  .....TLSRKELKELIKKelc.........L.............G....EKM.......RESS...............
ENSBTAP00000053738  .....TVTKSELRRVITT............F.............L....LPL.......TREQ...............
ENSBTAP00000054975  .....-------------............-.............-....---.......----...............
ENSBTAP00000046639  .....LLDKADFKQALKL............F.............R....LEV.......SEND...............
ENSBTAP00000052345  .....RVLASDAAVFLKK............S.............G....LPD.......LV--...............
ENSBTAP00000053164  .....-------------............-.............-....---.......----...............
ENSBTAP00000016774  .....AVYRDDLKQLLET............E.............C....PKF.......MKKK...............
ENSBTAP00000022630  .....QLSKEELKLLLQT............E.............F....PSL.......LKGPs..............
ENSBTAP00000010796  .....FVKASDFGQVLKD............F.............C....YKL.......TDNQ...............
ENSBTAP00000021909  .....FLGAEEAKTF-DQ............L.............T....PEE.......SKER...............
ENSBTAP00000033974  .....QVKTDELEWLVSL............L.............G....INS.......TKSE...............
ENSBTAP00000006711  .....-------------............-.............-....---.......----...............
ENSBTAP00000010796  .....ILRRRDMKNALYG............F.............D....IPL.......TPRE...............
ENSBTAP00000004912  .....FMSPNDFVTRYLNi...........F.............G....ESQ.......PNPK...............
ENSBTAP00000005979  .....ALSDQELNAFQTS............C.............F....GHP.......LAPQ...............
ENSBTAP00000053738  .....FVKASDFGQVLKD............F.............C....YKL.......TDNQ...............
ENSBTAP00000053746  .....-------------............-.............-....---.......----...............
ENSBTAP00000023221  .....-------------............-.............-....---.......----...............
ENSBTAP00000019429  .....FIDLMELKLMMEK............L.............G....APQ.......THLG...............
ENSBTAP00000052019  .....SLCKEELKQLLLAefgd........I.............L....RRP.......NDPE...............
ENSBTAP00000042244  .....FIDLMELKLMMEK............L.............G....APQ.......THLG...............
ENSBTAP00000053738  .....QITGQELQRILNC............M.............V....VKI.......SDSE...............
ENSBTAP00000018877  .....KISKSSFRKMLQKelnhm.......L.............T....DTG.......NRK-...............
ENSBTAP00000053019  .....YVSDYELQDLFKE............A.............S....LPLpgy....KVRE...............
ENSBTAP00000003073  .....-------------............-.............-....---.......----...............
ENSBTAP00000012886  .....FITIVDVQRVLES............I.............G....VQM.......DENT...............
ENSBTAP00000044222  .....-------------............-.............-....---.......-ECD...............
ENSBTAP00000028499  .....SLSVNEFKELVTQq...........L.............P....HLL.......KDVG...............
ENSBTAP00000047378  .....FLDREELTQLCLK............L.............H....LEK.......QLPV...............
ENSBTAP00000009308  .....-------------............-.............-....---.......----...............
ENSBTAP00000017060  .....RVGASEAALFLKK............S.............G....LSD.......II--...............
ENSBTAP00000050406  .....FICDYELHELFKE............A.............N....MPL.......PGYK...............
ENSBTAP00000031879  .....FICDYELHELFKE............A.............N....MPL.......PGYK...............
ENSBTAP00000031854  .....KADVYEMGKIAKA............C.............G....CPL.......YW--...............
ENSBTAP00000001250  .....RVTLPEFAAQ---............L.............G....VPE.......SE--...............
ENSBTAP00000026035  .....VLERGELKRLLEK............E.............FadviVKP.......HDPA...............
ENSBTAP00000011215  .....KADVYEMGKIAKA............C.............G....CPL.......YW--...............
ENSBTAP00000002128  .....YIDAEELQSILPS............I.............G....ITL.......SDKE...............
ENSBTAP00000053194  .....RLSHKDFRSCLRG............L.............N....YYL.......PMVEegepep.........
ENSBTAP00000056127  .....-------------............-.............-....---.......----...............
ENSBTAP00000033188  .....--------KYMRW............M.............N....HKK.......SR--...............
ENSBTAP00000053548  .....--------KYMRW............M.............N....HKK.......SR--...............
ENSBTAP00000011687  .....TLNDVLFYHFLHH............V.............-....TDL.......TRNQ...............
ENSBTAP00000007636  .....-------------............-.............-....---.......----...............
ENSBTAP00000020950  .....-------------............-.............-....---.......---R...............
ENSBTAP00000009115  .....CIDLHGMMCTLAK............L.............G....MNL.......TKHD...............
ENSBTAP00000023873  .....LVDEDTFKLIYSQ............F.............F....PQG.......DATT...............
ENSBTAP00000054471  .....-------------............-.............-....---.......----...............
ENSBTAP00000039694  .....TISEEDFAHILLR............Y.............T....NVE.......NTSV...............
ENSBTAP00000025205  .....-------------............-.............-....---.......----...............
ENSBTAP00000047882  .....-------------............-.............-....---.......----...............
ENSBTAP00000001368  .....-------------............-.............-....---.......--EK...............
ENSBTAP00000029786  yleqyRIDLEQFKGMFAL............L.............F....PWAcgt....HSDV...............
ENSBTAP00000028993  .....RLEREEFRALCAE............L.............R....VRP.......AD--...............
ENSBTAP00000023678  .....-------------............-.............-....---.......----...............
ENSBTAP00000034710  .....-------------............-.............-....---.......----...............
ENSBTAP00000031823  .....-------------............-.............-....--E.......SQAR...............
ENSBTAP00000038002  .....-------------............-.............-....---.......----...............
ENSBTAP00000021074  .....TLTCTELKQLIQSefed........I.............F....QPC.......AIHA...............
ENSBTAP00000026544  .....YIEEKELDAFFYH............M.............L....TKL.......GVDDavkeenvqk......
ENSBTAP00000007217  .....FIRTLSLKPLLFE............I.............P....GFL.......SDEE...............
ENSBTAP00000029792  .....RIDAHQFRELFAS............L.............T....PWAcga....HTPV...............
ENSBTAP00000044088  .....-------------............-.............-....---.......----...............
ENSBTAP00000017319  .....KLRKATAKNLLQT............Q.............F....KNFaegqe..TKAR...............
ENSBTAP00000044100  .....-------------............-.............-....---.......---K...............
ENSBTAP00000033594  .....-------------............-.............-....---.......----...............
ENSBTAP00000026766  .....RFDLETFGPL---............V.............S....PPI.......RPSL...............
ENSBTAP00000055894  .....EIDLMSLKRMMEK............L.............G....VPK.......THLE...............
ENSBTAP00000015220  .....-------------............-.............-....---.......----...............
ENSBTAP00000033613  .....-------------............-.............-....---.......----...............
ENSBTAP00000056320  .....LIDAQDLARH---............N.............D....HAI.......STKM...............
ENSBTAP00000025249  .....-------------............-.............-....---.......----...............
ENSBTAP00000029159  .....-------------............-.............-....---.......-VQR...............
ENSBTAP00000044088  .....KLHYKEFRRFMEN............L.............Q....AEV.......QEMEflqfskglsfmrked
ENSBTAP00000016319  .....KVSANGRVLELFR............A.............A....QLP.......ND--...............
ENSBTAP00000017662  .....-------------............-.............-....---.......----...............
ENSBTAP00000012479  .....FLLQSQLSHLFLR............L.............E....VPL.......QLPT...............
ENSBTAP00000029886  .....-------------............-.............-....---.......----...............
ENSBTAP00000027388  .....-------------............-.............-....---.......----...............
ENSBTAP00000039694  .....-LSKQELNQMLSE............T.............P....PVW.......KG--...............
ENSBTAP00000023673  .....-------------............-.............-....---.......----...............
ENSBTAP00000041488  .....-------------............-.............-....---.......----...............
ENSBTAP00000001452  .....-------------............-.............-....---.......----...............
ENSBTAP00000028498  .....TLTPSELRDLVTQq...........L.............P....HLM.......PSNC...............
ENSBTAP00000001426  .....-------------............-.............-....---.......----...............
ENSBTAP00000020240  .....-------------............-.............-....---.......----...............
ENSBTAP00000053650  .....-------------............-.............-....---.......----...............
ENSBTAP00000041651  .....-------------............-.............-....---.......----...............
ENSBTAP00000005154  .....-------------............-.............-....---.......----...............
ENSBTAP00000021174  .....-------------............-.............-....---.......----...............
ENSBTAP00000022068  .....-------------............-.............-....---.......----...............
ENSBTAP00000026682  .....-------------............-.............-....---.......----...............
ENSBTAP00000007636  .....RITERQFGGMLLAy...........S.............G....VQS.......KKLT...............
ENSBTAP00000027954  .....-------------............-.............-....---.......----...............
ENSBTAP00000020778  .....-------------............-.............-....---.......----...............
ENSBTAP00000013601  .....-------------............-.............-....---.......----...............
ENSBTAP00000005477  .....HICLSELPFVMRA............I.............G....FYP.......SEGE...............
ENSBTAP00000055305  .....-------------............-.............-....---.......----...............
ENSBTAP00000036054  .....-------------............-.............-....---.......----...............
ENSBTAP00000004912  .....KVTAIDFRDIMVT............I.............R....PHV.......LTPF...............
ENSBTAP00000022292  .....-------------............-.............-....---.......----...............
ENSBTAP00000002717  .....-ISLRELKTILPL............V.............N....FKV.......SSAK...............
ENSBTAP00000036015  .....KVSKSQLKVLSHN............L.............Y....TVL.......HIPHdpv............
ENSBTAP00000051638  .....-------------............-.............-....---.......----...............
ENSBTAP00000026766  .....-------------............-.............-....---.......----...............
ENSBTAP00000053738  .....-------------............-.............-....---.......----...............
ENSBTAP00000016306  .....-------------............-.............-....---.......----...............
ENSBTAP00000013714  .....-------------............-.............-....---.......----...............
ENSBTAP00000036550  .....RIDAQQFARLFQLvsp.........W.............T....CGA.......HTEI...............
ENSBTAP00000053738  .....KIHTHDFKKVLED............Y.............G....MPM.......DDDQ...............
ENSBTAP00000023383  .....RISAKDLKNMLSQ............V.............N....YRV.......PNMR...............
ENSBTAP00000027030  .....HLNRKKLVSICEQ............Y.............G....LQN.......VDGE...............
ENSBTAP00000053270  .....HLNRKKLVSICEQ............Y.............G....LQN.......VDGE...............
ENSBTAP00000054640  .....HLNRKKLVSICEQ............Y.............G....LQN.......VDGE...............
ENSBTAP00000012770  .....MINYENFLKVGEK............A.............G....PKC.......KQFF...............
ENSBTAP00000009967  .....IIGNKAFADLLLD............LvtlnlgtnnfpssW....MNL.......TQPE...............
ENSBTAP00000015183  .....QLTPGDFVQIQRA............F.............E....PSE.......PSQT...............
ENSBTAP00000014222  .....-------------............-.............-....---.......----...............
ENSBTAP00000026288  .....TVTKEDFVLTLEE............R.............Q....DFV.......NSEQ...............
ENSBTAP00000002128  .....-------------............-.............-....---.......----...............
ENSBTAP00000003365  .....-------------............-.............-....---.......----...............
ENSBTAP00000053738  .....-------------............-.............-....---.......----...............
ENSBTAP00000009228  .....-------------............-.............-....---.......----...............
ENSBTAP00000026785  .....-------------............-.............-....---.......----...............
ENSBTAP00000002578  .....KVSKSQLKVLSHN............L.............C....TVL.......KVPHdpvaleehfrdddeg
ENSBTAP00000000106  .....KLTYQQIEDTLES............V.............G....PEP.......ER--...............
ENSBTAP00000028840  .....QISREEFIVALKA............I.............G....VPL.......KNQE...............
ENSBTAP00000053594  .....-------------............-.............-....---.......----...............
ENSBTAP00000055414  .....-------------............-.............-....---.......----...............
ENSBTAP00000026698  .....RISQEEFAKQ---............-.............-....LQL.......SDSQ...............
ENSBTAP00000017015  .....SLTLEDFLRYRHQtakrgnsdr...A.............L....SEE.......QEE-...............
ENSBTAP00000049908  .....-------------............-.............-....---.......----...............
ENSBTAP00000021395  .....RVKVEKLEMALNY............L.............G....IQP.......TKEQ...............
ENSBTAP00000007194  .....-------------............-.............-....---.......----...............
ENSBTAP00000025455  .....-------------............-.............-....---.......----...............


                              60               70                                                   
                               |                |                                                   
d1bjfa_               .........FAEHVFRTF.......DA..N.....................................G...D.....G
ENSBTAP00000019411  .........-LQDMINEV.......DA..D.....................................G...N.....G
ENSBTAP00000036057  .........-LQDMINEV.......DA..D.....................................G...N.....G
ENSBTAP00000038404  .........FAEHVFRTF.......DA..N.....................................G...D.....G
ENSBTAP00000010971  .........FAEHVFRTF.......DT..N.....................................S...D.....G
ENSBTAP00000019803  .........TCRSMVAVM.......DS..D.....................................T...T.....G
ENSBTAP00000014038  .........LVQRVIDIF.......DT..D.....................................G...N.....G
ENSBTAP00000002055  .........-LQDMINEV.......DA..D.....................................G...N.....G
ENSBTAP00000049731  .........-LQDMINEV.......DA..D.....................................G...N.....G
ENSBTAP00000005577  .........FAEHVFRTF.......DT..N.....................................G...D.....G
ENSBTAP00000034949  .........YAQHVFRSF.......DA..N.....................................S...D.....G
ENSBTAP00000017447  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000010858  .........CLNWLLNVY.......DT..G.....................................R...T.....G
ENSBTAP00000046644  .........---------.......PS..S.....................................R...N.....D
ENSBTAP00000022814  .........FAQHAFRTF.......DK..N.....................................G...D.....G
ENSBTAP00000019758  .........-TTRFFETC.......DL..D.....................................N...D.....K
ENSBTAP00000019321  .........FAQHAFRTF.......DK..N.....................................G...D.....G
ENSBTAP00000011677  .........SCRSMIALM.......DT..D.....................................G...S.....G
ENSBTAP00000011680  .........SCRSMIALM.......DT..D.....................................G...S.....G
ENSBTAP00000021742  .........YATFLFNAF.......DT..N.....................................H...D.....G
ENSBTAP00000005348  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000016609  .........-VETALESCgl.....NF..N.....................................R...S.....E
ENSBTAP00000012740  .........CLNWLLNVY.......DT..G.....................................R...T.....G
ENSBTAP00000018403  .........-LKKLISQL.......DT..D.....................................K...N.....G
ENSBTAP00000026407  .........-VDIVFSKV.......KA..K.....................................S...A.....R
ENSBTAP00000052557  .........-MKRMIADV.......DK..E.....................................G...T.....G
ENSBTAP00000054167  .........YAHFLFNAF.......DT..D.....................................H...N.....G
ENSBTAP00000010319  .........-IKKMISEI.......DK..E.....................................G...T.....G
ENSBTAP00000041545  .........-AFQLFQTA.......DT..S.....................................Q...S.....G
ENSBTAP00000055204  .........TVRSIISMF.......DR..E.....................................N...K.....A
ENSBTAP00000003718  .........YAHYLFHAF.......DT..T.....................................Q...T.....G
ENSBTAP00000011676  .........TCREMISLM.......DS..N.....................................G...T.....G
ENSBTAP00000049395  .........-ARKIFKEC.......DH..S.....................................Q...T.....D
ENSBTAP00000054983  .........-VDIVFSKI.......KG..K.....................................S...C.....R
ENSBTAP00000052219  .........TCRLMVSML.......DR..D.....................................M...S.....G
ENSBTAP00000025402  .........-VEAALSAChl.....PK..G.....................................K...N.....D
ENSBTAP00000011678  .........SCRSMVNLM.......DR..D.....................................G...N.....G
ENSBTAP00000000433  .........-VDIVFSKV.......KA..K.....................................N...A.....R
ENSBTAP00000021491  .........-IKKMIAET.......DK..E.....................................G...I.....G
ENSBTAP00000044733  .........TCKIMVDML.......DS..D.....................................G...S.....G
ENSBTAP00000010937  .........-VRQMFQEA.......DT..D.....................................E...Nq....G
ENSBTAP00000056439  .........-VRQMFQEA.......DT..D.....................................E...Nq....G
ENSBTAP00000055780  .........-LQEMIDEV.......DE..D.....................................G...S.....G
ENSBTAP00000038002  .........LSQALFQSFqtgyyieDT..V.....................................R...E.....D
ENSBTAP00000034705  .........-AYGLFKEC.......DR..S.....................................K...N.....E
ENSBTAP00000035936  .........-VEAMFRAF.......DT..N.....................................G...D.....N
ENSBTAP00000013699  .........TCLMMINMF.......DK..T.....................................K...S.....G
ENSBTAP00000002564  .........SLNWLLNVF.......DR..P.....................................Sgr.S.....G
ENSBTAP00000011496  .........FATFVFNVF.......DE..N.....................................K...D.....G
ENSBTAP00000019111  .........-VLKILKDY.......DR..E.....................................A...T.....G
ENSBTAP00000017036  .........YVEQMFETF.......DF..N.....................................K...D.....G
ENSBTAP00000003213  .........-VKQMFKEA.......DT..D.....................................D...Hq....G
ENSBTAP00000055444  .........-VKQMFKEA.......DT..D.....................................D...Hq....G
ENSBTAP00000024550  .........TCRIMIAML.......DR..D.....................................Y...S.....G
ENSBTAP00000015248  .........-LEGMMSEA.......P-..-.....................................-...-.....G
ENSBTAP00000021328  .........-LDAMMNEA.......P-..-.....................................-...-.....G
ENSBTAP00000037091  .........-LEAMMNEA.......P-..-.....................................-...-.....G
ENSBTAP00000029967  .........-LIEISQQI.......--..-.....................................S...G.....G
ENSBTAP00000021449  .........-LIELGQQI.......RM..N.....................................L...G.....G
ENSBTAP00000053176  .........FTTHLFMSF.......SN..KfphsspmvkskpallssglkmnkgaitpprtspantcS...P.....E
ENSBTAP00000042361  .........-LIELSQQI.......NM..N.....................................L...G.....G
ENSBTAP00000016509  .........-VEAMFRAF.......DT..N.....................................G...D.....N
ENSBTAP00000026714  .........-LIELSQQI.......NM..N.....................................L...G.....G
ENSBTAP00000004690  .........VCRCMVNLL.......DK..D.....................................G...S.....G
ENSBTAP00000010858  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000013117  .........-IELKFKEL.......HK..S.....................................R...Dktg..T
ENSBTAP00000017574  .........-VKYIFKDN.......DR..L.....................................K...Q.....G
ENSBTAP00000004885  .........-EEKIFTTG.......DV..N.....................................K...D.....G
ENSBTAP00000008961  .........-AMALKSTI.......DL..T.....................................C...N.....D
ENSBTAP00000028063  .........LLNFMIAAY.......DS..E.....................................G...R.....G
ENSBTAP00000012740  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000006283  .........-LIEVSQHV.......KM..R.....................................M...G.....G
ENSBTAP00000014306  .........-VLKVLGNPks.....DE..M.....................................N...V.....K
ENSBTAP00000053252  .........-IRLKFKEI.......QK..S.....................................K...Eklt..T
ENSBTAP00000014304  .........-VLKVLGNPks.....DE..M.....................................N...V.....K
ENSBTAP00000045669  .........LLNFLLAAF.......DP..E.....................................G...H.....G
ENSBTAP00000041264  .........-ALALRSTI.......DL..T.....................................C...S.....G
ENSBTAP00000006711  .........-STHLFLAF.......S-..-.....................................-...-.....-
ENSBTAP00000017358  .........-AMALKSTI.......DL..T.....................................C...N.....D
ENSBTAP00000053274  .........LLNFLLAAF.......DP..E.....................................G...H.....G
ENSBTAP00000055296  .........-AMALKSTI.......DL..T.....................................C...N.....D
ENSBTAP00000016852  .........-AEELFRRF.......DK..D.....................................G...N.....G
ENSBTAP00000036380  .........-AQRHLQTH.......RI..D.....................................R...N.....G
ENSBTAP00000041719  .........-VLRVLGYPks.....DE..L.....................................K...S.....R
ENSBTAP00000049636  .........-VKKVLGNP.......SN..E.....................................Emn.A.....K
ENSBTAP00000024444  .........EIDEMLKEA.......P-..-.....................................-...-.....G
ENSBTAP00000004556  .........--KDWFGAL.......HE..D.....................................A...N.....R
ENSBTAP00000038767  .........LGDRIINAF.......FP..E.....................................G...E.....D
ENSBTAP00000031285  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000011457  .........-MDRVFRGF.......DK..D.....................................N...D.....G
ENSBTAP00000011047  .........-VLRVLGKP.......KQ..E.....................................Eln.S.....K
ENSBTAP00000002564  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000037104  .........-LEAMVKEA.......P-..-.....................................-...-.....G
ENSBTAP00000002672  .........ELDAMLQE-.......--..-.....................................G...K.....G
ENSBTAP00000028269  .........ELDAMMKEA.......--..-.....................................-...S.....G
ENSBTAP00000016647  .........LGDRIIDSF.......FP..D.....................................G...S.....L
ENSBTAP00000004536  .........AQQGISPEG.......DT..D.....................................P...D.....G
ENSBTAP00000042177  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000028063  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000050283  .........-VLRVLGKPkp.....EE..M.....................................N...S.....K
ENSBTAP00000048539  .........PLQQLFALF.......DR..N.....................................N...D.....G
ENSBTAP00000045669  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000007972  .........-MEGVCRRW.......DR..D.....................................G...S.....G
ENSBTAP00000040815  .........CARRFTDYC.......DL..N.....................................K...D.....K
ENSBTAP00000025661  .........VLRQLFALF.......DR..N.....................................H...D.....G
ENSBTAP00000028350  .........FKERICKVF.......ST..S.....................................P...Sr....D
ENSBTAP00000053274  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000021537  .........FRQRIAQVF.......SE..D.....................................G...D.....G
ENSBTAP00000055481  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000039155  .........-LQKVVGEL.......DC..D.....................................G...R.....G
ENSBTAP00000029333  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000016315  .........-LSYIWELS.......DA..D.....................................C...D.....G
ENSBTAP00000021091  .........ACQGILALL.......DL..N.....................................A...S.....G
ENSBTAP00000021618  .........-VQSMFSLA.......DK..D.....................................G...N.....G
ENSBTAP00000055520  .........-LQEMFQKV.......RV..E.....................................K...P.....G
ENSBTAP00000055624  .........-LQEMFQKV.......RV..E.....................................K...P.....G
ENSBTAP00000016319  .........-LSHIWELS.......DF..D.....................................K...D.....G
ENSBTAP00000034078  .........-LHDLIAEVe......EE..E.....................................P...T.....G
ENSBTAP00000006645  .........FRDRICRVF.......S-..-.....................................H...N.....N
ENSBTAP00000021909  .........VVQETMEDI.......DK..N.....................................A...D.....G
ENSBTAP00000001426  .........KMKEFMQKY.......DK..N.....................................S...D.....G
ENSBTAP00000015802  .........WKQKIVQAG.......DK..D.....................................L...D.....G
ENSBTAP00000032680  .........WKQKIVQAG.......DK..D.....................................L...D.....G
ENSBTAP00000055007  .........-LDAIIEEV.......DE..D.....................................G...S.....G
ENSBTAP00000020148  .........VLDRMMKKL.......DL..N.....................................S...D.....G
ENSBTAP00000052345  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000029334  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000052345  .........-LGRVWELS.......DI..D.....................................H...D.....G
ENSBTAP00000056127  .........VVLETLEDI.......DK..N.....................................G...D.....G
ENSBTAP00000012557  .........-LSSHLVT-.......-T..D.....................................K...D.....G
ENSBTAP00000011888  .........FAERFFVLF.......DS..D.....................................G...S.....G
ENSBTAP00000017060  .........-LGRVWDLS.......DI..D.....................................K...D.....G
ENSBTAP00000031854  .........IIERIFSGA.......VT..R.....................................G...KtvqkeG
ENSBTAP00000031823  .........VIAETLEDL.......DR..N.....................................K...D.....G
ENSBTAP00000021603  .........-VESMFSLA.......DK..D.....................................G...N.....G
ENSBTAP00000010838  .........YLSNIFEKQ.......DK..N.....................................K...D.....R
ENSBTAP00000014575  .........FKERIVEAF.......SE..D.....................................G...E.....G
ENSBTAP00000011215  .........IIERIFSGA.......VT..R.....................................G...KtvqkeG
ENSBTAP00000053698  .........-LAIIMQRL.......DM..D.....................................G...D.....G
ENSBTAP00000006806  .........-VDKVMKEL.......DE..N.....................................G...D.....G
ENSBTAP00000029334  .........-LAEIWALS.......DL..N.....................................K...D.....G
ENSBTAP00000044105  .........YLSDIFEKK.......DK..N.....................................K...D.....K
ENSBTAP00000026904  .........-VDKIMQDL.......DA..N.....................................K...D.....N
ENSBTAP00000017060  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000055520  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000044226  .........-VDKVMKEL.......DE..N.....................................G...D.....G
ENSBTAP00000055624  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000042182  .........TCEQLLQCF.......G-..-.....................................H...G.....G
ENSBTAP00000010796  .........-CQQLLIKY.......DL..K.....................................N...N.....G
ENSBTAP00000021174  .........-MKTFVDQY.......GQ..R.....................................D...D.....G
ENSBTAP00000006275  .........VVDKVMETL.......DS..D.....................................G...D.....G
ENSBTAP00000020950  .........VIQEALEEH.......DK..D.....................................G...D.....G
ENSBTAP00000053738  .........-CQQLLIKY.......DL..K.....................................N...N.....G
ENSBTAP00000004963  .........-MNRVFFAF.......DK..D.....................................N...D.....N
ENSBTAP00000023774  .........-LEVIIQRL.......DM..D.....................................G...D.....G
ENSBTAP00000020395  .........-FEAILDTV.......DP..N.....................................R...D.....G
ENSBTAP00000020150  .........AVDKIMKDL.......DQ..C.....................................R...D.....G
ENSBTAP00000025561  .........-FQKLMSNL.......DC..N.....................................K...D.....N
ENSBTAP00000053738  .........-FERLLGLL.......GL..R.....................................L...S.....I
ENSBTAP00000034009  .........TIDKIFQDL.......DA..D.....................................K...D.....G
ENSBTAP00000020539  .........-----FKKH.......DK..D.....................................E...T.....G
ENSBTAP00000020778  .........MVKEIIRDL.......DQ..D.....................................G...D.....K
ENSBTAP00000017461  .........-ADSVMSSV.......DP..N.....................................T...S.....-
ENSBTAP00000044096  .........AINEIMEDL.......DT..N.....................................V...D.....K
ENSBTAP00000008523  .........AINEIMEDL.......DT..N.....................................V...D.....K
ENSBTAP00000035196  .........ALEDVKNVVrkhis..DG..V.....................................A...D.....G
ENSBTAP00000041997  .........-LGKIWKLA.......DI..D.....................................K...D.....G
ENSBTAP00000025499  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000055481  .........-LAQIWALA.......DM..N.....................................N...D.....G
ENSBTAP00000002174  .........-LGKIWKLA.......DV..D.....................................R...D.....G
ENSBTAP00000000589  .........-LKKLMGDL.......DE..N.....................................S...D.....Q
ENSBTAP00000028239  .........-LGRIWKLS.......DV..D.....................................R...D.....G
ENSBTAP00000014894  .........-FNRIMSVV.......DP..N.....................................H...S.....G
ENSBTAP00000026544  .........YTGTMMKIF.......DK..N.....................................K...D.....G
ENSBTAP00000029333  .........-LAQIWALA.......DM..N.....................................N...D.....G
ENSBTAP00000041966  .........-CRSLVALM.......DL..K.....................................V...N.....G
ENSBTAP00000008933  .........-LGKIWKLA.......DC..D.....................................G...D.....G
ENSBTAP00000056088  .........TIDKIFQDL.......DA..D.....................................K...D.....G
ENSBTAP00000033794  .........YITQLFRAA.......DK..N.....................................Q...D.....N
ENSBTAP00000012786  .........-FARIMTLV.......DP..N.....................................G...Q.....G
ENSBTAP00000030018  .........-FARIMTMV.......DP..N.....................................A...A.....G
ENSBTAP00000040233  .........-FQDVLAQI.......PL..T.....................................S...S.....G
ENSBTAP00000003365  .........-----INKY.......WT..S.....................................Q...T.....A
ENSBTAP00000053176  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000024301  .........-FARIMSIV.......DP..N.....................................R...L.....G
ENSBTAP00000022292  .........IVQLLAGVA.......DQ..T.....................................K...D.....G
ENSBTAP00000015611  .........TVDVIMHIL.......DR..D.....................................H...D.....R
ENSBTAP00000012770  .........FLDRVFQEC.......-L..T.....................................Y...D.....G
ENSBTAP00000000847  .........-IDDLMKSL.......DK..N.....................................S...D.....Q
ENSBTAP00000053738  .........-FQDVLAQI.......PL..T.....................................S...S.....G
ENSBTAP00000054975  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000046639  .........-FESFWLIL.......NS..S.....................................G...N.....G
ENSBTAP00000052345  .........-LGKIWDLA.......DT..D.....................................G...K.....G
ENSBTAP00000053164  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000016774  .........DADTWFKEL.......DI..N.....................................Q...D.....G
ENSBTAP00000022630  .........TLDELFEEL.......DK..N.....................................G...D.....G
ENSBTAP00000010796  .........-YHYFLRKL.......RL..H.....................................L...T.....P
ENSBTAP00000021909  .........-LGMIVDKI.......DA..D.....................................K...D.....G
ENSBTAP00000033974  .........-LASTAKDV.......DR..V.....................................K...K.....G
ENSBTAP00000006711  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000010796  .........-FEKLWMRY.......DS..E.....................................G...R.....G
ENSBTAP00000004912  .........TVELLSGVV.......DQ..T.....................................K...D.....G
ENSBTAP00000005979  .........ALEDVKMVV.......SK..Nvvggv................................R...D.....D
ENSBTAP00000053738  .........-YHYFLRKL.......RL..H.....................................L...T.....P
ENSBTAP00000053746  .........---------.......--..-.....................................-...-.....D
ENSBTAP00000023221  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000019429  .........-LKSMIKEV.......DE..D.....................................F...D.....G
ENSBTAP00000052019  .........TVETILSLL.......DR..N.....................................R...N.....E
ENSBTAP00000042244  .........-LKNMIKEV.......DE..D.....................................F...D.....S
ENSBTAP00000053738  .........-FRELMRIL.......DP..G.....................................C...T.....G
ENSBTAP00000018877  .........AADKLIQNL.......DA..N.....................................H...D.....G
ENSBTAP00000053019  .........IVEKILAVA.......DN..N.....................................K...D.....S
ENSBTAP00000003073  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000012886  .........-LHEILNEV.......DL..N.....................................K...N.....G
ENSBTAP00000044222  .........-YKQFISVL.......DT..N.....................................K...D.....C
ENSBTAP00000028499  .........SLDEKMKSL.......DV..N.....................................Q...D.....S
ENSBTAP00000047378  .........L---LHTLL.......GN..N.....................................Q...F.....A
ENSBTAP00000009308  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000017060  .........-LGKIWDLA.......DP..E.....................................G...K.....G
ENSBTAP00000050406  .........-VREIIQKLmldg...DR..N.....................................K...D.....G
ENSBTAP00000031879  .........-VREIIQKLmldg...DR..N.....................................K...D.....G
ENSBTAP00000031854  .........-KAPMFRAA.......GG..E.....................................R...T.....G
ENSBTAP00000001250  .........SLEDLFSLF.......DE..G.....................................G...G.....G
ENSBTAP00000026035  .........TVDEVLRLL.......DE..D.....................................D...T.....G
ENSBTAP00000011215  .........-KAPMFRAA.......GG..E.....................................R...T.....G
ENSBTAP00000002128  .........-FKKIVTDT.......AR..N.....................................E...N.....G
ENSBTAP00000053194  .........KFEKFLDAV.......DP..E.....................................R...K.....G
ENSBTAP00000056127  .........----IVDRI.......DS..D.....................................G...D.....G
ENSBTAP00000033188  .........-VMDFFRRI.......DK..D.....................................Q...D.....G
ENSBTAP00000053548  .........-VMDFFRRI.......DK..D.....................................Q...D.....G
ENSBTAP00000011687  .........-ITVVFNML.......DW..N.....................................A...V.....G
ENSBTAP00000007636  .........---------.......--..-.....................................-...-.....G
ENSBTAP00000020950  .........-LKSIIKKI.......DL..D.....................................S...D.....G
ENSBTAP00000009115  .........-VHNELRCA.......DI..D.....................................Q...D.....G
ENSBTAP00000023873  .........YAHFLFNAF.......DA..D.....................................G...N.....G
ENSBTAP00000054471  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000039694  .........FLENVRYSI.......P-..-.....................................E...E.....K
ENSBTAP00000025205  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000047882  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000001368  .........MVESVFRNF.......DV..D.....................................G...D.....G
ENSBTAP00000029786  .........LASRLFQLL.......DE..N.....................................G...D.....S
ENSBTAP00000028993  .........-AEAVFQRL.......DA..D.....................................R...D.....G
ENSBTAP00000023678  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000034710  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000031823  .........-LGRIVDRM.......DRagD.....................................G...D.....G
ENSBTAP00000038002  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000021074  .........-VERNLNLL.......NI..D.....................................S...N.....G
ENSBTAP00000026544  .........MKQQFMAPH.......NV..S.....................................K...D.....G
ENSBTAP00000007217  .........-CRLVIHLA.......QM..K.....................................GlqrS.....Q
ENSBTAP00000029792  .........LAGRMFRLL.......DE..N.....................................K...D.....S
ENSBTAP00000044088  .........---------.......--..G.....................................D...K.....G
ENSBTAP00000017319  .........-YKDLLSEL.......DE..H.....................................T...E.....N
ENSBTAP00000044100  .........LVESVFRNY.......DH..D.....................................H...D.....G
ENSBTAP00000033594  .........---------.......--..E.....................................G...K.....G
ENSBTAP00000026766  .........-SEGLFNAF.......DE..N.....................................R...D.....N
ENSBTAP00000055894  .........-MKKMISEV.......TG..G.....................................V...S.....D
ENSBTAP00000015220  .........----LFEHM.......DL..N.....................................K...D.....G
ENSBTAP00000033613  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000056320  .........-IDRIFSGA.......VT..R.....................................G...KkvqkeG
ENSBTAP00000025249  .........---------.......--..-.....................................-...D.....S
ENSBTAP00000029159  .........MVDSVFKNY.......DH..D.....................................Q...D.....G
ENSBTAP00000044088  .........FAEWLLFFT.......DT..Enkdvywknvrekls.......................A...G.....E
ENSBTAP00000016319  .........VVLQIMELC.......GA..T.....................................R...L.....G
ENSBTAP00000017662  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000012479  .........-VKILCQRF.......SR..G.....................................S...Sp....E
ENSBTAP00000029886  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000027388  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000039694  .........-SSKLFRNL.......K-..-.....................................E...K.....G
ENSBTAP00000023673  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000041488  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000001452  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000028498  .........GLEEKIANL.......GN..C.....................................N...D.....S
ENSBTAP00000001426  .........------RMF.......DL..N.....................................G...D.....G
ENSBTAP00000020240  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000053650  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000041651  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000005154  .........-FQDVFRRA.......DK..N.....................................D...D.....G
ENSBTAP00000021174  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000022068  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000026682  .........-VDDISESL.......-R..Q.....................................G...G.....G
ENSBTAP00000007636  .........AMQKQLKKH.......-F..K.....................................E...G.....K
ENSBTAP00000027954  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000020778  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000013601  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000005477  .........-IEDMFNEIrfseyv.DT..G.....................................Kl..T.....D
ENSBTAP00000055305  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000036054  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000004912  .........VEECLVAAA.......GG..T.....................................T...S.....H
ENSBTAP00000022292  .........------LHF.......GH..N.....................................R...K.....K
ENSBTAP00000002717  .........FLKDKFLEI.......GA..H.....................................K...D.....-
ENSBTAP00000036015  .........ALEEHFRD-.......--..D.....................................D...D.....G
ENSBTAP00000051638  .........-----FRLL.......DE..N.....................................S...D.....C
ENSBTAP00000026766  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000053738  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000016306  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000013714  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000036550  .........LAERTFRLL.......DE..N.....................................M...D.....H
ENSBTAP00000053738  .........-YALLTT--.......--..-.....................................-...-.....-
ENSBTAP00000023383  .........FLRERLTDL.......-E..Q.....................................R...T.....S
ENSBTAP00000027030  .........MLEEVFHNL.......D-..-.....................................P...D.....G
ENSBTAP00000053270  .........MLEEVFHNL.......D-..-.....................................P...D.....G
ENSBTAP00000054640  .........MLEEVFHNL.......D-..-.....................................P...D.....G
ENSBTAP00000012770  .........TAKVFAKLL.......HT..D.....................................S...Y.....G
ENSBTAP00000009967  .........-LQELASLL.......-V..T.....................................N...S.....E
ENSBTAP00000015183  .........---------.......--..-.....................................-...-.....I
ENSBTAP00000014222  .........---------.......--..-.....................................G...E.....Q
ENSBTAP00000026288  .........-LAAIAQLH.......EK..V.....................................R...G.....G
ENSBTAP00000002128  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000003365  .........-LSDIFEVI.......DL..D.....................................G...N.....G
ENSBTAP00000053738  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000009228  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000026785  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000002578  pvsnqgympYLNKFILEK.......VQ..D.....................................N...F.....D
ENSBTAP00000000106  .........-----LREF.......DS..D.....................................G...D.....G
ENSBTAP00000028840  .........VEDIVVYLS.......SL..G.....................................K...H.....N
ENSBTAP00000053594  .........---------.......--..-.....................................-...-.....E
ENSBTAP00000055414  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000026698  .........TVAGAFSYF.......QQ..D.....................................A...D.....G
ENSBTAP00000017015  .........QAARQFAAL.......DP..E.....................................H...R.....G
ENSBTAP00000049908  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000021395  .........-HQALRQQV.......QV..D.....................................T...K.....G
ENSBTAP00000007194  .........---------.......--..-.....................................-...-.....-
ENSBTAP00000025455  .........---------.......--..-.....................................-...-.....-


                          80                                                                        
                           |                                                                        
d1bjfa_               TIDFREF.IIA...................................................................
ENSBTAP00000019411  TIDFPEF.LTM...................................................................
ENSBTAP00000036057  TIDFPEF.LTM...................................................................
ENSBTAP00000038404  TIDFREF.IIA...................................................................
ENSBTAP00000010971  TIDFREF.IIA...................................................................
ENSBTAP00000019803  KLGFEEF.KYL...................................................................
ENSBTAP00000014038  EVDFKEF.IEG...................................................................
ENSBTAP00000002055  TIDFPEF.LTM...................................................................
ENSBTAP00000049731  TIDFPEF.LTM...................................................................
ENSBTAP00000005577  TIDFREF.IIA...................................................................
ENSBTAP00000034949  TLDFKEY.VIA...................................................................
ENSBTAP00000017447  AFTYEKF.YEL...................................................................
ENSBTAP00000010858  RIRVLSF.KTG...................................................................
ENSBTAP00000046644  SIPQEDF.TPE...................................................................
ENSBTAP00000022814  TIDFREF.ICA...................................................................
ENSBTAP00000019758  YIALDEW.AGC...................................................................
ENSBTAP00000019321  TIDFREF.ICA...................................................................
ENSBTAP00000011677  RLNLQEF.HHL...................................................................
ENSBTAP00000011680  RLNLQEF.HHL...................................................................
ENSBTAP00000021742  SVSFEDF.VAG...................................................................
ENSBTAP00000005348  -------.---...................................................................
ENSBTAP00000016609  SIRPDEFsLEI...................................................................
ENSBTAP00000012740  KIRVQSL.KIG...................................................................
ENSBTAP00000018403  SISFQEF.LEA...................................................................
ENSBTAP00000026407  VINYEEF.KKA...................................................................
ENSBTAP00000052557  KISFNDF.LAV...................................................................
ENSBTAP00000054167  AVSFEDF.IKG...................................................................
ENSBTAP00000010319  KMNFSDF.LTV...................................................................
ENSBTAP00000041545  TLEGEEF.VEF...................................................................
ENSBTAP00000055204  GVNFSEF.TGV...................................................................
ENSBTAP00000003718  SVKFEDF.VTA...................................................................
ENSBTAP00000011676  SLELVEF.KTL...................................................................
ENSBTAP00000049395  SLEDEEI.ETF...................................................................
ENSBTAP00000054983  TITFEQF.KEA...................................................................
ENSBTAP00000052219  TMGFNEF.KEL...................................................................
ENSBTAP00000025402  AINPEDF.PES...................................................................
ENSBTAP00000011678  KLGLVEF.NIL...................................................................
ENSBTAP00000000433  TITFQQF.QEA...................................................................
ENSBTAP00000021491  TISFEKF.FAI...................................................................
ENSBTAP00000044733  KLGLKEF.YIL...................................................................
ENSBTAP00000010937  TLTFEEF.CVF...................................................................
ENSBTAP00000056439  TLTFEEF.CVF...................................................................
ENSBTAP00000055780  TVDFDEF.LVM...................................................................
ENSBTAP00000038002  VVCLSDV.SCY...................................................................
ENSBTAP00000034705  RLEGPEI.EEF...................................................................
ENSBTAP00000035936  TIDFLEY.VAA...................................................................
ENSBTAP00000013699  RIDVYGF.SAL...................................................................
ENSBTAP00000002564  KMRALSF.KTG...................................................................
ENSBTAP00000011496  RIEFSEF.IQA...................................................................
ENSBTAP00000019111  KITFEDF.NEV...................................................................
ENSBTAP00000017036  YIDFMEY.VAA...................................................................
ENSBTAP00000003213  TLGFEEF.CAF...................................................................
ENSBTAP00000055444  TLGFEEF.CAF...................................................................
ENSBTAP00000024550  KMGFNEF.KEL...................................................................
ENSBTAP00000015248  PINFTMF.LTM...................................................................
ENSBTAP00000021328  PINFTMF.LTM...................................................................
ENSBTAP00000037091  PINFTMF.LTM...................................................................
ENSBTAP00000029967  KVDFEDF.VEL...................................................................
ENSBTAP00000021449  RVDFDDF.VEL...................................................................
ENSBTAP00000053176  VIHLKDI.VCY...................................................................
ENSBTAP00000042361  HVDFDDF.VEL...................................................................
ENSBTAP00000016509  TIDFLEY.VAA...................................................................
ENSBTAP00000026714  HVDFDDF.VEL...................................................................
ENSBTAP00000004690  KLGLREF.QVL...................................................................
ENSBTAP00000010858  -------.---...................................................................
ENSBTAP00000013117  DVIKEEF.VEV...................................................................
ENSBTAP00000017574  RITIEEF.RTI...................................................................
ENSBTAP00000004885  KLDFEEF.MKY...................................................................
ENSBTAP00000008961  YISVFEF.DIF...................................................................
ENSBTAP00000028063  KLTVFSV.KAM...................................................................
ENSBTAP00000012740  -------.---...................................................................
ENSBTAP00000006283  RVDFEEF.VEM...................................................................
ENSBTAP00000014306  VLDFEHF.LPM...................................................................
ENSBTAP00000053252  RVTEEEF.CEA...................................................................
ENSBTAP00000014304  VLDFEHF.LPM...................................................................
ENSBTAP00000045669  KISVFAV.KMA...................................................................
ENSBTAP00000041264  HVSIFEF.DIF...................................................................
ENSBTAP00000006711  -------.---...................................................................
ENSBTAP00000017358  YISVFEF.DIF...................................................................
ENSBTAP00000053274  KISVFAV.KMA...................................................................
ENSBTAP00000055296  YISVFEF.DIF...................................................................
ENSBTAP00000016852  TIDFNEF.LLT...................................................................
ENSBTAP00000036380  ELDFSTF.LTI...................................................................
ENSBTAP00000041719  RVDFETF.LPM...................................................................
ENSBTAP00000049636  KIEFEQF.LPM...................................................................
ENSBTAP00000024444  PINFTVF.LQM...................................................................
ENSBTAP00000004556  VINPTSS.ETA...................................................................
ENSBTAP00000038767  QVNFRGF.MRT...................................................................
ENSBTAP00000031285  -------.---...................................................................
ENSBTAP00000011457  CISVTEW.VYG...................................................................
ENSBTAP00000011047  MMDFDTF.LPM...................................................................
ENSBTAP00000002564  -------.---...................................................................
ENSBTAP00000037104  PINFTVF.LTM...................................................................
ENSBTAP00000002672  PINFTVF.LTL...................................................................
ENSBTAP00000028269  PINFTVF.LNM...................................................................
ENSBTAP00000016647  RLDFPGF.VRV...................................................................
ENSBTAP00000004536  GLDLEEF.ILY...................................................................
ENSBTAP00000042177  -------.---...................................................................
ENSBTAP00000028063  -------.---...................................................................
ENSBTAP00000050283  MLDFETF.LPI...................................................................
ENSBTAP00000048539  TIDFREY.VIG...................................................................
ENSBTAP00000045669  -------.---...................................................................
ENSBTAP00000007972  TLDLEEF.LRA...................................................................
ENSBTAP00000040815  VISLPEL.KGC...................................................................
ENSBTAP00000025661  SIDFREY.VIG...................................................................
ENSBTAP00000028350  SLSFEDF.LDL...................................................................
ENSBTAP00000053274  -------.---...................................................................
ENSBTAP00000021537  HMTLDNF.LDM...................................................................
ENSBTAP00000055481  -------.---...................................................................
ENSBTAP00000039155  PVGFPEL.LGL...................................................................
ENSBTAP00000029333  -------.---...................................................................
ENSBTAP00000016315  ALTLPEF.CAA...................................................................
ENSBTAP00000021091  TVSIQEF.RDL...................................................................
ENSBTAP00000021618  YLSFREF.LDI...................................................................
ENSBTAP00000055520  QMHPRA-.---...................................................................
ENSBTAP00000055624  QMHPRA-.---...................................................................
ENSBTAP00000016319  ALTLDEF.CAA...................................................................
ENSBTAP00000034078  YIRFEKF.LPV...................................................................
ENSBTAP00000006645  VFSFEDV.LGM...................................................................
ENSBTAP00000021909  FIDLEEY.IGD...................................................................
ENSBTAP00000001426  KIEMAEL.AQI...................................................................
ENSBTAP00000015802  QLDFEEF.VHY...................................................................
ENSBTAP00000032680  QLDFEEF.VHY...................................................................
ENSBTAP00000055007  TIDFEEF.LVM...................................................................
ENSBTAP00000020148  QLDFQEF.LNL...................................................................
ENSBTAP00000052345  -------.---...................................................................
ENSBTAP00000029334  -------.---...................................................................
ENSBTAP00000052345  MLDRDEF.AVA...................................................................
ENSBTAP00000056127  FVDQDEY.IAD...................................................................
ENSBTAP00000012557  NIDYMSG.FQD...................................................................
ENSBTAP00000011888  TITLQEL.QKA...................................................................
ENSBTAP00000017060  HLDRDEF.AVA...................................................................
ENSBTAP00000031854  RMSYADF.VWF...................................................................
ENSBTAP00000031823  YVQVEEY.IAD...................................................................
ENSBTAP00000021603  YLSFREF.LDV...................................................................
ENSBTAP00000010838  KIDFSEF.LSL...................................................................
ENSBTAP00000014575  NLTFNDF.VDM...................................................................
ENSBTAP00000011215  RMSYADF.VWF...................................................................
ENSBTAP00000053698  QVDFDEF.MTI...................................................................
ENSBTAP00000006806  EVDFQEY.VVL...................................................................
ENSBTAP00000029334  KMDQQEF.SIA...................................................................
ENSBTAP00000044105  KIDFSEF.LSL...................................................................
ENSBTAP00000026904  EVDFNEF.VVM...................................................................
ENSBTAP00000017060  -------.---...................................................................
ENSBTAP00000055520  -------.---...................................................................
ENSBTAP00000044226  EVDFQEY.VVL...................................................................
ENSBTAP00000055624  -------.---...................................................................
ENSBTAP00000042182  SLDLYHF.QQL...................................................................
ENSBTAP00000010796  KFAYCSF.IQScvlllkaketslmqrmkiqnankmkeagaetcsfysa..............................
ENSBTAP00000021174  KIGIVEL.AHV...................................................................
ENSBTAP00000006275  ECDFQEF.MAF...................................................................
ENSBTAP00000020950  FVSLEEF.LGD...................................................................
ENSBTAP00000053738  KFAYCSF.IQScvlllkaketslmqrmkiqnankmkeagaetcsfysa..............................
ENSBTAP00000004963  YINVKEW.VKG...................................................................
ENSBTAP00000023774  QVDFEEF.VTL...................................................................
ENSBTAP00000020395  HVSLQEY.MAF...................................................................
ENSBTAP00000020150  KVGFQSF.FSL...................................................................
ENSBTAP00000025561  EVDFQEY.CVF...................................................................
ENSBTAP00000053738  TLNFREF.RNLcekrsfsadddapqrlprpkqkvadselaceqahq................................
ENSBTAP00000034009  AVSFEEF.VVL...................................................................
ENSBTAP00000020539  LIALSDW.AAAvesvlhlglpwrmlrpqlvssltdnklaykswlenlakeklsqqniq....................
ENSBTAP00000020778  KLSLSEF.ISL...................................................................
ENSBTAP00000017461  GIRLKEF.LDI...................................................................
ENSBTAP00000044096  QLSFEEF.IML...................................................................
ENSBTAP00000008523  QLSFEEF.IML...................................................................
ENSBTAP00000035196  GLTLKGF.LFL...................................................................
ENSBTAP00000041997  MLDDEEF.ALA...................................................................
ENSBTAP00000025499  ---HKKF.FQM...................................................................
ENSBTAP00000055481  RMDQVEF.SIA...................................................................
ENSBTAP00000002174  LLDDEEF.ALA...................................................................
ENSBTAP00000000589  QVDFQEY.AVF...................................................................
ENSBTAP00000028239  MLDDEEF.ALA...................................................................
ENSBTAP00000014894  LVTFQAF.IDF...................................................................
ENSBTAP00000026544  RLDLNDL.ARI...................................................................
ENSBTAP00000029333  RMDQVEF.SIA...................................................................
ENSBTAP00000041966  RLDQEEF.SRL...................................................................
ENSBTAP00000008933  MLDEEEF.ALA...................................................................
ENSBTAP00000056088  AVSFEEF.VVL...................................................................
ENSBTAP00000033794  QICFEEF.LYI...................................................................
ENSBTAP00000012786  TVTFQSF.IDF...................................................................
ENSBTAP00000030018  VVTFQAF.IDF...................................................................
ENSBTAP00000040233  AVPYLVF.LSRfggidlninvikrggenemngcrtlkdleaqvgeki...............................
ENSBTAP00000003365  KLNFDDF.CII...................................................................
ENSBTAP00000053176  -IHLKDI.VCY...................................................................
ENSBTAP00000024301  VVTFQAF.IDF...................................................................
ENSBTAP00000022292  LISYQEF.LAF...................................................................
ENSBTAP00000015611  RLDFTEF.LLM...................................................................
ENSBTAP00000012770  EMDYKTY.LDF...................................................................
ENSBTAP00000000847  EIDFKEY.SVF...................................................................
ENSBTAP00000053738  AVPYLVF.LSRfggidlninvikrggenemngcrtlkdleaqvgeki...............................
ENSBTAP00000054975  -------.---...................................................................
ENSBTAP00000046639  RADYGEF.KRA...................................................................
ENSBTAP00000052345  ILNKQEF.FVA...................................................................
ENSBTAP00000053164  -------.---...................................................................
ENSBTAP00000016774  GINFEEF.LVL...................................................................
ENSBTAP00000022630  EVSFEEF.QVL...................................................................
ENSBTAP00000010796  YINWKYF.LQNfssyveetavewaekmprgprplspkemanqel..................................
ENSBTAP00000021909  FVTEGEL.KSW...................................................................
ENSBTAP00000033974  FFNCSNL.LAL...................................................................
ENSBTAP00000006711  ---LKDV.VCY...................................................................
ENSBTAP00000010796  HITYQEF.LQKlginysadihrpyaeeyfnfmghftkpqqvqeelkelqqsteka.......................
ENSBTAP00000004912  LISFQEF.VAF...................................................................
ENSBTAP00000005979  QLTLDGF.LFLntlfiqrgrhettwtilrrfgygdsleltadylcpplrvppg.........................
ENSBTAP00000053738  YINWKYF.LQNfssyveetavewaekmprgprplspkemanqel..................................
ENSBTAP00000053746  EINFEDF.LTI...................................................................
ENSBTAP00000023221  -------.---...................................................................
ENSBTAP00000019429  KLSFREF.LLI...................................................................
ENSBTAP00000052019  HVDFHEY.LLM...................................................................
ENSBTAP00000042244  KLSFREF.LLI...................................................................
ENSBTAP00000053738  CVNVSRF.IELieespklhkipaykdtkmplflawdsveeiihdsiakn.............................
ENSBTAP00000018877  RISFDEY.WTL...................................................................
ENSBTAP00000053019  RISFEEF.VSL...................................................................
ENSBTAP00000003073  -------.---...................................................................
ENSBTAP00000012886  QVELNEF.LQL...................................................................
ENSBTAP00000044222  QVDFVEY.MRL...................................................................
ENSBTAP00000028499  ELKFSEY.WRL...................................................................
ENSBTAP00000047378  RVNFEEF.KDGfiavlssqsglassdedsgslesvasravppkyvsgskwygrrshpepcgaaggapglleqparpsa
ENSBTAP00000009308  -------.---...................................................................
ENSBTAP00000017060  YLDKQGF.YVA...................................................................
ENSBTAP00000050406  KISFDEF.VYI...................................................................
ENSBTAP00000031879  KISFDEF.VYI...................................................................
ENSBTAP00000031854  FVSAQSF.ITI...................................................................
ENSBTAP00000001250  EVDLREY.VVA...................................................................
ENSBTAP00000026035  TVEFKEF.LVL...................................................................
ENSBTAP00000011215  FVSAQSF.ITI...................................................................
ENSBTAP00000002128  MVKLDDF.VSA...................................................................
ENSBTAP00000053194  YISKDEY.IDF...................................................................
ENSBTAP00000056127  FVTTEEL.KTW...................................................................
ENSBTAP00000033188  KITRQEF.IDG...................................................................
ENSBTAP00000053548  KITRQEF.IDG...................................................................
ENSBTAP00000011687  EIGFDQF.YML...................................................................
ENSBTAP00000007636  LISFSDY.IFL...................................................................
ENSBTAP00000020950  FLTESEL.SSW...................................................................
ENSBTAP00000009115  KVNFSDF.LK-...................................................................
ENSBTAP00000023873  AIRFE--.---...................................................................
ENSBTAP00000054471  -------.---...................................................................
ENSBTAP00000039694  GITFDEF.RSF...................................................................
ENSBTAP00000025205  -------.---...................................................................
ENSBTAP00000047882  -------.---...................................................................
ENSBTAP00000001368  HISQEEF.QII...................................................................
ENSBTAP00000029786  LINFREF.VSG...................................................................
ENSBTAP00000028993  AITFQEF.ARG...................................................................
ENSBTAP00000023678  ----EAL.IDT...................................................................
ENSBTAP00000034710  -------.---...................................................................
ENSBTAP00000031823  WVSLAEL.RSW...................................................................
ENSBTAP00000038002  -------.--Y...................................................................
ENSBTAP00000021074  AISFDEF.VLA...................................................................
ENSBTAP00000026544  CIQMKEL.AGM...................................................................
ENSBTAP00000007217  ILPTEEY.EEA...................................................................
ENSBTAP00000029792  LINFKEF.VTG...................................................................
ENSBTAP00000044088  LISYTEY.LFL...................................................................
ENSBTAP00000017319  KLDFEDF.MVL...................................................................
ENSBTAP00000044100  YISQEDF.ESI...................................................................
ENSBTAP00000033594  KIPPEST.LIF...................................................................
ENSBTAP00000026766  HIDFKEI.SCG...................................................................
ENSBTAP00000055894  TISYRDF.VNM...................................................................
ENSBTAP00000015220  EVPVEEF.STF...................................................................
ENSBTAP00000033613  -------.---...................................................................
ENSBTAP00000056320  KISYADF.VWF...................................................................
ENSBTAP00000025249  SMSFVEF.VEL...................................................................
ENSBTAP00000029159  YISQEEF.EKI...................................................................
ENSBTAP00000044088  NISLEEF.KSF...................................................................
ENSBTAP00000016319  YFGRSQF.YIA...................................................................
ENSBTAP00000017662  -------.---...................................................................
ENSBTAP00000012479  MVNYEKL.LWFlkvaasedteqnkgvedsnvketqssshqssiapqdynsqsevnesllevlkma.............
ENSBTAP00000029886  -------.---...................................................................
ENSBTAP00000027388  -------.---...................................................................
ENSBTAP00000039694  VISYTEY.LFL...................................................................
ENSBTAP00000023673  -------.---...................................................................
ENSBTAP00000041488  -------.---...................................................................
ENSBTAP00000001452  -------.---...................................................................
ENSBTAP00000028498  KLEFGSF.WEL...................................................................
ENSBTAP00000001426  KLGLSEM.SRL...................................................................
ENSBTAP00000020240  -------.---...................................................................
ENSBTAP00000053650  -------.---...................................................................
ENSBTAP00000041651  -------.---...................................................................
ENSBTAP00000005154  KLSFEEF.QNY...................................................................
ENSBTAP00000021174  -------.---...................................................................
ENSBTAP00000022068  -------.---...................................................................
ENSBTAP00000026682  KLNFDEL.RQD...................................................................
ENSBTAP00000007636  GLTFQEV.ENF...................................................................
ENSBTAP00000027954  -------.---...................................................................
ENSBTAP00000020778  -------.---...................................................................
ENSBTAP00000013601  -------.---...................................................................
ENSBTAP00000005477  KINLPDF.FKV...................................................................
ENSBTAP00000055305  -------.---...................................................................
ENSBTAP00000036054  -------.---...................................................................
ENSBTAP00000004912  QVSFSYF.NGF...................................................................
ENSBTAP00000022292  HLNYTEF.TQF...................................................................
ENSBTAP00000002717  ELSFEQF.HLF...................................................................
ENSBTAP00000036015  PVSSQGY.MPY...................................................................
ENSBTAP00000051638  LINFKEF.SSA...................................................................
ENSBTAP00000026766  -LHFNNL.IVG...................................................................
ENSBTAP00000053738  -------.---...................................................................
ENSBTAP00000016306  QLKFEEL.QCD...................................................................
ENSBTAP00000013714  -------.---...................................................................
ENSBTAP00000036550  LIEFKAF.VSC...................................................................
ENSBTAP00000053738  -------.---...................................................................
ENSBTAP00000023383  DITYGQF.AQL...................................................................
ENSBTAP00000027030  MMSVEDF.FYGlfkngkpltpsastpyrqlkrhismqsfdesgrrttapsammsti......................
ENSBTAP00000053270  MMSVEDF.FYGlfkngkpltpsastpyrqlkrhismqsfdesgrrttapsammsti......................
ENSBTAP00000054640  MMSVEDF.FYGlfkngkpltpsastpyrqlkrhismqsfdesgrrttapsammsti......................
ENSBTAP00000012770  RISIMQF.FNY...................................................................
ENSBTAP00000009967  SVDWRKF.LLV...................................................................
ENSBTAP00000015183  CMSREEF.VQR...................................................................
ENSBTAP00000014222  EIQFEDF.TNT...................................................................
ENSBTAP00000026288  GVNINEF.FKG...................................................................
ENSBTAP00000002128  ------F.FDC...................................................................
ENSBTAP00000003365  LLSLEEY.NFF...................................................................
ENSBTAP00000053738  -------.-TA...................................................................
ENSBTAP00000009228  -------.---...................................................................
ENSBTAP00000026785  VISVSEL.INA...................................................................
ENSBTAP00000002578  KIEFNRM.CWT...................................................................
ENSBTAP00000000106  RYSFLEL.RAA...................................................................
ENSBTAP00000028840  SIT----.---...................................................................
ENSBTAP00000053594  SVTLEQF.GEL...................................................................
ENSBTAP00000055414  -------.--Dmdnqkhiyedfdnvllemntlpsekhfsktqskllaspedqhehyrestlpqsppeqqrgatveqgp
ENSBTAP00000026698  LVDFRDV.ALA...................................................................
ENSBTAP00000017015  HVEWPDF.LS-...................................................................
ENSBTAP00000049908  -------.---...................................................................
ENSBTAP00000021395  TVSFGDF.VHV...................................................................
ENSBTAP00000007194  -------.---...................................................................
ENSBTAP00000025455  -------.---...................................................................


                                                                                                    
                                                                                                    
d1bjfa_               ..............................................................................
ENSBTAP00000019411  ..............................................................................
ENSBTAP00000036057  ..............................................................................
ENSBTAP00000038404  ..............................................................................
ENSBTAP00000010971  ..............................................................................
ENSBTAP00000019803  ..............................................................................
ENSBTAP00000014038  ..............................................................................
ENSBTAP00000002055  ..............................................................................
ENSBTAP00000049731  ..............................................................................
ENSBTAP00000005577  ..............................................................................
ENSBTAP00000034949  ..............................................................................
ENSBTAP00000017447  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000046644  ..............................................................................
ENSBTAP00000022814  ..............................................................................
ENSBTAP00000019758  ..............................................................................
ENSBTAP00000019321  ..............................................................................
ENSBTAP00000011677  ..............................................................................
ENSBTAP00000011680  ..............................................................................
ENSBTAP00000021742  ..............................................................................
ENSBTAP00000005348  ..............................................................................
ENSBTAP00000016609  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000018403  ..............................................................................
ENSBTAP00000026407  ..............................................................................
ENSBTAP00000052557  ..............................................................................
ENSBTAP00000054167  ..............................................................................
ENSBTAP00000010319  ..............................................................................
ENSBTAP00000041545  ..............................................................................
ENSBTAP00000055204  ..............................................................................
ENSBTAP00000003718  ..............................................................................
ENSBTAP00000011676  ..............................................................................
ENSBTAP00000049395  ..............................................................................
ENSBTAP00000054983  ..............................................................................
ENSBTAP00000052219  ..............................................................................
ENSBTAP00000025402  ..............................................................................
ENSBTAP00000011678  ..............................................................................
ENSBTAP00000000433  ..............................................................................
ENSBTAP00000021491  ..............................................................................
ENSBTAP00000044733  ..............................................................................
ENSBTAP00000010937  ..............................................................................
ENSBTAP00000056439  ..............................................................................
ENSBTAP00000055780  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000034705  ..............................................................................
ENSBTAP00000035936  ..............................................................................
ENSBTAP00000013699  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000011496  ..............................................................................
ENSBTAP00000019111  ..............................................................................
ENSBTAP00000017036  ..............................................................................
ENSBTAP00000003213  ..............................................................................
ENSBTAP00000055444  ..............................................................................
ENSBTAP00000024550  ..............................................................................
ENSBTAP00000015248  ..............................................................................
ENSBTAP00000021328  ..............................................................................
ENSBTAP00000037091  ..............................................................................
ENSBTAP00000029967  ..............................................................................
ENSBTAP00000021449  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000042361  ..............................................................................
ENSBTAP00000016509  ..............................................................................
ENSBTAP00000026714  ..............................................................................
ENSBTAP00000004690  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000013117  ..............................................................................
ENSBTAP00000017574  ..............................................................................
ENSBTAP00000004885  ..............................................................................
ENSBTAP00000008961  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000006283  ..............................................................................
ENSBTAP00000014306  ..............................................................................
ENSBTAP00000053252  ..............................................................................
ENSBTAP00000014304  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000041264  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000017358  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000055296  ..............................................................................
ENSBTAP00000016852  ..............................................................................
ENSBTAP00000036380  ..............................................................................
ENSBTAP00000041719  ..............................................................................
ENSBTAP00000049636  ..............................................................................
ENSBTAP00000024444  ..............................................................................
ENSBTAP00000004556  ..............................................................................
ENSBTAP00000038767  ..............................................................................
ENSBTAP00000031285  ..............................................................................
ENSBTAP00000011457  ..............................................................................
ENSBTAP00000011047  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000037104  ..............................................................................
ENSBTAP00000002672  ..............................................................................
ENSBTAP00000028269  ..............................................................................
ENSBTAP00000016647  ..............................................................................
ENSBTAP00000004536  ..............................................................................
ENSBTAP00000042177  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000050283  ..............................................................................
ENSBTAP00000048539  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000007972  ..............................................................................
ENSBTAP00000040815  ..............................................................................
ENSBTAP00000025661  ..............................................................................
ENSBTAP00000028350  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000021537  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000039155  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000016315  ..............................................................................
ENSBTAP00000021091  ..............................................................................
ENSBTAP00000021618  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000034078  ..............................................................................
ENSBTAP00000006645  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000015802  ..............................................................................
ENSBTAP00000032680  ..............................................................................
ENSBTAP00000055007  ..............................................................................
ENSBTAP00000020148  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000012557  ..............................................................................
ENSBTAP00000011888  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000021603  ..............................................................................
ENSBTAP00000010838  ..............................................................................
ENSBTAP00000014575  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000053698  ..............................................................................
ENSBTAP00000006806  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000044105  ..............................................................................
ENSBTAP00000026904  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000044226  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000042182  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000006275  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000004963  ..............................................................................
ENSBTAP00000023774  ..............................................................................
ENSBTAP00000020395  ..............................................................................
ENSBTAP00000020150  ..............................................................................
ENSBTAP00000025561  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000034009  ..............................................................................
ENSBTAP00000020539  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000017461  ..............................................................................
ENSBTAP00000044096  ..............................................................................
ENSBTAP00000008523  ..............................................................................
ENSBTAP00000035196  ..............................................................................
ENSBTAP00000041997  ..............................................................................
ENSBTAP00000025499  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000002174  ..............................................................................
ENSBTAP00000000589  ..............................................................................
ENSBTAP00000028239  ..............................................................................
ENSBTAP00000014894  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000041966  ..............................................................................
ENSBTAP00000008933  ..............................................................................
ENSBTAP00000056088  ..............................................................................
ENSBTAP00000033794  ..............................................................................
ENSBTAP00000012786  ..............................................................................
ENSBTAP00000030018  ..............................................................................
ENSBTAP00000040233  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000024301  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000015611  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000000847  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000054975  ..............................................................................
ENSBTAP00000046639  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000053164  ..............................................................................
ENSBTAP00000016774  ..............................................................................
ENSBTAP00000022630  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000033974  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000005979  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000053746  ..............................................................................
ENSBTAP00000023221  ..............................................................................
ENSBTAP00000019429  ..............................................................................
ENSBTAP00000052019  ..............................................................................
ENSBTAP00000042244  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000018877  ..............................................................................
ENSBTAP00000053019  ..............................................................................
ENSBTAP00000003073  ..............................................................................
ENSBTAP00000012886  ..............................................................................
ENSBTAP00000044222  ..............................................................................
ENSBTAP00000028499  ..............................................................................
ENSBTAP00000047378  rsklrrsaslesveslksdeeadsakepqnelfeaqgqlptwgsevfgsark..........................
ENSBTAP00000009308  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000050406  ..............................................................................
ENSBTAP00000031879  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000001250  ..............................................................................
ENSBTAP00000026035  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000053194  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000033188  ..............................................................................
ENSBTAP00000053548  ..............................................................................
ENSBTAP00000011687  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000009115  ..............................................................................
ENSBTAP00000023873  ..............................................................................
ENSBTAP00000054471  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000025205  ..............................................................................
ENSBTAP00000047882  ..............................................................................
ENSBTAP00000001368  ..............................................................................
ENSBTAP00000029786  ..............................................................................
ENSBTAP00000028993  ..............................................................................
ENSBTAP00000023678  ..............................................................................
ENSBTAP00000034710  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000021074  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000007217  ..............................................................................
ENSBTAP00000029792  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000017319  ..............................................................................
ENSBTAP00000044100  ..............................................................................
ENSBTAP00000033594  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000055894  ..............................................................................
ENSBTAP00000015220  ..............................................................................
ENSBTAP00000033613  ..............................................................................
ENSBTAP00000056320  ..............................................................................
ENSBTAP00000025249  ..............................................................................
ENSBTAP00000029159  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000017662  ..............................................................................
ENSBTAP00000012479  ..............................................................................
ENSBTAP00000029886  ..............................................................................
ENSBTAP00000027388  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000023673  ..............................................................................
ENSBTAP00000041488  ..............................................................................
ENSBTAP00000001452  ..............................................................................
ENSBTAP00000028498  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000020240  ..............................................................................
ENSBTAP00000053650  ..............................................................................
ENSBTAP00000041651  ..............................................................................
ENSBTAP00000005154  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000022068  ..............................................................................
ENSBTAP00000026682  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000027954  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000013601  ..............................................................................
ENSBTAP00000005477  ..............................................................................
ENSBTAP00000055305  ..............................................................................
ENSBTAP00000036054  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000002717  ..............................................................................
ENSBTAP00000036015  ..............................................................................
ENSBTAP00000051638  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000016306  ..............................................................................
ENSBTAP00000013714  ..............................................................................
ENSBTAP00000036550  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000023383  ..............................................................................
ENSBTAP00000027030  ..............................................................................
ENSBTAP00000053270  ..............................................................................
ENSBTAP00000054640  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000009967  ..............................................................................
ENSBTAP00000015183  ..............................................................................
ENSBTAP00000014222  ..............................................................................
ENSBTAP00000026288  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000009228  ..............................................................................
ENSBTAP00000026785  ..............................................................................
ENSBTAP00000002578  ..............................................................................
ENSBTAP00000000106  ..............................................................................
ENSBTAP00000028840  ..............................................................................
ENSBTAP00000053594  ..............................................................................
ENSBTAP00000055414  ngistreqeqpeestgeqelneesvskegtytgstpeqrssreliteqrphhepiteqgvpqgthiestaeqglsees
ENSBTAP00000026698  ..............................................................................
ENSBTAP00000017015  ..............................................................................
ENSBTAP00000049908  ..............................................................................
ENSBTAP00000021395  ..............................................................................
ENSBTAP00000007194  ..............................................................................
ENSBTAP00000025455  ..............................................................................


                                                                                                    
                                                                                                    
d1bjfa_               ..............................................................................
ENSBTAP00000019411  ..............................................................................
ENSBTAP00000036057  ..............................................................................
ENSBTAP00000038404  ..............................................................................
ENSBTAP00000010971  ..............................................................................
ENSBTAP00000019803  ..............................................................................
ENSBTAP00000014038  ..............................................................................
ENSBTAP00000002055  ..............................................................................
ENSBTAP00000049731  ..............................................................................
ENSBTAP00000005577  ..............................................................................
ENSBTAP00000034949  ..............................................................................
ENSBTAP00000017447  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000046644  ..............................................................................
ENSBTAP00000022814  ..............................................................................
ENSBTAP00000019758  ..............................................................................
ENSBTAP00000019321  ..............................................................................
ENSBTAP00000011677  ..............................................................................
ENSBTAP00000011680  ..............................................................................
ENSBTAP00000021742  ..............................................................................
ENSBTAP00000005348  ..............................................................................
ENSBTAP00000016609  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000018403  ..............................................................................
ENSBTAP00000026407  ..............................................................................
ENSBTAP00000052557  ..............................................................................
ENSBTAP00000054167  ..............................................................................
ENSBTAP00000010319  ..............................................................................
ENSBTAP00000041545  ..............................................................................
ENSBTAP00000055204  ..............................................................................
ENSBTAP00000003718  ..............................................................................
ENSBTAP00000011676  ..............................................................................
ENSBTAP00000049395  ..............................................................................
ENSBTAP00000054983  ..............................................................................
ENSBTAP00000052219  ..............................................................................
ENSBTAP00000025402  ..............................................................................
ENSBTAP00000011678  ..............................................................................
ENSBTAP00000000433  ..............................................................................
ENSBTAP00000021491  ..............................................................................
ENSBTAP00000044733  ..............................................................................
ENSBTAP00000010937  ..............................................................................
ENSBTAP00000056439  ..............................................................................
ENSBTAP00000055780  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000034705  ..............................................................................
ENSBTAP00000035936  ..............................................................................
ENSBTAP00000013699  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000011496  ..............................................................................
ENSBTAP00000019111  ..............................................................................
ENSBTAP00000017036  ..............................................................................
ENSBTAP00000003213  ..............................................................................
ENSBTAP00000055444  ..............................................................................
ENSBTAP00000024550  ..............................................................................
ENSBTAP00000015248  ..............................................................................
ENSBTAP00000021328  ..............................................................................
ENSBTAP00000037091  ..............................................................................
ENSBTAP00000029967  ..............................................................................
ENSBTAP00000021449  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000042361  ..............................................................................
ENSBTAP00000016509  ..............................................................................
ENSBTAP00000026714  ..............................................................................
ENSBTAP00000004690  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000013117  ..............................................................................
ENSBTAP00000017574  ..............................................................................
ENSBTAP00000004885  ..............................................................................
ENSBTAP00000008961  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000006283  ..............................................................................
ENSBTAP00000014306  ..............................................................................
ENSBTAP00000053252  ..............................................................................
ENSBTAP00000014304  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000041264  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000017358  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000055296  ..............................................................................
ENSBTAP00000016852  ..............................................................................
ENSBTAP00000036380  ..............................................................................
ENSBTAP00000041719  ..............................................................................
ENSBTAP00000049636  ..............................................................................
ENSBTAP00000024444  ..............................................................................
ENSBTAP00000004556  ..............................................................................
ENSBTAP00000038767  ..............................................................................
ENSBTAP00000031285  ..............................................................................
ENSBTAP00000011457  ..............................................................................
ENSBTAP00000011047  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000037104  ..............................................................................
ENSBTAP00000002672  ..............................................................................
ENSBTAP00000028269  ..............................................................................
ENSBTAP00000016647  ..............................................................................
ENSBTAP00000004536  ..............................................................................
ENSBTAP00000042177  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000050283  ..............................................................................
ENSBTAP00000048539  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000007972  ..............................................................................
ENSBTAP00000040815  ..............................................................................
ENSBTAP00000025661  ..............................................................................
ENSBTAP00000028350  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000021537  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000039155  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000016315  ..............................................................................
ENSBTAP00000021091  ..............................................................................
ENSBTAP00000021618  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000034078  ..............................................................................
ENSBTAP00000006645  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000015802  ..............................................................................
ENSBTAP00000032680  ..............................................................................
ENSBTAP00000055007  ..............................................................................
ENSBTAP00000020148  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000012557  ..............................................................................
ENSBTAP00000011888  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000021603  ..............................................................................
ENSBTAP00000010838  ..............................................................................
ENSBTAP00000014575  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000053698  ..............................................................................
ENSBTAP00000006806  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000044105  ..............................................................................
ENSBTAP00000026904  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000044226  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000042182  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000006275  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000004963  ..............................................................................
ENSBTAP00000023774  ..............................................................................
ENSBTAP00000020395  ..............................................................................
ENSBTAP00000020150  ..............................................................................
ENSBTAP00000025561  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000034009  ..............................................................................
ENSBTAP00000020539  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000017461  ..............................................................................
ENSBTAP00000044096  ..............................................................................
ENSBTAP00000008523  ..............................................................................
ENSBTAP00000035196  ..............................................................................
ENSBTAP00000041997  ..............................................................................
ENSBTAP00000025499  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000002174  ..............................................................................
ENSBTAP00000000589  ..............................................................................
ENSBTAP00000028239  ..............................................................................
ENSBTAP00000014894  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000041966  ..............................................................................
ENSBTAP00000008933  ..............................................................................
ENSBTAP00000056088  ..............................................................................
ENSBTAP00000033794  ..............................................................................
ENSBTAP00000012786  ..............................................................................
ENSBTAP00000030018  ..............................................................................
ENSBTAP00000040233  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000024301  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000015611  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000000847  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000054975  ..............................................................................
ENSBTAP00000046639  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000053164  ..............................................................................
ENSBTAP00000016774  ..............................................................................
ENSBTAP00000022630  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000033974  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000005979  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000053746  ..............................................................................
ENSBTAP00000023221  ..............................................................................
ENSBTAP00000019429  ..............................................................................
ENSBTAP00000052019  ..............................................................................
ENSBTAP00000042244  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000018877  ..............................................................................
ENSBTAP00000053019  ..............................................................................
ENSBTAP00000003073  ..............................................................................
ENSBTAP00000012886  ..............................................................................
ENSBTAP00000044222  ..............................................................................
ENSBTAP00000028499  ..............................................................................
ENSBTAP00000047378  ..............................................................................
ENSBTAP00000009308  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000050406  ..............................................................................
ENSBTAP00000031879  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000001250  ..............................................................................
ENSBTAP00000026035  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000053194  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000033188  ..............................................................................
ENSBTAP00000053548  ..............................................................................
ENSBTAP00000011687  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000009115  ..............................................................................
ENSBTAP00000023873  ..............................................................................
ENSBTAP00000054471  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000025205  ..............................................................................
ENSBTAP00000047882  ..............................................................................
ENSBTAP00000001368  ..............................................................................
ENSBTAP00000029786  ..............................................................................
ENSBTAP00000028993  ..............................................................................
ENSBTAP00000023678  ..............................................................................
ENSBTAP00000034710  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000021074  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000007217  ..............................................................................
ENSBTAP00000029792  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000017319  ..............................................................................
ENSBTAP00000044100  ..............................................................................
ENSBTAP00000033594  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000055894  ..............................................................................
ENSBTAP00000015220  ..............................................................................
ENSBTAP00000033613  ..............................................................................
ENSBTAP00000056320  ..............................................................................
ENSBTAP00000025249  ..............................................................................
ENSBTAP00000029159  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000017662  ..............................................................................
ENSBTAP00000012479  ..............................................................................
ENSBTAP00000029886  ..............................................................................
ENSBTAP00000027388  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000023673  ..............................................................................
ENSBTAP00000041488  ..............................................................................
ENSBTAP00000001452  ..............................................................................
ENSBTAP00000028498  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000020240  ..............................................................................
ENSBTAP00000053650  ..............................................................................
ENSBTAP00000041651  ..............................................................................
ENSBTAP00000005154  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000022068  ..............................................................................
ENSBTAP00000026682  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000027954  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000013601  ..............................................................................
ENSBTAP00000005477  ..............................................................................
ENSBTAP00000055305  ..............................................................................
ENSBTAP00000036054  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000002717  ..............................................................................
ENSBTAP00000036015  ..............................................................................
ENSBTAP00000051638  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000016306  ..............................................................................
ENSBTAP00000013714  ..............................................................................
ENSBTAP00000036550  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000023383  ..............................................................................
ENSBTAP00000027030  ..............................................................................
ENSBTAP00000053270  ..............................................................................
ENSBTAP00000054640  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000009967  ..............................................................................
ENSBTAP00000015183  ..............................................................................
ENSBTAP00000014222  ..............................................................................
ENSBTAP00000026288  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000009228  ..............................................................................
ENSBTAP00000026785  ..............................................................................
ENSBTAP00000002578  ..............................................................................
ENSBTAP00000000106  ..............................................................................
ENSBTAP00000028840  ..............................................................................
ENSBTAP00000053594  ..............................................................................
ENSBTAP00000055414  ittegqhegsttgqgshgksteeqgsrresqsdqgqpretmaeqeahresqsdqgphggetileeqqdtdltsqsrkg
ENSBTAP00000026698  ..............................................................................
ENSBTAP00000017015  ..............................................................................
ENSBTAP00000049908  ..............................................................................
ENSBTAP00000021395  ..............................................................................
ENSBTAP00000007194  ..............................................................................
ENSBTAP00000025455  ..............................................................................


                                                                                                    
                                                                                                    
d1bjfa_               ..............................................................................
ENSBTAP00000019411  ..............................................................................
ENSBTAP00000036057  ..............................................................................
ENSBTAP00000038404  ..............................................................................
ENSBTAP00000010971  ..............................................................................
ENSBTAP00000019803  ..............................................................................
ENSBTAP00000014038  ..............................................................................
ENSBTAP00000002055  ..............................................................................
ENSBTAP00000049731  ..............................................................................
ENSBTAP00000005577  ..............................................................................
ENSBTAP00000034949  ..............................................................................
ENSBTAP00000017447  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000046644  ..............................................................................
ENSBTAP00000022814  ..............................................................................
ENSBTAP00000019758  ..............................................................................
ENSBTAP00000019321  ..............................................................................
ENSBTAP00000011677  ..............................................................................
ENSBTAP00000011680  ..............................................................................
ENSBTAP00000021742  ..............................................................................
ENSBTAP00000005348  ..............................................................................
ENSBTAP00000016609  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000018403  ..............................................................................
ENSBTAP00000026407  ..............................................................................
ENSBTAP00000052557  ..............................................................................
ENSBTAP00000054167  ..............................................................................
ENSBTAP00000010319  ..............................................................................
ENSBTAP00000041545  ..............................................................................
ENSBTAP00000055204  ..............................................................................
ENSBTAP00000003718  ..............................................................................
ENSBTAP00000011676  ..............................................................................
ENSBTAP00000049395  ..............................................................................
ENSBTAP00000054983  ..............................................................................
ENSBTAP00000052219  ..............................................................................
ENSBTAP00000025402  ..............................................................................
ENSBTAP00000011678  ..............................................................................
ENSBTAP00000000433  ..............................................................................
ENSBTAP00000021491  ..............................................................................
ENSBTAP00000044733  ..............................................................................
ENSBTAP00000010937  ..............................................................................
ENSBTAP00000056439  ..............................................................................
ENSBTAP00000055780  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000034705  ..............................................................................
ENSBTAP00000035936  ..............................................................................
ENSBTAP00000013699  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000011496  ..............................................................................
ENSBTAP00000019111  ..............................................................................
ENSBTAP00000017036  ..............................................................................
ENSBTAP00000003213  ..............................................................................
ENSBTAP00000055444  ..............................................................................
ENSBTAP00000024550  ..............................................................................
ENSBTAP00000015248  ..............................................................................
ENSBTAP00000021328  ..............................................................................
ENSBTAP00000037091  ..............................................................................
ENSBTAP00000029967  ..............................................................................
ENSBTAP00000021449  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000042361  ..............................................................................
ENSBTAP00000016509  ..............................................................................
ENSBTAP00000026714  ..............................................................................
ENSBTAP00000004690  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000013117  ..............................................................................
ENSBTAP00000017574  ..............................................................................
ENSBTAP00000004885  ..............................................................................
ENSBTAP00000008961  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000006283  ..............................................................................
ENSBTAP00000014306  ..............................................................................
ENSBTAP00000053252  ..............................................................................
ENSBTAP00000014304  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000041264  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000017358  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000055296  ..............................................................................
ENSBTAP00000016852  ..............................................................................
ENSBTAP00000036380  ..............................................................................
ENSBTAP00000041719  ..............................................................................
ENSBTAP00000049636  ..............................................................................
ENSBTAP00000024444  ..............................................................................
ENSBTAP00000004556  ..............................................................................
ENSBTAP00000038767  ..............................................................................
ENSBTAP00000031285  ..............................................................................
ENSBTAP00000011457  ..............................................................................
ENSBTAP00000011047  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000037104  ..............................................................................
ENSBTAP00000002672  ..............................................................................
ENSBTAP00000028269  ..............................................................................
ENSBTAP00000016647  ..............................................................................
ENSBTAP00000004536  ..............................................................................
ENSBTAP00000042177  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000050283  ..............................................................................
ENSBTAP00000048539  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000007972  ..............................................................................
ENSBTAP00000040815  ..............................................................................
ENSBTAP00000025661  ..............................................................................
ENSBTAP00000028350  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000021537  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000039155  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000016315  ..............................................................................
ENSBTAP00000021091  ..............................................................................
ENSBTAP00000021618  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000034078  ..............................................................................
ENSBTAP00000006645  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000015802  ..............................................................................
ENSBTAP00000032680  ..............................................................................
ENSBTAP00000055007  ..............................................................................
ENSBTAP00000020148  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000012557  ..............................................................................
ENSBTAP00000011888  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000021603  ..............................................................................
ENSBTAP00000010838  ..............................................................................
ENSBTAP00000014575  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000053698  ..............................................................................
ENSBTAP00000006806  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000044105  ..............................................................................
ENSBTAP00000026904  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000044226  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000042182  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000006275  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000004963  ..............................................................................
ENSBTAP00000023774  ..............................................................................
ENSBTAP00000020395  ..............................................................................
ENSBTAP00000020150  ..............................................................................
ENSBTAP00000025561  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000034009  ..............................................................................
ENSBTAP00000020539  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000017461  ..............................................................................
ENSBTAP00000044096  ..............................................................................
ENSBTAP00000008523  ..............................................................................
ENSBTAP00000035196  ..............................................................................
ENSBTAP00000041997  ..............................................................................
ENSBTAP00000025499  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000002174  ..............................................................................
ENSBTAP00000000589  ..............................................................................
ENSBTAP00000028239  ..............................................................................
ENSBTAP00000014894  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000041966  ..............................................................................
ENSBTAP00000008933  ..............................................................................
ENSBTAP00000056088  ..............................................................................
ENSBTAP00000033794  ..............................................................................
ENSBTAP00000012786  ..............................................................................
ENSBTAP00000030018  ..............................................................................
ENSBTAP00000040233  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000024301  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000015611  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000000847  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000054975  ..............................................................................
ENSBTAP00000046639  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000053164  ..............................................................................
ENSBTAP00000016774  ..............................................................................
ENSBTAP00000022630  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000033974  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000005979  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000053746  ..............................................................................
ENSBTAP00000023221  ..............................................................................
ENSBTAP00000019429  ..............................................................................
ENSBTAP00000052019  ..............................................................................
ENSBTAP00000042244  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000018877  ..............................................................................
ENSBTAP00000053019  ..............................................................................
ENSBTAP00000003073  ..............................................................................
ENSBTAP00000012886  ..............................................................................
ENSBTAP00000044222  ..............................................................................
ENSBTAP00000028499  ..............................................................................
ENSBTAP00000047378  ..............................................................................
ENSBTAP00000009308  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000050406  ..............................................................................
ENSBTAP00000031879  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000001250  ..............................................................................
ENSBTAP00000026035  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000053194  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000033188  ..............................................................................
ENSBTAP00000053548  ..............................................................................
ENSBTAP00000011687  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000009115  ..............................................................................
ENSBTAP00000023873  ..............................................................................
ENSBTAP00000054471  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000025205  ..............................................................................
ENSBTAP00000047882  ..............................................................................
ENSBTAP00000001368  ..............................................................................
ENSBTAP00000029786  ..............................................................................
ENSBTAP00000028993  ..............................................................................
ENSBTAP00000023678  ..............................................................................
ENSBTAP00000034710  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000021074  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000007217  ..............................................................................
ENSBTAP00000029792  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000017319  ..............................................................................
ENSBTAP00000044100  ..............................................................................
ENSBTAP00000033594  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000055894  ..............................................................................
ENSBTAP00000015220  ..............................................................................
ENSBTAP00000033613  ..............................................................................
ENSBTAP00000056320  ..............................................................................
ENSBTAP00000025249  ..............................................................................
ENSBTAP00000029159  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000017662  ..............................................................................
ENSBTAP00000012479  ..............................................................................
ENSBTAP00000029886  ..............................................................................
ENSBTAP00000027388  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000023673  ..............................................................................
ENSBTAP00000041488  ..............................................................................
ENSBTAP00000001452  ..............................................................................
ENSBTAP00000028498  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000020240  ..............................................................................
ENSBTAP00000053650  ..............................................................................
ENSBTAP00000041651  ..............................................................................
ENSBTAP00000005154  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000022068  ..............................................................................
ENSBTAP00000026682  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000027954  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000013601  ..............................................................................
ENSBTAP00000005477  ..............................................................................
ENSBTAP00000055305  ..............................................................................
ENSBTAP00000036054  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000002717  ..............................................................................
ENSBTAP00000036015  ..............................................................................
ENSBTAP00000051638  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000016306  ..............................................................................
ENSBTAP00000013714  ..............................................................................
ENSBTAP00000036550  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000023383  ..............................................................................
ENSBTAP00000027030  ..............................................................................
ENSBTAP00000053270  ..............................................................................
ENSBTAP00000054640  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000009967  ..............................................................................
ENSBTAP00000015183  ..............................................................................
ENSBTAP00000014222  ..............................................................................
ENSBTAP00000026288  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000009228  ..............................................................................
ENSBTAP00000026785  ..............................................................................
ENSBTAP00000002578  ..............................................................................
ENSBTAP00000000106  ..............................................................................
ENSBTAP00000028840  ..............................................................................
ENSBTAP00000053594  ..............................................................................
ENSBTAP00000055414  sltgesktsresisfehteippqegrtqahayeellfvspelqaktgvsipedhlsepakkevqkdkscepksqkieg
ENSBTAP00000026698  ..............................................................................
ENSBTAP00000017015  ..............................................................................
ENSBTAP00000049908  ..............................................................................
ENSBTAP00000021395  ..............................................................................
ENSBTAP00000007194  ..............................................................................
ENSBTAP00000025455  ..............................................................................


                                                                                                    
                                                                                                    
d1bjfa_               ..............................................................................
ENSBTAP00000019411  ..............................................................................
ENSBTAP00000036057  ..............................................................................
ENSBTAP00000038404  ..............................................................................
ENSBTAP00000010971  ..............................................................................
ENSBTAP00000019803  ..............................................................................
ENSBTAP00000014038  ..............................................................................
ENSBTAP00000002055  ..............................................................................
ENSBTAP00000049731  ..............................................................................
ENSBTAP00000005577  ..............................................................................
ENSBTAP00000034949  ..............................................................................
ENSBTAP00000017447  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000046644  ..............................................................................
ENSBTAP00000022814  ..............................................................................
ENSBTAP00000019758  ..............................................................................
ENSBTAP00000019321  ..............................................................................
ENSBTAP00000011677  ..............................................................................
ENSBTAP00000011680  ..............................................................................
ENSBTAP00000021742  ..............................................................................
ENSBTAP00000005348  ..............................................................................
ENSBTAP00000016609  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000018403  ..............................................................................
ENSBTAP00000026407  ..............................................................................
ENSBTAP00000052557  ..............................................................................
ENSBTAP00000054167  ..............................................................................
ENSBTAP00000010319  ..............................................................................
ENSBTAP00000041545  ..............................................................................
ENSBTAP00000055204  ..............................................................................
ENSBTAP00000003718  ..............................................................................
ENSBTAP00000011676  ..............................................................................
ENSBTAP00000049395  ..............................................................................
ENSBTAP00000054983  ..............................................................................
ENSBTAP00000052219  ..............................................................................
ENSBTAP00000025402  ..............................................................................
ENSBTAP00000011678  ..............................................................................
ENSBTAP00000000433  ..............................................................................
ENSBTAP00000021491  ..............................................................................
ENSBTAP00000044733  ..............................................................................
ENSBTAP00000010937  ..............................................................................
ENSBTAP00000056439  ..............................................................................
ENSBTAP00000055780  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000034705  ..............................................................................
ENSBTAP00000035936  ..............................................................................
ENSBTAP00000013699  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000011496  ..............................................................................
ENSBTAP00000019111  ..............................................................................
ENSBTAP00000017036  ..............................................................................
ENSBTAP00000003213  ..............................................................................
ENSBTAP00000055444  ..............................................................................
ENSBTAP00000024550  ..............................................................................
ENSBTAP00000015248  ..............................................................................
ENSBTAP00000021328  ..............................................................................
ENSBTAP00000037091  ..............................................................................
ENSBTAP00000029967  ..............................................................................
ENSBTAP00000021449  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000042361  ..............................................................................
ENSBTAP00000016509  ..............................................................................
ENSBTAP00000026714  ..............................................................................
ENSBTAP00000004690  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000013117  ..............................................................................
ENSBTAP00000017574  ..............................................................................
ENSBTAP00000004885  ..............................................................................
ENSBTAP00000008961  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000006283  ..............................................................................
ENSBTAP00000014306  ..............................................................................
ENSBTAP00000053252  ..............................................................................
ENSBTAP00000014304  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000041264  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000017358  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000055296  ..............................................................................
ENSBTAP00000016852  ..............................................................................
ENSBTAP00000036380  ..............................................................................
ENSBTAP00000041719  ..............................................................................
ENSBTAP00000049636  ..............................................................................
ENSBTAP00000024444  ..............................................................................
ENSBTAP00000004556  ..............................................................................
ENSBTAP00000038767  ..............................................................................
ENSBTAP00000031285  ..............................................................................
ENSBTAP00000011457  ..............................................................................
ENSBTAP00000011047  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000037104  ..............................................................................
ENSBTAP00000002672  ..............................................................................
ENSBTAP00000028269  ..............................................................................
ENSBTAP00000016647  ..............................................................................
ENSBTAP00000004536  ..............................................................................
ENSBTAP00000042177  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000050283  ..............................................................................
ENSBTAP00000048539  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000007972  ..............................................................................
ENSBTAP00000040815  ..............................................................................
ENSBTAP00000025661  ..............................................................................
ENSBTAP00000028350  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000021537  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000039155  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000016315  ..............................................................................
ENSBTAP00000021091  ..............................................................................
ENSBTAP00000021618  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000034078  ..............................................................................
ENSBTAP00000006645  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000015802  ..............................................................................
ENSBTAP00000032680  ..............................................................................
ENSBTAP00000055007  ..............................................................................
ENSBTAP00000020148  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000012557  ..............................................................................
ENSBTAP00000011888  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000021603  ..............................................................................
ENSBTAP00000010838  ..............................................................................
ENSBTAP00000014575  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000053698  ..............................................................................
ENSBTAP00000006806  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000044105  ..............................................................................
ENSBTAP00000026904  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000044226  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000042182  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000006275  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000004963  ..............................................................................
ENSBTAP00000023774  ..............................................................................
ENSBTAP00000020395  ..............................................................................
ENSBTAP00000020150  ..............................................................................
ENSBTAP00000025561  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000034009  ..............................................................................
ENSBTAP00000020539  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000017461  ..............................................................................
ENSBTAP00000044096  ..............................................................................
ENSBTAP00000008523  ..............................................................................
ENSBTAP00000035196  ..............................................................................
ENSBTAP00000041997  ..............................................................................
ENSBTAP00000025499  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000002174  ..............................................................................
ENSBTAP00000000589  ..............................................................................
ENSBTAP00000028239  ..............................................................................
ENSBTAP00000014894  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000041966  ..............................................................................
ENSBTAP00000008933  ..............................................................................
ENSBTAP00000056088  ..............................................................................
ENSBTAP00000033794  ..............................................................................
ENSBTAP00000012786  ..............................................................................
ENSBTAP00000030018  ..............................................................................
ENSBTAP00000040233  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000024301  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000015611  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000000847  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000054975  ..............................................................................
ENSBTAP00000046639  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000053164  ..............................................................................
ENSBTAP00000016774  ..............................................................................
ENSBTAP00000022630  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000033974  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000005979  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000053746  ..............................................................................
ENSBTAP00000023221  ..............................................................................
ENSBTAP00000019429  ..............................................................................
ENSBTAP00000052019  ..............................................................................
ENSBTAP00000042244  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000018877  ..............................................................................
ENSBTAP00000053019  ..............................................................................
ENSBTAP00000003073  ..............................................................................
ENSBTAP00000012886  ..............................................................................
ENSBTAP00000044222  ..............................................................................
ENSBTAP00000028499  ..............................................................................
ENSBTAP00000047378  ..............................................................................
ENSBTAP00000009308  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000050406  ..............................................................................
ENSBTAP00000031879  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000001250  ..............................................................................
ENSBTAP00000026035  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000053194  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000033188  ..............................................................................
ENSBTAP00000053548  ..............................................................................
ENSBTAP00000011687  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000009115  ..............................................................................
ENSBTAP00000023873  ..............................................................................
ENSBTAP00000054471  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000025205  ..............................................................................
ENSBTAP00000047882  ..............................................................................
ENSBTAP00000001368  ..............................................................................
ENSBTAP00000029786  ..............................................................................
ENSBTAP00000028993  ..............................................................................
ENSBTAP00000023678  ..............................................................................
ENSBTAP00000034710  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000021074  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000007217  ..............................................................................
ENSBTAP00000029792  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000017319  ..............................................................................
ENSBTAP00000044100  ..............................................................................
ENSBTAP00000033594  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000055894  ..............................................................................
ENSBTAP00000015220  ..............................................................................
ENSBTAP00000033613  ..............................................................................
ENSBTAP00000056320  ..............................................................................
ENSBTAP00000025249  ..............................................................................
ENSBTAP00000029159  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000017662  ..............................................................................
ENSBTAP00000012479  ..............................................................................
ENSBTAP00000029886  ..............................................................................
ENSBTAP00000027388  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000023673  ..............................................................................
ENSBTAP00000041488  ..............................................................................
ENSBTAP00000001452  ..............................................................................
ENSBTAP00000028498  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000020240  ..............................................................................
ENSBTAP00000053650  ..............................................................................
ENSBTAP00000041651  ..............................................................................
ENSBTAP00000005154  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000022068  ..............................................................................
ENSBTAP00000026682  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000027954  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000013601  ..............................................................................
ENSBTAP00000005477  ..............................................................................
ENSBTAP00000055305  ..............................................................................
ENSBTAP00000036054  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000002717  ..............................................................................
ENSBTAP00000036015  ..............................................................................
ENSBTAP00000051638  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000016306  ..............................................................................
ENSBTAP00000013714  ..............................................................................
ENSBTAP00000036550  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000023383  ..............................................................................
ENSBTAP00000027030  ..............................................................................
ENSBTAP00000053270  ..............................................................................
ENSBTAP00000054640  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000009967  ..............................................................................
ENSBTAP00000015183  ..............................................................................
ENSBTAP00000014222  ..............................................................................
ENSBTAP00000026288  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000009228  ..............................................................................
ENSBTAP00000026785  ..............................................................................
ENSBTAP00000002578  ..............................................................................
ENSBTAP00000000106  ..............................................................................
ENSBTAP00000028840  ..............................................................................
ENSBTAP00000053594  ..............................................................................
ENSBTAP00000055414  kswtgelltcnwnmkyakhedeeqahliydnsrftdlhsiirniqsykeikgrstfngvsvnllqfvqlletfvgeds
ENSBTAP00000026698  ..............................................................................
ENSBTAP00000017015  ..............................................................................
ENSBTAP00000049908  ..............................................................................
ENSBTAP00000021395  ..............................................................................
ENSBTAP00000007194  ..............................................................................
ENSBTAP00000025455  ..............................................................................


                                                                    90                              
                                                                     |                              
d1bjfa_               ..............................LS............VTSRG....KL..................EQKL.
ENSBTAP00000019411  ..............................MA............RKMKDt...DS..................EEEI.
ENSBTAP00000036057  ..............................MA............RKMKDt...DS..................EEEI.
ENSBTAP00000038404  ..............................LS............VTSRG....KL..................EQKL.
ENSBTAP00000010971  ..............................LS............VTSRG....RL..................EQKL.
ENSBTAP00000019803  ..............................WN............NIKK-....--..................---W.
ENSBTAP00000014038  ..............................VS............QFSVKg...DK..................EQKL.
ENSBTAP00000002055  ..............................MA............RKMKDt...DS..................EEEI.
ENSBTAP00000049731  ..............................MA............RKMKDt...DS..................EEEI.
ENSBTAP00000005577  ..............................LS............VTSRG....KL..................EQKL.
ENSBTAP00000034949  ..............................LH............MTSAG....KT..................NQKL.
ENSBTAP00000017447  ..............................TQ............KICP-....--..................RTDI.
ENSBTAP00000010858  ..............................II............SLCK-....--..................----.
ENSBTAP00000046644  ..............................VYr...........VFLNNl...CP..................RPEI.
ENSBTAP00000022814  ..............................LS............ITSRG....SF..................EQKL.
ENSBTAP00000019758  ..............................FG............IKE--....--..................----.
ENSBTAP00000019321  ..............................LS............VTSRG....SF..................EQKL.
ENSBTAP00000011677  ..............................WK............KIKT-....--..................---W.
ENSBTAP00000011680  ..............................WK............KIKT-....--..................---W.
ENSBTAP00000021742  ..............................LS............VILRG....TT..................DDRL.
ENSBTAP00000005348  ..............................--............-----....--..................---V.
ENSBTAP00000016609  ..............................FE............RFLNKl...CL..................RPDI.
ENSBTAP00000012740  ..............................LI............ALSK-....--..................----.
ENSBTAP00000018403  ..............................MA............AGLQT....SD..................TEGL.
ENSBTAP00000026407  ..............................LE............ELAP-....--..................----.
ENSBTAP00000052557  ..............................MT............QKMAEk...DT..................KEEI.
ENSBTAP00000054167  ..............................LS............ILLRG....TV..................QEKL.
ENSBTAP00000010319  ..............................MT............QKMSEk...DT..................KEEI.
ENSBTAP00000041545  ..............................YK............SLTQ-....--..................RPEV.
ENSBTAP00000055204  ..............................WK............YITD-....--..................---W.
ENSBTAP00000003718  ..............................LS............ILLRG....TV..................HEKL.
ENSBTAP00000011676  ..............................WL............KIRK-....--..................---Y.
ENSBTAP00000049395  ..............................YK............ILTQRk...EI..................DRTF.
ENSBTAP00000054983  ..............................LE............ELAKK....RF..................KDK-.
ENSBTAP00000052219  ..............................WA............VLNG-....--..................---W.
ENSBTAP00000025402  ..............................VYks..........FLMSL....CP..................RPEI.
ENSBTAP00000011678  ..............................WN............RIRN-....--..................---Y.
ENSBTAP00000000433  ..............................MKelgqk.......RFKGK....SP..................DEAL.
ENSBTAP00000021491  ..............................MS............VKMSEk...DE..................KEEI.
ENSBTAP00000044733  ..............................WT............KIQK-....--..................---Y.
ENSBTAP00000010937  ..............................YK............MMSL-....--..................RRDL.
ENSBTAP00000056439  ..............................YK............MMSL-....--..................RRDL.
ENSBTAP00000055780  ..............................MV............RCMKDdskgKS..................EEEL.
ENSBTAP00000038002  ..............................FS............LLEGG....RP..................EDKL.
ENSBTAP00000034705  ..............................LR............RLLK-....--..................RPEL.
ENSBTAP00000035936  ..............................LN............LVLRG....TL..................EHKL.
ENSBTAP00000013699  ..............................WK............FIQQ-....--..................---W.
ENSBTAP00000002564  ..............................IA............C----....--..................----.
ENSBTAP00000011496  ..............................LS............VTSRG....TL..................DEKL.
ENSBTAP00000019111  ..............................VTd...........WILER....DP..................HEEI.
ENSBTAP00000017036  ..............................LS............LVLKG....KV..................EQKL.
ENSBTAP00000003213  ..............................YK............MMST-....--..................RRDL.
ENSBTAP00000055444  ..............................YK............MMST-....--..................RRDL.
ENSBTAP00000024550  ..............................WA............ALNS-....--..................---W.
ENSBTAP00000015248  ..............................FG............EKLNGt...DP..................EDVI.
ENSBTAP00000021328  ..............................FG............EKLNGt...DP..................EDVI.
ENSBTAP00000037091  ..............................FG............EKLNGt...DP..................EDVI.
ENSBTAP00000029967  ..............................MG............PKLLA....ETadmig.............VREL.
ENSBTAP00000021449  ..............................MT............PKLLA....ETagmig.............VQEM.
ENSBTAP00000053176  ..............................LS............LLERG....RP..................EDKL.
ENSBTAP00000042361  ..............................MG............PKLLA....ETadmig.............VKEL.
ENSBTAP00000016509  ..............................LN............LVLRG....TL..................EHKL.
ENSBTAP00000026714  ..............................MG............PKLLA....ETadmig.............VKEL.
ENSBTAP00000004690  ..............................WR............KIKK-....--..................---W.
ENSBTAP00000010858  ..............................--............-----....-L..................EDKY.
ENSBTAP00000013117  ..............................FH............ELCT-....--..................RPEI.
ENSBTAP00000017574  ..............................YR............IITY-....--..................REEI.
ENSBTAP00000004885  ..............................LK............DHE--....--..................-KKM.
ENSBTAP00000008961  ..............................TR............LFQP-....--..................----.
ENSBTAP00000028063  ..............................LA............TMCG-....--..................----.
ENSBTAP00000012740  ..............................--............-----....--..................----.
ENSBTAP00000006283  ..............................MG............PKLRE....ETahmlg.............LREL.
ENSBTAP00000014306  ..............................LQ............TVAKNkdq.GT..................YEDY.
ENSBTAP00000053252  ..............................FC............ELCT-....--..................RPEV.
ENSBTAP00000014304  ..............................LQ............TVAKNkdq.GT..................YEDY.
ENSBTAP00000045669  ..............................LA............TLCG-....--..................----.
ENSBTAP00000041264  ..............................TR............LFQP-....--..................----.
ENSBTAP00000006711  ..............................--............-----....--..................----.
ENSBTAP00000017358  ..............................TR............LFQP-....--..................----.
ENSBTAP00000053274  ..............................LA............TLCG-....--..................----.
ENSBTAP00000055296  ..............................TR............LFQP-....--..................----.
ENSBTAP00000016852  ..............................LR............PPMSR....AR..................KEVI.
ENSBTAP00000036380  ..............................MH............MQIKQe...DP..................KKEI.
ENSBTAP00000041719  ..............................LQ............AVAKLpdr.GS..................YQDY.
ENSBTAP00000049636  ..............................LQ............AISNNkdq.GT..................YEDF.
ENSBTAP00000024444  ..............................FG............EKLKGa...DP..................EETI.
ENSBTAP00000004556  ..............................QG............RFDTSilp.IC..................KDSL.
ENSBTAP00000038767  ..............................LA............HFRPI....EDnekskdvngpeplnsr..SNKL.
ENSBTAP00000031285  ..............................--............--LGA....SC..................KDSI.
ENSBTAP00000011457  ..............................LS............VFLRG....TL..................EEKM.
ENSBTAP00000011047  ..............................LQ............HISKNkdt.GT..................YEDF.
ENSBTAP00000002564  ..............................--............-----....--..................----.
ENSBTAP00000037104  ..............................FG............EKLKGt...DP..................EETI.
ENSBTAP00000002672  ..............................FG............EKLNGt...DP..................EEAI.
ENSBTAP00000028269  ..............................FG............EKLKGa...DP..................EDVI.
ENSBTAP00000016647  ..............................LA............HFRPV....DEeddgnrdpkepeplnsr.MNKL.
ENSBTAP00000004536  ..............................LQ............ER---....--..................EQRL.
ENSBTAP00000042177  ..............................--............-----....-E..................ERVV.
ENSBTAP00000028063  ..............................--............-----....--..................LDKL.
ENSBTAP00000050283  ..............................LQ............HISRNkeq.GT..................YEDF.
ENSBTAP00000048539  ..............................LT............VLCNPv...NT..................EKIL.
ENSBTAP00000045669  ..............................--............-----....-I..................MDKL.
ENSBTAP00000007972  ..............................LR............PPMSQ....AR..................EAVV.
ENSBTAP00000040815  ..............................L-............-----....--..................----.
ENSBTAP00000025661  ..............................LA............VLCNPa...NT..................EEII.
ENSBTAP00000028350  ..............................LS............VFSDTa...TP..................DIKS.
ENSBTAP00000053274  ..............................--............-----....-I..................MDKL.
ENSBTAP00000021537  ..............................FS............VMSEMa...PR..................DLKA.
ENSBTAP00000055481  ..............................--............----Q....SS..................RLKY.
ENSBTAP00000039155  ..............................MA............WKVKAg...DS..................EDHI.
ENSBTAP00000029333  ..............................--............----Q....SS..................RLKY.
ENSBTAP00000016315  ..............................FH............LIVA-....--..................----.
ENSBTAP00000021091  ..............................WK............QLMF-....--..................---Y.
ENSBTAP00000021618  ..............................LV............VFMKG....SP..................EEKS.
ENSBTAP00000055520  ..............................--............-----....-S..................ELTL.
ENSBTAP00000055624  ..............................--............-----....-S..................ELTL.
ENSBTAP00000016319  ..............................FH............LVVA-....--..................----.
ENSBTAP00000034078  ..............................MTevlle.......RRYRP....IP..................EDIL.
ENSBTAP00000006645  ..............................AS............VFSEQa...CP..................SLKI.
ENSBTAP00000021909  ..............................MY............SHDGN....AD..................EPEWv
ENSBTAP00000001426  ..............................LP............TEENF....LLcfrqhvgs..........STEF.
ENSBTAP00000015802  ..............................LQ............DH---....--..................EKKL.
ENSBTAP00000032680  ..............................LQ............DH---....--..................EKKL.
ENSBTAP00000055007  ..............................MV............RQMKEdakgKT..................EEEL.
ENSBTAP00000020148  ..............................IG............GL---....--..................----.
ENSBTAP00000052345  ..............................--............-----....-E..................KAKY.
ENSBTAP00000029334  ..............................--............-----....PS..................RLKY.
ENSBTAP00000052345  ..............................MF............L----....--..................----.
ENSBTAP00000056127  ..............................MF............SHEES....GP..................EPDWv
ENSBTAP00000012557  ..............................VH............-----....-IqkpvkevqsslietvyryRSDL.
ENSBTAP00000011888  ..............................LT............LLIHG....SP..................MDKL.
ENSBTAP00000017060  ..............................MH............LVYRA....--..................----.
ENSBTAP00000031854  ..............................LI............SEEDK....RN..................PTSI.
ENSBTAP00000031823  ..............................LY............TAEPG....EE..................EPAWv
ENSBTAP00000021603  ..............................LV............VFMKG....SP..................EDKS.
ENSBTAP00000010838  ..............................LA............DIAT-....--..................----.
ENSBTAP00000014575  ..............................FS............VLCESa...PR..................ELKA.
ENSBTAP00000011215  ..............................LI............SEEDK....RN..................PTSI.
ENSBTAP00000053698  ..............................LG............PKLVS....SEgrdgfl............GNTI.
ENSBTAP00000006806  ..............................VA............ALT--....--..................----.
ENSBTAP00000029334  ..............................MK............LIK--....--..................----.
ENSBTAP00000044105  ..............................LA............DIAT-....--..................----.
ENSBTAP00000026904  ..............................VA............ALT--....--..................----.
ENSBTAP00000017060  ..............................--............-----....--..................--RF.
ENSBTAP00000055520  ..............................--............-----....--..................----.
ENSBTAP00000044226  ..............................VA............ALT--....--..................----.
ENSBTAP00000055624  ..............................--............-----....--..................----.
ENSBTAP00000042182  ..............................WG............HLLE-....--..................---W.
ENSBTAP00000010796  ..............................L-............-----....-Lriqpkivhc.........WRPM.
ENSBTAP00000021174  ..............................LPteenflllf...RCQQL....KS..................CEEF.
ENSBTAP00000006275  ..............................VA............MITT-....--..................----.
ENSBTAP00000020950  ..............................YR............RDPTA....SE..................DPEWi
ENSBTAP00000053738  ..............................L-............-----....-Lriqpkivhc.........WRPM.
ENSBTAP00000004963  ..............................LS............VFLRG....TF..................EEKL.
ENSBTAP00000023774  ..............................LG............PKLSTs...GI..................PEKFh
ENSBTAP00000020395  ..............................MI............SRETEnv..KS..................SEEI.
ENSBTAP00000020150  ..............................IA............GL---....--..................----.
ENSBTAP00000025561  ..............................LS............CIA--....--..................----.
ENSBTAP00000053738  ..............................YL............VTKAK....TR..................WSDL.
ENSBTAP00000034009  ..............................VS............RVLKT....--..................----.
ENSBTAP00000020539  ..............................S-............-----....-Slletlyrn..........RSNL.
ENSBTAP00000020778  ..............................PV............GTVENqqgqDVddswv.............RDRK.
ENSBTAP00000017461  ..............................VR............KKKEAq...LY..................RNEV.
ENSBTAP00000044096  ..............................VA............RLTVA....SH..................EE--.
ENSBTAP00000008523  ..............................VA............RLTVA....SH..................EE--.
ENSBTAP00000035196  ..............................HT............LFIQR....GR..................HETT.
ENSBTAP00000041997  ..............................NH............-----....--..................----.
ENSBTAP00000025499  ..............................VG............LKK--....KS..................PEDV.
ENSBTAP00000055481  ..............................MK............LIK--....--..................----.
ENSBTAP00000002174  ..............................NH............-----....--..................----.
ENSBTAP00000000589  ..............................LA............LIT--....--..................----.
ENSBTAP00000028239  ..............................SH............L----....--..................----.
ENSBTAP00000014894  ..............................MS............RETTDt...DT..................ADQV.
ENSBTAP00000026544  ..............................LAlqenfllqfkmdACSSE....ER..................KRDF.
ENSBTAP00000029333  ..............................MK............LIK--....--..................----.
ENSBTAP00000041966  ..............................WS............RLVH-....--..................---C.
ENSBTAP00000008933  ..............................--............-----....--..................----.
ENSBTAP00000056088  ..............................VS............RVLK-....--..................----.
ENSBTAP00000033794  ..............................LG............KLVKD....YH..................LQYH.
ENSBTAP00000012786  ..............................MT............RETADt...DT..................AEQV.
ENSBTAP00000030018  ..............................MT............RETAEt...DT..................AEQV.
ENSBTAP00000040233  ..............................FK............N----....--..................IKTV.
ENSBTAP00000003365  ..............................LR............KEKP-....TS..................KAEL.
ENSBTAP00000053176  ..............................LS............LLERG....RP..................EDKL.
ENSBTAP00000024301  ..............................MS............RETADt...DT..................ADQV.
ENSBTAP00000022292  ..............................ES............VLCA-....-P..................DSMF.
ENSBTAP00000015611  ..............................VF............KL---....--..................----.
ENSBTAP00000012770  ..............................VL............ALENR....KE..................PAAL.
ENSBTAP00000000847  ..............................LT............TLC--....--..................----.
ENSBTAP00000053738  ..............................FK............N----....--..................IKTV.
ENSBTAP00000054975  ..............................--............-----....--..................ASQV.
ENSBTAP00000046639  ..............................II............GEMNE....YR..................KSFV.
ENSBTAP00000052345  ..............................LR............L----....--..................----.
ENSBTAP00000053164  ..............................--............-----....-N..................FDTL.
ENSBTAP00000016774  ..............................VI............K----....--..................----.
ENSBTAP00000022630  ..............................V-............-----....--..................----.
ENSBTAP00000010796  ..............................LA............RLHKAvt..SH..................YHAI.
ENSBTAP00000021909  ..............................IK............HAQKK....YI..................YDNV.
ENSBTAP00000033974  ..............................MG............LYWEKaq..NQ..................EGEL.
ENSBTAP00000006711  ..............................LS............LLESG....RP..................QDKL.
ENSBTAP00000010796  ..............................M-............-----....-Pardklkdh..........DQDI.
ENSBTAP00000004912  ..............................ES............VLCA-....-P..................DALF.
ENSBTAP00000005979  ..............................CS............AELNH....RG..................YQFV.
ENSBTAP00000053738  ..............................LA............RLHKAvt..SH..................YHAI.
ENSBTAP00000053746  ..............................MS............YFRPI....DTtmdeeqvqlcr.......KEKL.
ENSBTAP00000023221  ..............................--............-----....--..................--DP.
ENSBTAP00000019429  ..............................FH............-----....--..................----.
ENSBTAP00000052019  ..............................VF............QLA--....--..................----.
ENSBTAP00000042244  ..............................FR............KAAA-....--..................----.
ENSBTAP00000053738  ..............................L-............-----....--..................-SAF.
ENSBTAP00000018877  ..............................IG............G----....--..................----.
ENSBTAP00000053019  ..............................MQ............ELKSK....DI..................SKTF.
ENSBTAP00000003073  ..............................--............-----....--..................---P.
ENSBTAP00000012886  ..............................MS............AIQK-....--..................----.
ENSBTAP00000044222  ..............................LA............CLC--....--..................----.
ENSBTAP00000028499  ..............................IG............ELAK-....--..................----.
ENSBTAP00000047378  ..............................PR............SHSFD....TP..................ETRV.
ENSBTAP00000009308  ..............................--............-----....--..................-LEL.
ENSBTAP00000017060  ..............................LR............-----....--..................----.
ENSBTAP00000050406  ..............................FQ............EVKSS....DI..................AKTF.
ENSBTAP00000031879  ..............................FQ............EVKSS....DI..................AKTF.
ENSBTAP00000031854  ..............................WR............KLLSN....HH..................DDAS.
ENSBTAP00000001250  ..............................LS............VVCRPa...RT..................LDTI.
ENSBTAP00000026035  ..............................VF............KVAQ-....--..................----.
ENSBTAP00000011215  ..............................WR............KLLSN....HH..................DDAS.
ENSBTAP00000002128  ..............................VS............KEQNL....PE..................YDVL.
ENSBTAP00000053194  ..............................LT............DKESEni..RS..................SDEL.
ENSBTAP00000056127  ..............................IK............RVQKR....YI..................YDNV.
ENSBTAP00000033188  ..............................IL............ASKFP....TT..................KLEM.
ENSBTAP00000053548  ..............................IL............SSKFP....TS..................RLEM.
ENSBTAP00000011687  ..............................VC............ILLAQen..HL..................EEQFi
ENSBTAP00000007636  ..............................TT............VLST-....-P..................QRNF.
ENSBTAP00000020950  ..............................IQ............MSFKH....YA..................MQEA.
ENSBTAP00000009115  ..............................--............-----....--..................----.
ENSBTAP00000023873  ..............................--............-----....--..................----.
ENSBTAP00000054471  ..............................--............-----....--..................--RA.
ENSBTAP00000039694  ..............................FQ............FLNN-....--..................LEDF.
ENSBTAP00000025205  ..............................--............-----....--..................--RA.
ENSBTAP00000047882  ..............................--............-----....-P..................QELQ.
ENSBTAP00000001368  ..............................RG............NFP--....--..................---Y.
ENSBTAP00000029786  ..............................LS............AACHG....DL..................TEKL.
ENSBTAP00000028993  ..............................--............-----....--..................----.
ENSBTAP00000023678  ..............................IQ............KQLKDr...PC..................RDNI.
ENSBTAP00000034710  ..............................--............-----....--..................--AF.
ENSBTAP00000031823  ..............................IA............HTQQR....HI..................RDSV.
ENSBTAP00000038002  ..............................FS............LLEGG....RP..................EDKL.
ENSBTAP00000021074  ..............................IF............SFLN-....--..................----.
ENSBTAP00000026544  ..............................FLsedenflllfr.QETPL....DS..................SVEF.
ENSBTAP00000007217  ..............................MG............TMQI-....--..................--SP.
ENSBTAP00000029792  ..............................MS............GMYHG....DL..................TEKL.
ENSBTAP00000044088  ..............................LT............ILTK-....-P..................HSGF.
ENSBTAP00000017319  ..............................LL............S----....--..................----.
ENSBTAP00000044100  ..............................AA............NFP--....--..................---F.
ENSBTAP00000033594  ..............................NI............DLLEI....RN..................GPRS.
ENSBTAP00000026766  ..............................LS............ACCRG....PL..................AERQ.
ENSBTAP00000055894  ..............................M-............-----....--..................----.
ENSBTAP00000015220  ..............................IKaqvsegkg....RLLPGq...DP..................EKTI.
ENSBTAP00000033613  ..............................--............-----....--..................----.
ENSBTAP00000056320  ..............................LI............SEEDK....KT..................PTSI.
ENSBTAP00000025249  ..............................FK............SFSV-....RS..................RKDL.
ENSBTAP00000029159  ..............................AA............S----....--..................---F.
ENSBTAP00000044088  ..............................CH............FATH-....--..................LEDF.
ENSBTAP00000016319  ..............................L-............-----....--..................----.
ENSBTAP00000017662  ..............................--............--LTM....KQ..................EEAF.
ENSBTAP00000012479  ..............................LR............ATKAK....LN..................IEKL.
ENSBTAP00000029886  ..............................--............-----....--..................-EIL.
ENSBTAP00000027388  ..............................--............-----....--..................LEAF.
ENSBTAP00000039694  ..............................LC............ILTK-....-P..................HAGF.
ENSBTAP00000023673  ..............................--............-----....--..................-EQA.
ENSBTAP00000041488  ..............................--............-----....--..................-EQA.
ENSBTAP00000001452  ..............................--............-----....--..................----.
ENSBTAP00000028498  ..............................I-............-----....--..................----.
ENSBTAP00000001426  ..............................LPvqenfll.....KFQGMk...LT..................SEEF.
ENSBTAP00000020240  ..............................--............-----....--..................---S.
ENSBTAP00000053650  ..............................--............-----....--..................---S.
ENSBTAP00000041651  ..............................--............----M....SR..................EQVL.
ENSBTAP00000005154  ..............................FA............-----....--..................----.
ENSBTAP00000021174  ..............................--............-----....-C..................GKEF.
ENSBTAP00000022068  ..............................--............-----....--..................--RL.
ENSBTAP00000026682  ..............................LK............GKG--....HT..................DAEI.
ENSBTAP00000007636  ..............................FT............FLKNI....ND..................VDTA.
ENSBTAP00000027954  ..............................--............-----....--..................----.
ENSBTAP00000020778  ..............................--............-----....--..................----.
ENSBTAP00000013601  ..............................--............-----....--..................----.
ENSBTAP00000005477  ..............................YL............NHRPPfg..NT..................MSGI.
ENSBTAP00000055305  ..............................--............-----....--..................---S.
ENSBTAP00000036054  ..............................--............-----....--..................---S.
ENSBTAP00000004912  ..............................NS............LLNN-....--..................MELI.
ENSBTAP00000022292  ..............................LQ............ELQ--....--..................LEHA.
ENSBTAP00000002717  ..............................YK............KLMFEqqk.SI..................LDEF.
ENSBTAP00000036015  ..............................LN............KY---....--..................----.
ENSBTAP00000051638  ..............................ID............IMYNG....SF..................TEKL.
ENSBTAP00000026766  ..............................LV............LLTRG....RD..................EEKA.
ENSBTAP00000053738  ..............................--............----K....DH..................DQDI.
ENSBTAP00000016306  ..............................VS............VEED-....--..................-SRQ.
ENSBTAP00000013714  ..............................--............----E....AP..................SEQA.
ENSBTAP00000036550  ..............................LD............IMYNG....EM..................NEKI.
ENSBTAP00000053738  ..............................--............-----....--..................----.
ENSBTAP00000023383  ..............................YR............SLMY-....--..................----.
ENSBTAP00000027030  ..............................G-............-----....--..................----.
ENSBTAP00000053270  ..............................G-............-----....--..................----.
ENSBTAP00000054640  ..............................G-............-----....--..................----.
ENSBTAP00000012770  ..............................VM............RKV--....-W..................LHQT.
ENSBTAP00000009967  ..............................VA............LPWPI....PL..................EEELl
ENSBTAP00000015183  ..............................MT............EIVGW....GT..................EEEY.
ENSBTAP00000014222  ..............................LR............ELEHTe...HE..................TTKL.
ENSBTAP00000026288  ..............................TR............YLSK-....--..................----.
ENSBTAP00000002128  ..............................LK............IFLYI....LY..................FAAF.
ENSBTAP00000003365  ..............................EL............RTSGEk...CD..................EDAW.
ENSBTAP00000053738  ..............................FC............LELS-....KC..................YEKV.
ENSBTAP00000009228  ..............................--............-----....--..................----.
ENSBTAP00000026785  ..............................MK............QIKH-....IP..................ESKL.
ENSBTAP00000002578  ..............................LC............VKKN-....--..................----.
ENSBTAP00000000106  ..............................--............-----....--..................----.
ENSBTAP00000028840  ..............................--............-----....--..................----.
ENSBTAP00000053594  ..............................LE............ARGAG....FS..................GERF.
ENSBTAP00000055414  plsvsealtsffrkgfvetkeekmsglekaRQ............NASRI....RR..................ELLL.
ENSBTAP00000026698  ..............................LA............ALSGGr...SL..................EELT.
ENSBTAP00000017015  ..............................--............-----....--..................----.
ENSBTAP00000049908  ..............................--............-----....--..................---L.
ENSBTAP00000021395  ..............................A-............-----....--..................----.
ENSBTAP00000007194  ..............................--............-----....VL..................PVDC.
ENSBTAP00000025455  ..............................--............-----....--..................-LLL.


                          100                                                      110       120    
                            |                                                        |         |    
d1bjfa_               ....KWAFSMY...........DLD.GN...................................GYISKAEMLEIVQAI
ENSBTAP00000019411  ....REAFRVF...........DKD.GN...................................GYISAAELRHVMT--
ENSBTAP00000036057  ....REAFRVF...........DKD.GN...................................GYISAAELRHVMT--
ENSBTAP00000038404  ....KWAFSMY...........DLD.GN...................................GYISKAEMLEIVQAI
ENSBTAP00000010971  ....MWAFSMY...........DLD.GN...................................GYISREEMLEIVQAI
ENSBTAP00000019803  ....QAVYKQF...........DVD.RS...................................GTIGSSELPGAFE--
ENSBTAP00000014038  ....RFAFRIY...........DMD.KD...................................GYISNGELFQVLK--
ENSBTAP00000002055  ....REAFRVF...........DKD.GN...................................GYISAAELRHVMT--
ENSBTAP00000049731  ....REAFRVF...........DKD.GN...................................GYISAAELRHVMT--
ENSBTAP00000005577  ....KWAFSMY...........DLD.GN...................................GYISRSEMLEIVQAI
ENSBTAP00000034949  ....EWAFSLY...........DVD.GN...................................GTISKNEVLEIVTAI
ENSBTAP00000017447  ....EDLFKKI...........NGD.KT...................................DYLTVDQLVSFLNEH
ENSBTAP00000010858  ....-------...........---.--...................................---------------
ENSBTAP00000046644  ....DNIFSEF...........GAK.SK...................................PYLTVDQMMDFIN--
ENSBTAP00000022814  ....NWAFNMY...........DLD.GD...................................GKITRVEMLEIIEAI
ENSBTAP00000019758  ....-------...........---.--...................................---------------
ENSBTAP00000019321  ....NWAFEMY...........DLD.GD...................................GRITRLEMLEIIEAI
ENSBTAP00000011677  ....QKIFKHY...........DTD.QS...................................GTINSYEMRNAVK--
ENSBTAP00000011680  ....QKIFKHY...........DTD.QS...................................GTINSYEMRNAVK--
ENSBTAP00000021742  ....NWAFNLY...........DLN.KD...................................GCITKEEMLDIMKSI
ENSBTAP00000005348  ....HWQFSEL...........DQHpRD...................................RVLTHSELAPLRA--
ENSBTAP00000016609  ....DKILLEI...........GAK.GK...................................PYLTLEQLMDFIN--
ENSBTAP00000012740  ....-------...........---.--...................................---------------
ENSBTAP00000018403  ....REIFRAF...........DQD.DD...................................GYISVDELRQATS--
ENSBTAP00000026407  ....-------...........---.--...................................---------------
ENSBTAP00000052557  ....LKAFRLF...........DDD.ET...................................GKISFKNLKRVAK--
ENSBTAP00000054167  ....NWAFNLY...........DIN.KD...................................GYITKEEMLDIMKAI
ENSBTAP00000010319  ....LKAFKLF...........DDD.ET...................................GKISFKNLKRVAK--
ENSBTAP00000041545  ....QELFEKF...........SSD.GQ...................................-KLTLLEFVDFLQEE
ENSBTAP00000055204  ....QNVFRTY...........DRD.NS...................................GMIDKNELKQALS--
ENSBTAP00000003718  ....RWTFNLY...........DIN.KD...................................GYINKEEMMDIVKAI
ENSBTAP00000011676  ....LDIFRET...........DHN.HS...................................GTIDAHEMRTALK--
ENSBTAP00000049395  ....EEA----...........-TG.SK...................................ETLSVDQLVTFLQHQ
ENSBTAP00000054983  ....-------...........---.--...................................---------------
ENSBTAP00000052219  ....RQHFISF...........DSD.RS...................................GTVDPQELQKALT--
ENSBTAP00000025402  ....DEIFTSY...........HSK.AK...................................PYMTKEHLAKFIN--
ENSBTAP00000011678  ....LSIFRKF...........DLD.KS...................................GSMSAYEMRMAIE--
ENSBTAP00000000433  ....ENIYKLM...........---.--...................................---------------
ENSBTAP00000021491  ....LKAFKLF...........DDD.DT...................................GSISLNNIKRVAK--
ENSBTAP00000044733  ....QKIYREI...........DVD.RS...................................GTMNSYEMRKALE--
ENSBTAP00000010937  ....YLLLLSY...........-SD.KK...................................DHLTVEELAQFLKVE
ENSBTAP00000056439  ....YLLLLSY...........-SD.KK...................................DHLTVEELAQFLKVE
ENSBTAP00000055780  ....SDLFRMF...........DKN.AD...................................GYIDLEELKIMLQ--
ENSBTAP00000038002  ....EF-----...........---.--...................................---------------
ENSBTAP00000034705  ....EEIFHRY...........-SG.ED...................................RVLSASELLEFLE--
ENSBTAP00000035936  ....KWTFKIY...........DKD.RN...................................GCIDRQELLDIVESI
ENSBTAP00000013699  ....KNLFQQY...........DRD.CS...................................GSISYTELQQALS--
ENSBTAP00000002564  ....-------...........---.--...................................---------------
ENSBTAP00000011496  ....RWAFKLY...........DLD.ND...................................GYITRNEMLDIVDAI
ENSBTAP00000019111  ....LKAFKLF...........DDD.DS...................................GKISLRNLRRVAR--
ENSBTAP00000017036  ....RWYFKLY...........DVD.GN...................................GCIDRDELLTIIRAI
ENSBTAP00000003213  ....YLLMLTY...........-SN.HK...................................DHLDATDLLRFLEVE
ENSBTAP00000055444  ....YLLMLTY...........-SN.HK...................................DHLDATDLLRFLEVE
ENSBTAP00000024550  ....KQNFITV...........DKD.GS...................................GSVEHHELNQAIA--
ENSBTAP00000015248  ....RNAFACF...........DEE.AS...................................GFIHEDHLRELLT--
ENSBTAP00000021328  ....RNAFACF...........DEE.AT...................................GTIQEDYLRELLT--
ENSBTAP00000037091  ....RNAFACF...........DEE.AT...................................GTIQEDYLRELLT--
ENSBTAP00000029967  ....RDAFREF...........DTN.GD...................................GCISLGELRAALK--
ENSBTAP00000021449  ....RDAFKEF...........DAN.GD...................................GEITLGELQQAMQ--
ENSBTAP00000053176  ....EF-----...........---.--...................................---------------
ENSBTAP00000042361  ....RDAFREF...........DTN.GD...................................GEISTSELREAMR--
ENSBTAP00000016509  ....KWTFKIY...........DKD.RN...................................GCIDRQELLDIVE--
ENSBTAP00000026714  ....RDAFREF...........DTN.GD...................................GEISTSELREAMR--
ENSBTAP00000004690  ....TDIFREC...........DQD.QS...................................GTLNSYEMRLAVE--
ENSBTAP00000010858  ....RYLFKQV...........-AS.ST...................................GFCDQRRLGLLLHDS
ENSBTAP00000013117  ....YFLLVQF...........-SS.NK...................................EFLDTKDLMMFLEAE
ENSBTAP00000017574  ....IEIFNTY...........-SE.NR...................................KILLEKNLVEFLMRE
ENSBTAP00000004885  ....KLAFKSL...........DKN.ND...................................GKIEASEIVQSLQ--
ENSBTAP00000008961  ....-------...........---.--...................................---------------
ENSBTAP00000028063  ....-------...........---.--...................................---------------
ENSBTAP00000012740  ....-------...........---.--...................................---------------
ENSBTAP00000006283  ....RIAFREF...........DRD.RD...................................GRITVAELREAAP--
ENSBTAP00000014306  ....VEGLRVF...........DKE.GN...................................GTVMGAEIRHVLV--
ENSBTAP00000053252  ....YFLLVQI...........-SK.NK...................................EYLDANDLMLFLEAE
ENSBTAP00000014304  ....VEGLRVF...........DKE.GN...................................GTVMGAEIRHVLV--
ENSBTAP00000045669  ....-------...........---.--...................................---------------
ENSBTAP00000041264  ....-------...........---.--...................................---------------
ENSBTAP00000006711  ....-------...........---.--...................................---------------
ENSBTAP00000017358  ....-------...........---.--...................................---------------
ENSBTAP00000053274  ....-------...........---.--...................................---------------
ENSBTAP00000055296  ....-------...........---.--...................................---------------
ENSBTAP00000016852  ....MQAFRKL...........DKT.GD...................................GVITIEDLREVYN--
ENSBTAP00000036380  ....LLAMLMA...........DKE.KK...................................GYIMASELRSKLM--
ENSBTAP00000041719  ....LEGLRVF...........DKE.QN...................................GKVMGAELRHVLT--
ENSBTAP00000049636  ....VEGLRVF...........DKE.GN...................................GTVMGAELRHVLA--
ENSBTAP00000024444  ....LNAFKVF...........DPE.GK...................................GVLKADYIKEMLT--
ENSBTAP00000004556  ....GWMFNKL...........DMN.YD...................................LLLDHSEINAIYL--
ENSBTAP00000038767  ....HFAFRLY...........DLD.KD...................................DKISRDELLQVLR--
ENSBTAP00000031285  ....GWMFSKL...........DTS.AD...................................LFLDQTELA------
ENSBTAP00000011457  ....KYCFEVF...........DLN.GD...................................SFISKEEMFHMLKNS
ENSBTAP00000011047  ....VEGLRVF...........DKE.GN...................................GTVMGAELRHVLA--
ENSBTAP00000002564  ....-------...........---.--...................................---------------
ENSBTAP00000037104  ....LHAFKVF...........DTE.GK...................................GFVKADFIKEKLM--
ENSBTAP00000002672  ....LSAFRLF...........DPS.GK...................................GVVNKDEFRQLLL--
ENSBTAP00000028269  ....TGAFKVL...........DPE.GK...................................GTIKKKFLEELLT--
ENSBTAP00000016647  ....RFAFQLY...........DLD.RD...................................GKISRHEMLQALR--
ENSBTAP00000004536  ....LLLFHSL...........DRN.QD...................................GQIDVSEIQQSFR--
ENSBTAP00000042177  ....HWYFKLL...........DKN.NS...................................GDIGKKEIKPFKRFL
ENSBTAP00000028063  ....RYVFSQM...........-SD.SN...................................GLMIFSKFDQFLKEV
ENSBTAP00000050283  ....VEGLRVF...........DKE.SN...................................GTVMGAELRHVLA--
ENSBTAP00000048539  ....QMSFKLF...........DLD.KD...................................GFITEQELAAILR--
ENSBTAP00000045669  ....RYIFSMI...........-SD.SS...................................GVMVYGRYDQFLREV
ENSBTAP00000007972  ....TAAFAKL...........DRS.GD...................................GVVTVDDLRGVYS--
ENSBTAP00000040815  ....-------...........---.--...................................---------------
ENSBTAP00000025661  ....QVAFKLF...........DVD.ED...................................GFITEEEFSTILQ--
ENSBTAP00000028350  ....HYAFRIF...........DFD.DD...................................GTLNREDLSQLVN--
ENSBTAP00000053274  ....RYIFSMI...........-SD.SS...................................GVMVYGRYDQFLREV
ENSBTAP00000021537  ....YYAFKIY...........DFN.ND...................................DYICAWDLEQTVT--
ENSBTAP00000055481  ....RQLFNSH...........DKT.MS...................................GHLTGPQARTILM--
ENSBTAP00000039155  ....WEAFHVF...........DKD.SK...................................ILVSTAKRRHAMT--
ENSBTAP00000029333  ....RQLFNSH...........DKT.MS...................................GHLTGPQARTILM--
ENSBTAP00000016315  ....-------...........---.--...................................---------------
ENSBTAP00000021091  ....QEVFHKQ...........DTN.RS...................................GSLNWAQLRAAMR--
ENSBTAP00000021618  ....RLMFRMY...........DFD.GN...................................GLISKDEFIRMLRSF
ENSBTAP00000055520  ....SLLTTMY...........DST.GT...................................GFIKL----------
ENSBTAP00000055624  ....SLLTTMY...........DST.GT...................................GFIKL----------
ENSBTAP00000016319  ....-------...........---.--...................................---------------
ENSBTAP00000034078  ....LRAFEVL...........DPA.KR...................................GFLSKDELIKYMT--
ENSBTAP00000006645  ....EYAFRIY...........DFN.EN...................................GFIDEEDLQRIILRL
ENSBTAP00000021909  .kteREQFVEFr..........DKN.RD...................................GKMDKEETKDWIL--
ENSBTAP00000001426  ....MEAWRKY...........DTD.RS...................................GYIEANELKGFLSDL
ENSBTAP00000015802  ....RLVFKSL...........DKK.ND...................................GRIDAQEIMQSLR--
ENSBTAP00000032680  ....RLVFKSL...........DKK.ND...................................GRIDAQEIMQSLR--
ENSBTAP00000055007  ....AECFRIF...........DR-.--...................................---------------
ENSBTAP00000020148  ....-------...........---.--...................................---------------
ENSBTAP00000052345  ....DEIFLKT...........DKD.MD...................................GFVSGLEVREIFL--
ENSBTAP00000029334  ....RQKFNSL...........DKS.MS...................................GYLSGFQARNALL--
ENSBTAP00000052345  ....-------...........---.--...................................---------------
ENSBTAP00000056127  .lseREQFNEFr..........DLN.KD...................................GKLDKDEISHWIL--
ENSBTAP00000012557  ....QIIFNII...........DSD.HS...................................GLISMEEFRSMWR--
ENSBTAP00000011888  ....KFLFQVY...........DVD.GKhplwdgrrtqregqrerpvsvtaqhwassspetgsGSIDADELRTVLQSC
ENSBTAP00000017060  ....-------...........---.--...................................---------------
ENSBTAP00000031854  ....EYWFRCM...........DVD.GD...................................GVLSMYELEYFYEEQ
ENSBTAP00000031823  .qteREQFRDFr..........DLN.KD...................................GKLNGSEVGHWVL--
ENSBTAP00000021603  ....RLMFTMY...........DLD.GN...................................GFLSKDEFFTMMRVP
ENSBTAP00000010838  ....-------...........---.--...................................---------------
ENSBTAP00000014575  ....SYAFKIY...........DFN.TD...................................NFICKEDLQLTLA--
ENSBTAP00000011215  ....EYWFRCM...........DVD.GD...................................GVLSMYELEYFYEEQ
ENSBTAP00000053698  ....DSIFWQF...........DMQ.--...................................-RITLEELKHILY--
ENSBTAP00000006806  ....-------...........---.--...................................---------------
ENSBTAP00000029334  ....-------...........---.--...................................---------------
ENSBTAP00000044105  ....-------...........---.--...................................---------------
ENSBTAP00000026904  ....-------...........---.--...................................---------------
ENSBTAP00000017060  ....DEIFLKT...........DLD.LD...................................GYVSGQEVKEIFM--
ENSBTAP00000055520  ....-------...........---.--...................................---------------
ENSBTAP00000044226  ....-------...........---.--...................................---------------
ENSBTAP00000055624  ....-------...........---.--...................................---------------
ENSBTAP00000042182  ....QATFDKF...........DED.AS...................................GTMNSYELRLALN--
ENSBTAP00000010796  ....RRTFKAY...........DEG.GT...................................GLLSVADFRKVLR--
ENSBTAP00000021174  ....MKTWRKY...........DTD.HS...................................GFIETEELKNFLKDL
ENSBTAP00000006275  ....-------...........---.--...................................---------------
ENSBTAP00000020950  lvekDRFMNDY...........DRD.AD...................................GRLDPQELLSWVV--
ENSBTAP00000053738  ....RRTFKAY...........DEG.GT...................................GLLSVADFRKVLR--
ENSBTAP00000004963  ....KFCFEVY...........YFN.GD...................................GYISRERIYDMLKN-
ENSBTAP00000023774  gtdfDTVFWKC...........DMQ.K-...................................--LTVDELKRLLY--
ENSBTAP00000020395  ....ESAFRAL...........SSE.GK...................................PYVTKEELYQNLT--
ENSBTAP00000020150  ....-------...........---.--...................................---------------
ENSBTAP00000025561  ....-------...........---.--...................................---------------
ENSBTAP00000053738  ....SKNFIET...........DSE.GN...................................GILRRRDMKNALY--
ENSBTAP00000034009  ....-------...........---.--...................................---------------
ENSBTAP00000020539  ....ETIFRII...........DSD.HS...................................GSISLDEFRHTWK--
ENSBTAP00000020778  ....REFEELI...........DAN.HD...................................GIVTMAELEDYMD--
ENSBTAP00000017461  ....RHIFTAF...........DRH.YR...................................GYLTLEDFKKAFK--
ENSBTAP00000044096  ....-------...........---.--...................................---------------
ENSBTAP00000008523  ....-------...........---.--...................................---------------
ENSBTAP00000035196  ....WTVLRRF...........GYD.DD...................................LDLTPEYLFPLLK--
ENSBTAP00000041997  ....-------...........---.--...................................---------------
ENSBTAP00000025499  ....KKVFHIL...........DKD.KS...................................GFIEEEELGFILKGF
ENSBTAP00000055481  ....-------...........---.--...................................---------------
ENSBTAP00000002174  ....-------...........---.--...................................---------------
ENSBTAP00000000589  ....-------...........---.--...................................---------------
ENSBTAP00000028239  ....-------...........---.--...................................---------------
ENSBTAP00000014894  ....IASFKVL...........-AG.DK...................................NFITAEELRRELP--
ENSBTAP00000026544  ....EKIFAHY...........DVS.KT...................................GALEGPEVDGFVKDM
ENSBTAP00000029333  ....-------...........---.--...................................---------------
ENSBTAP00000041966  ....QSVFQNS...........PKN.AG...................................VFLSSDLWKAIRDTD
ENSBTAP00000008933  ....-------...........---.--...................................---------------
ENSBTAP00000056088  ....-------...........---.--...................................---------------
ENSBTAP00000033794  ....-------...........---.--...................................---------------
ENSBTAP00000012786  ....IASFRIL...........-AS.DK...................................PYILAEELRRELP--
ENSBTAP00000030018  ....VASFKIL...........-AG.DK...................................NYITAEELRRELP--
ENSBTAP00000040233  ....IKALMLI...........DVN.TT...................................GLVQPHELRRVLE--
ENSBTAP00000003365  ....LKSFKQL...........DVN.DN...................................GSILHTDLYKLLT--
ENSBTAP00000053176  ....EFMFRLY...........DTD.GN...................................GFLDSSELENIIS--
ENSBTAP00000024301  ....MASFKIL...........-AG.DK...................................NYITVDELRREL---
ENSBTAP00000022292  ....IVAFQLF...........DKS.GN...................................GEVTFENVKEIFGQT
ENSBTAP00000015611  ....-------...........---.--...................................---------------
ENSBTAP00000012770  ....QYIFKLL...........DIE.NK...................................GYLNVFSLNYFFRAI
ENSBTAP00000000847  ....-------...........---.--...................................---------------
ENSBTAP00000053738  ....IKALMLI...........DVN.TT...................................GLVQPHELRRVLE--
ENSBTAP00000054975  ....KDVFRFI...........DND.QS...................................GYLDEEELKFFLQKF
ENSBTAP00000046639  ....RKAFMKL...........DFN.KT...................................GSVSIIDIRKCYC--
ENSBTAP00000052345  ....-------...........---.--...................................---------------
ENSBTAP00000053164  ....LAAFRHY...........DKK.GD...................................GVIDRAELQEACD--
ENSBTAP00000016774  ....-------...........---.--...................................---------------
ENSBTAP00000022630  ....-------...........---.--...................................---------------
ENSBTAP00000010796  ....AQEFENF...........DTM.KT...................................NTASRDEFRSICT--
ENSBTAP00000021909  ....ENQWQEF...........DLN.QD...................................GLISWDEYRNVTYGT
ENSBTAP00000033974  ....RAALCIF...........DKE.AR...................................GYIDWDTLKYVLM--
ENSBTAP00000006711  ....EFMFRLY...........DSD.EN...................................GLLDQAEMDRIVS--
ENSBTAP00000010796  ....SKALAKL...........DKS.RT...................................GYISLGRLQRLLQ--
ENSBTAP00000004912  ....MVAFQLF...........DKA.GK...................................GEVTFEDVKQVFGQT
ENSBTAP00000005979  ....QRMFEKH...........DQD.RD...................................GALSPAELQSLFS--
ENSBTAP00000053738  ....AQEFENF...........DTM.KT...................................NTASRDEFRSICT--
ENSBTAP00000053746  ....RFLFHMY...........DSD.SD...................................GRITLEEYRNVVEEL
ENSBTAP00000023221  ....KTFFKLH...........DVN.SD...................................GFLDEQELEALFTKE
ENSBTAP00000019429  ....-------...........---.--...................................---------------
ENSBTAP00000052019  ....-------...........---.--...................................---------------
ENSBTAP00000042244  ....-------...........---.--...................................---------------
ENSBTAP00000053738  ....CNMLRSY...........DLG.DT...................................GLIGRNNFKKIMR--
ENSBTAP00000018877  ....-------...........---.--...................................---------------
ENSBTAP00000053019  ....RK-----...........---.--...................................---------------
ENSBTAP00000003073  ....KTFFILH...........DIN.SD...................................GVLDEQELEALFTKE
ENSBTAP00000012886  ....-------...........---.--...................................---------------
ENSBTAP00000044222  ....-------...........---.--...................................---------------
ENSBTAP00000028499  ....-------...........---.--...................................---------------
ENSBTAP00000047378  ....WGLWEEL...........GVG.SS...................................GHLTEQELALVCQ--
ENSBTAP00000009308  ....REAFAKV...........DTD.GN...................................GYISCSELNDLFKAA
ENSBTAP00000017060  ....-------...........---.--...................................---------------
ENSBTAP00000050406  ....RKA----...........---.--...................................--INRKEGICALGGT
ENSBTAP00000031879  ....RKA----...........---.--...................................--INRKEGICALGGT
ENSBTAP00000031854  ....KFICLLA...........-KP.SC...................................SSLEQDDFIPLLQDV
ENSBTAP00000001250  ....QLAFKMF...........-GS.QD...................................GSVEEHALSSILK--
ENSBTAP00000026035  ....-------...........---.--...................................---------------
ENSBTAP00000011215  ....KFICLLA...........-KP.SC...................................SSLEQDDFIPLLQDV
ENSBTAP00000002128  ....TDVVKAI...........DKI.KD...................................ENIDYGDLNTCLQ--
ENSBTAP00000053194  ....EDSFQAL...........-AE.GK...................................AYITKEDMKQALT--
ENSBTAP00000056127  ....AKVWKDY...........DRD.KD...................................DKISWEEYKQATYGY
ENSBTAP00000033188  ....TAVADIF...........DRD.GD...................................GYIDYYEFVAALH--
ENSBTAP00000053548  ....SAVADIF...........DRD.GD...................................GYIDYYEFVAALH--
ENSBTAP00000011687  frhsRPVFELL...........DLD.GE...................................LKIGPDHLHMY----
ENSBTAP00000007636  ....EIAFKMF...........DLN.GD...................................GEVDMEEFEQVQSII
ENSBTAP00000020950  ....KQQFIEY...........DKN.SD...................................GSVSWDEYNIQMYDR
ENSBTAP00000009115  ....-------...........---.--...................................---------------
ENSBTAP00000023873  ....-------...........---.--...................................---------------
ENSBTAP00000054471  ....QEFFQTC...........DKE.GK...................................GFIARADMQRLHK--
ENSBTAP00000039694  ....AIALNMY...........-NF.AS...................................RSIGQDEFKRAVY--
ENSBTAP00000025205  ....QEFFQTC...........DKE.GK...................................GFIARADMQRLHK--
ENSBTAP00000047882  ....LHYFKMH...........DYD.GN...................................NLLDGLELSTAITHV
ENSBTAP00000001368  ....LSAFGDL...........DQN.QD...................................GCISKEEMVSYFL--
ENSBTAP00000029786  ....KLLYKMH...........---.--...................................---------------
ENSBTAP00000028993  ....-------...........---.--...................................---------------
ENSBTAP00000023678  ....REAFQIY...........DKE.AS...................................GYVDRETFFKICG--
ENSBTAP00000034710  ....QDVFKLF...........SSS.PT...................................GSVDMRSMKAALS--
ENSBTAP00000031823  ....SAAWNTY...........DTD.RD...................................GRVGWEELRNATYGH
ENSBTAP00000038002  ....EFTFKLY...........DTD.RN...................................GILDSSEVDRIII--
ENSBTAP00000021074  ....-------...........---.--...................................---------------
ENSBTAP00000026544  ....MRIWRKY...........DAD.SS...................................GFISAAELCNFLRD-
ENSBTAP00000007217  ....LDLFQLL...........DQN.HD...................................GRLQLREVLAQNR--
ENSBTAP00000029792  ....KVLYKLH...........---.--...................................---------------
ENSBTAP00000044088  ....HVAFKML...........DAD.GD...................................EMVEKKEFFKLQKII
ENSBTAP00000017319  ....-------...........---.--...................................---------------
ENSBTAP00000044100  ....LDSFCVL...........DKD.QD...................................GLISKDEMMAYFLRA
ENSBTAP00000033594  ....HESFQEM...........DLN.DD...................................WKLSKNEVKVYLKKE
ENSBTAP00000026766  ....KYCFLLV...........QVN.--...................................---------------
ENSBTAP00000055894  ....-------...........---.--...................................---------------
ENSBTAP00000015220  ....GDMFQNQ...........DRN.QD...................................GKITAEEL-------
ENSBTAP00000033613  ....-NLFEEI...........DKD.GD...................................GEVLLEEFSEYIHAQ
ENSBTAP00000056320  ....EYWFRM-...........DLD.GD...................................VALFMFELEYFYEEQ
ENSBTAP00000025249  ....KDLFDIY...........AVP.CD...................................---------------
ENSBTAP00000029159  ....PFSFCVM...........DKD.RE...................................GLISRDEITAYFM--
ENSBTAP00000044088  ....AIAMQMF...........SLA.-H...................................RPVRLAEFKRAVK--
ENSBTAP00000016319  ....-------...........---.--...................................---------------
ENSBTAP00000017662  ....RSYFEIF...........--N.GH...................................GEVDAQSLENILL--
ENSBTAP00000012479  ....NLSFRKE...........DRS.FS...................................GCLPPPKVRAICG--
ENSBTAP00000029886  ....DKYFKNF...........-DN.GD...................................SRLDSSEFLKFVEQN
ENSBTAP00000027388  ....KKKYMEF...........DLN.ED...................................GGIDIMSLKRMME--
ENSBTAP00000039694  ....RIAFNMF...........DTD.GN...................................EMVDKKEFLVLQEIF
ENSBTAP00000023673  ....QELFLLC...........DKE.AK...................................GFITRHDLQGL----
ENSBTAP00000041488  ....QELFLLC...........DKE.AK...................................GFITRHDLQGL----
ENSBTAP00000001452  ....-ETFKQI...........DTD.ND...................................RQLSKTEISHYLKKE
ENSBTAP00000028498  ....-------...........---.--...................................---------------
ENSBTAP00000001426  ....NAIFTFY...........DKD.GS...................................GYIDENELDALLK--
ENSBTAP00000020240  ....SDTFKEY...........DPD.GK...................................GVISKRDFHKAME--
ENSBTAP00000053650  ....SDTFKEY...........DPD.GK...................................GVISKRDFHKAME--
ENSBTAP00000041651  ....LYLFALH...........DYD.QS...................................GQLDGLELLSMLTAA
ENSBTAP00000005154  ....-------...........---.-D...................................GVLSPGELRELFS--
ENSBTAP00000021174  ....NKAFELY...........DQD.GN...................................GYIDENELDALLKDL
ENSBTAP00000022068  ....RAVFDAL...........DGD.GD...................................GFVRIEDFVQFAT--
ENSBTAP00000026682  ....EAIFTKY...........DQD.GD...................................QELTEHE--------
ENSBTAP00000007636  ....LSFYHMA...........G--.--...................................ASLDKVTMQQVAR--
ENSBTAP00000027954  ....------F...........DPG.NT...................................GFISTGKFRSLLD--
ENSBTAP00000020778  ....-------...........DLN.TD...................................RRISAKEMQKWIMQK
ENSBTAP00000013601  ....-------...........---.--...................................------------M--
ENSBTAP00000005477  ....QQSFDILgft........NSK.GE...................................KAIQREDFLNLLH--
ENSBTAP00000055305  ....SDTFKEY...........DPD.GK...................................GIISKKEFQKAME--
ENSBTAP00000036054  ....SDTFKEY...........DPD.GK...................................GIISKKEFQKAME--
ENSBTAP00000004912  ....RKIYSTL...........AGNrKD...................................VEVTKEEFVLAAQ--
ENSBTAP00000022292  ....RQAFALK...........DKS.KS...................................GLISGLDFSDIMVTI
ENSBTAP00000002717  ....KKDSSVFllgnt......DRP.DA...................................SAVHLHDFQRFLL--
ENSBTAP00000036015  ....-------...........---.--...................................---------------
ENSBTAP00000051638  ....KLLFKLHispaytevqykDPS.KG...................................DELSKEELLYFSQ--
ENSBTAP00000026766  ....KYIFSLF...........ASE.SG...................................SYVIREEMERMLH--
ENSBTAP00000053738  ....SKALAKL...........DKS.RT...................................GYISLGRLQRLLQ--
ENSBTAP00000016306  ....EWTFTLY...........DFD.NN...................................GKVTREDITSLLHTI
ENSBTAP00000013714  ....RRVFQTY...........DPE.DN...................................GFIPDSLLEDVMK--
ENSBTAP00000036550  ....KLLYRLH...........---.--...................................---------------
ENSBTAP00000053738  ....-------...........---.--...................................---------------
ENSBTAP00000023383  ....-------...........---.--...................................---------------
ENSBTAP00000027030  ....FRVFSCL...........-DD.GM...................................GYASVERILDTWQ--
ENSBTAP00000053270  ....FRVFSCL...........-DD.GM...................................GYASVERILDTWQ--
ENSBTAP00000054640  ....FRVFSCL...........-DD.GM...................................GYASVERILDTWQ--
ENSBTAP00000012770  ....RIGLSLY...........DVA.GQ...................................GYLRESDLENYILEL
ENSBTAP00000009967  ..etLQRFKAL...........DAE.QL...................................GTITYEQYKQA----
ENSBTAP00000015183  ....GELFDKV...........DVA.QE...................................GFINWDKLTSFLL--
ENSBTAP00000014222  ....TAAFTRF...........DQD.GN...................................GVLDEKEQKETQQ--
ENSBTAP00000026288  ....-------...........---.--...................................---------------
ENSBTAP00000002128  ....QNALKIF...........HRI.KC...................................GRVPVSEVDKVLD--
ENSBTAP00000003365  ....AVCRENF...........DTK.KN...................................---------------
ENSBTAP00000053738  ....EKALSAG...........DPC.TS...................................GYVSLNYLKIVLD--
ENSBTAP00000009228  ....-EAFQDY...........VTD.PR...................................GLISKKDFKKAMD--
ENSBTAP00000026785  ....LSLASAL...........DDN.KD...................................GKVDIDDLVKVIE--
ENSBTAP00000002578  ....-------...........---.--...................................---------------
ENSBTAP00000000106  ....-------...........---.--...................................---------------
ENSBTAP00000028840  ....-------...........---.--...................................---------------
ENSBTAP00000053594  ....EEAFAQF...........DAE.GD...................................GTVDAENMLEALK--
ENSBTAP00000055414  ....KALFQKW...........DCD.GS...................................GFLDLKEIDELLY--
ENSBTAP00000026698  ....RLAFELF...........---.--...................................---------------
ENSBTAP00000017015  ....-------...........---.--...................................---------------
ENSBTAP00000049908  ....LMAFVYF...........DQS.HC...................................GYLLEKDLEEIFY--
ENSBTAP00000021395  ....-------...........---.--...................................---------------
ENSBTAP00000007194  ....LLAFVYF...........DAN.WC...................................GYLHRRDLERILL--
ENSBTAP00000025455  ....KALFQKW...........DCD.GS...................................GFLDLKEIDELLY--


                         130                                                                        
                           |                                                                        
d1bjfa_               YKMVSSV..MK...................................................................
ENSBTAP00000019411  -------..--...................................................................
ENSBTAP00000036057  -------..--...................................................................
ENSBTAP00000038404  YKMVSSV..MK...................................................................
ENSBTAP00000010971  YKMVSSV..MK...................................................................
ENSBTAP00000019803  -------..--...................................................................
ENSBTAP00000014038  -----MM..VG...................................................................
ENSBTAP00000002055  -------..--...................................................................
ENSBTAP00000049731  -------..--...................................................................
ENSBTAP00000005577  YKMVSSV..MK...................................................................
ENSBTAP00000034949  FKMISPEdtKH...................................................................
ENSBTAP00000017447  --QRDPR..LN...................................................................
ENSBTAP00000010858  -------..--...................................................................
ENSBTAP00000046644  LKQRDPR..LN...................................................................
ENSBTAP00000022814  YKMVGTV..IM...................................................................
ENSBTAP00000019758  -------..--...................................................................
ENSBTAP00000019321  YKMVGTV..IM...................................................................
ENSBTAP00000011677  -------..--...................................................................
ENSBTAP00000011680  -------..--...................................................................
ENSBTAP00000021742  YDMMGKY..TY...................................................................
ENSBTAP00000005348  -------..--...................................................................
ENSBTAP00000016609  QKQRDPR..LN...................................................................
ENSBTAP00000012740  -------..--...................................................................
ENSBTAP00000018403  -------..--...................................................................
ENSBTAP00000026407  -------..--...................................................................
ENSBTAP00000052557  -------..--...................................................................
ENSBTAP00000054167  YDMMGKC..TY...................................................................
ENSBTAP00000010319  -------..--...................................................................
ENSBTAP00000041545  Q------..--...................................................................
ENSBTAP00000055204  -------..--...................................................................
ENSBTAP00000003718  YDMMGKY..TY...................................................................
ENSBTAP00000011676  -------..--...................................................................
ENSBTAP00000049395  QR-----..--...................................................................
ENSBTAP00000054983  -------..--...................................................................
ENSBTAP00000052219  -------..--...................................................................
ENSBTAP00000025402  -------..--...................................................................
ENSBTAP00000011678  -------..--...................................................................
ENSBTAP00000000433  -------..--...................................................................
ENSBTAP00000021491  -------..--...................................................................
ENSBTAP00000044733  -------..--...................................................................
ENSBTAP00000010937  QKMTN--..--...................................................................
ENSBTAP00000056439  QKMTN--..--...................................................................
ENSBTAP00000055780  -------..--...................................................................
ENSBTAP00000038002  -------..--...................................................................
ENSBTAP00000034705  -------..--...................................................................
ENSBTAP00000035936  YKLKKAC..SV...................................................................
ENSBTAP00000013699  -------..--...................................................................
ENSBTAP00000002564  -------..--...................................................................
ENSBTAP00000011496  YQMVGNT..VE...................................................................
ENSBTAP00000019111  -------..--...................................................................
ENSBTAP00000017036  RAINPC-..--...................................................................
ENSBTAP00000003213  QKMTG--..--...................................................................
ENSBTAP00000055444  QKMTG--..--...................................................................
ENSBTAP00000024550  -------..--...................................................................
ENSBTAP00000015248  -------..--...................................................................
ENSBTAP00000021328  -------..--...................................................................
ENSBTAP00000037091  -------..--...................................................................
ENSBTAP00000029967  -------..--...................................................................
ENSBTAP00000021449  -------..--...................................................................
ENSBTAP00000053176  -------..--...................................................................
ENSBTAP00000042361  -------..--...................................................................
ENSBTAP00000016509  ---VKRP..WG...................................................................
ENSBTAP00000026714  -------..--...................................................................
ENSBTAP00000004690  -------..--...................................................................
ENSBTAP00000010858  IQIPRQL..GE...................................................................
ENSBTAP00000013117  -------..--...................................................................
ENSBTAP00000017574  -------..--...................................................................
ENSBTAP00000004885  -------..--...................................................................
ENSBTAP00000008961  -------..--...................................................................
ENSBTAP00000028063  -------..--...................................................................
ENSBTAP00000012740  -------..--...................................................................
ENSBTAP00000006283  -------..--...................................................................
ENSBTAP00000014306  -------..--...................................................................
ENSBTAP00000053252  -------..--...................................................................
ENSBTAP00000014304  -------..--...................................................................
ENSBTAP00000045669  -------..--...................................................................
ENSBTAP00000041264  -------..--...................................................................
ENSBTAP00000006711  -------..--...................................................................
ENSBTAP00000017358  -------..--...................................................................
ENSBTAP00000053274  -------..--...................................................................
ENSBTAP00000055296  -------..--...................................................................
ENSBTAP00000016852  ---AKHH..PK...................................................................
ENSBTAP00000036380  -------..--...................................................................
ENSBTAP00000041719  -------..--...................................................................
ENSBTAP00000049636  -------..--...................................................................
ENSBTAP00000024444  -------..--...................................................................
ENSBTAP00000004556  -------..--...................................................................
ENSBTAP00000038767  -----MM..VG...................................................................
ENSBTAP00000031285  -------..--...................................................................
ENSBTAP00000011457  LLKQPSE..ED...................................................................
ENSBTAP00000011047  -------..--...................................................................
ENSBTAP00000002564  -------..--...................................................................
ENSBTAP00000037104  -------..--...................................................................
ENSBTAP00000002672  -------..--...................................................................
ENSBTAP00000028269  -------..--...................................................................
ENSBTAP00000016647  -----LM..VG...................................................................
ENSBTAP00000004536  -------..--...................................................................
ENSBTAP00000042177  RKK----..--...................................................................
ENSBTAP00000028063  L-KLPTA..VF...................................................................
ENSBTAP00000050283  -------..--...................................................................
ENSBTAP00000048539  -------..--...................................................................
ENSBTAP00000045669  L-KLPTA..VF...................................................................
ENSBTAP00000007972  ---GRTH..PK...................................................................
ENSBTAP00000040815  -------..--...................................................................
ENSBTAP00000025661  -------..--...................................................................
ENSBTAP00000028350  -CLTGES..ED...................................................................
ENSBTAP00000053274  L-KLPTA..VF...................................................................
ENSBTAP00000021537  -----KL..TR...................................................................
ENSBTAP00000055481  -------..--...................................................................
ENSBTAP00000039155  -------..--...................................................................
ENSBTAP00000029333  -------..--...................................................................
ENSBTAP00000016315  -------..--...................................................................
ENSBTAP00000021091  -------..--...................................................................
ENSBTAP00000021618  IEISNN-..--...................................................................
ENSBTAP00000055520  -------..--...................................................................
ENSBTAP00000055624  -------..--...................................................................
ENSBTAP00000016319  -------..--...................................................................
ENSBTAP00000034078  -------..--...................................................................
ENSBTAP00000006645  LNSD---..--...................................................................
ENSBTAP00000021909  -------..--...................................................................
ENSBTAP00000001426  LKKANR-..--...................................................................
ENSBTAP00000015802  -------..--...................................................................
ENSBTAP00000032680  -------..--...................................................................
ENSBTAP00000055007  -------..--...................................................................
ENSBTAP00000020148  -------..--...................................................................
ENSBTAP00000052345  -------..--...................................................................
ENSBTAP00000029334  -------..--...................................................................
ENSBTAP00000052345  -------..--...................................................................
ENSBTAP00000056127  -------..--...................................................................
ENSBTAP00000012557  --LFKS-..--...................................................................
ENSBTAP00000011888  LYESAI-..--...................................................................
ENSBTAP00000017060  -------..--...................................................................
ENSBTAP00000031854  CERMEAM..GI...................................................................
ENSBTAP00000031823  -------..--...................................................................
ENSBTAP00000021603  PTPRPRS..FI...................................................................
ENSBTAP00000010838  -------..--...................................................................
ENSBTAP00000014575  -----RL..TK...................................................................
ENSBTAP00000011215  CERMEAM..GI...................................................................
ENSBTAP00000053698  -------..--...................................................................
ENSBTAP00000006806  -------..--...................................................................
ENSBTAP00000029334  -------..--...................................................................
ENSBTAP00000044105  -------..--...................................................................
ENSBTAP00000026904  -------..--...................................................................
ENSBTAP00000017060  -------..--...................................................................
ENSBTAP00000055520  -------..--...................................................................
ENSBTAP00000044226  -------..--...................................................................
ENSBTAP00000055624  -------..--...................................................................
ENSBTAP00000042182  -------..--...................................................................
ENSBTAP00000010796  -------..--...................................................................
ENSBTAP00000021174  LEKANK-..--...................................................................
ENSBTAP00000006275  -------..--...................................................................
ENSBTAP00000020950  -------..--...................................................................
ENSBTAP00000053738  -------..--...................................................................
ENSBTAP00000004963  -------..--...................................................................
ENSBTAP00000023774  -------..--...................................................................
ENSBTAP00000020395  -------..--...................................................................
ENSBTAP00000020150  -------..--...................................................................
ENSBTAP00000025561  -------..--...................................................................
ENSBTAP00000053738  -------..--...................................................................
ENSBTAP00000034009  -------..--...................................................................
ENSBTAP00000020539  --LFSS-..--...................................................................
ENSBTAP00000020778  -------..--...................................................................
ENSBTAP00000017461  -------..--...................................................................
ENSBTAP00000044096  -------..--...................................................................
ENSBTAP00000008523  -------..--...................................................................
ENSBTAP00000035196  --IPPDC..T-...................................................................
ENSBTAP00000041997  -------..--...................................................................
ENSBTAP00000025499  S------..--...................................................................
ENSBTAP00000055481  -------..--...................................................................
ENSBTAP00000002174  -------..--...................................................................
ENSBTAP00000000589  -------..--...................................................................
ENSBTAP00000028239  -------..--...................................................................
ENSBTAP00000014894  -------..--...................................................................
ENSBTAP00000026544  MELVQP-..--...................................................................
ENSBTAP00000029333  -------..--...................................................................
ENSBTAP00000041966  F------..--...................................................................
ENSBTAP00000008933  -------..--...................................................................
ENSBTAP00000056088  -------..--...................................................................
ENSBTAP00000033794  -------..--...................................................................
ENSBTAP00000012786  -------..--...................................................................
ENSBTAP00000030018  -------..--...................................................................
ENSBTAP00000040233  -------..--...................................................................
ENSBTAP00000003365  -------..--...................................................................
ENSBTAP00000053176  -QMMHVA..EY...................................................................
ENSBTAP00000024301  -------..--...................................................................
ENSBTAP00000022292  TIHHHI-..--...................................................................
ENSBTAP00000015611  -------..--...................................................................
ENSBTAP00000012770  QELMKIH..GQ...................................................................
ENSBTAP00000000847  -------..--...................................................................
ENSBTAP00000053738  -------..--...................................................................
ENSBTAP00000054975  E------..--...................................................................
ENSBTAP00000046639  AKMHPR-..--...................................................................
ENSBTAP00000052345  -------..--...................................................................
ENSBTAP00000053164  -------..--...................................................................
ENSBTAP00000016774  -------..--...................................................................
ENSBTAP00000022630  -------..--...................................................................
ENSBTAP00000010796  -------..--...................................................................
ENSBTAP00000021909  YLDDPD-..PD...................................................................
ENSBTAP00000033974  -------..--...................................................................
ENSBTAP00000006711  -QMLHIA..QY...................................................................
ENSBTAP00000010796  -------..--...................................................................
ENSBTAP00000004912  TIHQHIP..FN...................................................................
ENSBTAP00000005979  -------..--...................................................................
ENSBTAP00000053738  -------..--...................................................................
ENSBTAP00000053746  LSGNPHI..EK...................................................................
ENSBTAP00000023221  LEKVYDP..KN...................................................................
ENSBTAP00000019429  -------..--...................................................................
ENSBTAP00000052019  -------..--...................................................................
ENSBTAP00000042244  -------..--...................................................................
ENSBTAP00000053738  -------..--...................................................................
ENSBTAP00000018877  -------..--...................................................................
ENSBTAP00000053019  -------..--...................................................................
ENSBTAP00000003073  LEKVYDP..KN...................................................................
ENSBTAP00000012886  -------..--...................................................................
ENSBTAP00000044222  -------..--...................................................................
ENSBTAP00000028499  -------..--...................................................................
ENSBTAP00000047378  -------..--...................................................................
ENSBTAP00000009308  C------..--...................................................................
ENSBTAP00000017060  -------..--...................................................................
ENSBTAP00000050406  SELSSEG..TQ...................................................................
ENSBTAP00000031879  SELSSEG..TQ...................................................................
ENSBTAP00000031854  VDTHPGL..TF...................................................................
ENSBTAP00000001250  -------..--...................................................................
ENSBTAP00000026035  -------..--...................................................................
ENSBTAP00000011215  VDTHPGL..TF...................................................................
ENSBTAP00000002128  -------..--...................................................................
ENSBTAP00000053194  -------..--...................................................................
ENSBTAP00000056127  YLGNPTE..FQ...................................................................
ENSBTAP00000033188  -------..--...................................................................
ENSBTAP00000053548  -------..--...................................................................
ENSBTAP00000011687  -------..--...................................................................
ENSBTAP00000007636  RSQTSMG..MRhrdrsttgntlksglcsalttyffgadlkgkltiknflefqrklqhdvlkleferhdpvdgriterq
ENSBTAP00000020950  V--IDFV..EN...................................................................
ENSBTAP00000009115  -------..--...................................................................
ENSBTAP00000023873  -------..--...................................................................
ENSBTAP00000054471  -------..--...................................................................
ENSBTAP00000039694  -------..--...................................................................
ENSBTAP00000025205  -------..--...................................................................
ENSBTAP00000047882  HKEEGSE..QA...................................................................
ENSBTAP00000001368  -------..--...................................................................
ENSBTAP00000029786  -------..--...................................................................
ENSBTAP00000028993  -------..--...................................................................
ENSBTAP00000023678  -------..--...................................................................
ENSBTAP00000034710  -------..--...................................................................
ENSBTAP00000031823  Y------..--...................................................................
ENSBTAP00000038002  -QMMRMA..EY...................................................................
ENSBTAP00000021074  -------..--...................................................................
ENSBTAP00000026544  -------..--...................................................................
ENSBTAP00000007217  -------..--...................................................................
ENSBTAP00000029792  -------..--...................................................................
ENSBTAP00000044088  SKQDDLK..TAitdetecqeqtvqepeinttlqirffgkrgerklhykefrrfmenlqaevqemeflqfskglsfmrk
ENSBTAP00000017319  -------..--...................................................................
ENSBTAP00000044100  KSQ----..--...................................................................
ENSBTAP00000033594  FEKHGA-..--...................................................................
ENSBTAP00000026766  -------..--...................................................................
ENSBTAP00000055894  -------..--...................................................................
ENSBTAP00000015220  -------..--...................................................................
ENSBTAP00000033613  VASGKGK..LA...................................................................
ENSBTAP00000056320  SRRLDSM..AI...................................................................
ENSBTAP00000025249  -------..RAgseaaplytnltidenisglqpdldlltrnvsdlglfikskqqlsdnqrqisdaiaaasivtngtgv
ENSBTAP00000029159  -------..--...................................................................
ENSBTAP00000044088  -------..--...................................................................
ENSBTAP00000016319  -------..--...................................................................
ENSBTAP00000017662  -------..--...................................................................
ENSBTAP00000012479  -------..--...................................................................
ENSBTAP00000029886  ETAINIT..TY...................................................................
ENSBTAP00000027388  -------..--...................................................................
ENSBTAP00000039694  RKKNEKR..ETkgdeekramlrlqlygyhsptnsvlktdaeelvsrsywdtlrrntsqalfsdfae............
ENSBTAP00000023673  -------..--...................................................................
ENSBTAP00000041488  -------..--...................................................................
ENSBTAP00000001452  FEKDEK-..--...................................................................
ENSBTAP00000028498  -------..--...................................................................
ENSBTAP00000001426  -------..--...................................................................
ENSBTAP00000020240  -------..--...................................................................
ENSBTAP00000053650  -------..--...................................................................
ENSBTAP00000041651  LAPGAS-..--...................................................................
ENSBTAP00000005154  -------..--...................................................................
ENSBTAP00000021174  CEKNKQ-..--...................................................................
ENSBTAP00000022068  -------..--...................................................................
ENSBTAP00000026682  -------..--...................................................................
ENSBTAP00000007636  -------..--...................................................................
ENSBTAP00000027954  -------..--...................................................................
ENSBTAP00000020778  T------..--...................................................................
ENSBTAP00000013601  -------..--...................................................................
ENSBTAP00000005477  -------..--...................................................................
ENSBTAP00000055305  -------..--...................................................................
ENSBTAP00000036054  -------..--...................................................................
ENSBTAP00000004912  -------..--...................................................................
ENSBTAP00000022292  -------..--...................................................................
ENSBTAP00000002717  -------..--...................................................................
ENSBTAP00000036015  -------..--...................................................................
ENSBTAP00000051638  -------..--...................................................................
ENSBTAP00000026766  -------..--...................................................................
ENSBTAP00000053738  -------..--...................................................................
ENSBTAP00000016306  YEVVDSS..VN...................................................................
ENSBTAP00000013714  -------..--...................................................................
ENSBTAP00000036550  -------..--...................................................................
ENSBTAP00000053738  -------..--...................................................................
ENSBTAP00000023383  -------..--...................................................................
ENSBTAP00000027030  -------..--...................................................................
ENSBTAP00000053270  -------..--...................................................................
ENSBTAP00000054640  -------..--...................................................................
ENSBTAP00000012770  IPTLPQL..DG...................................................................
ENSBTAP00000009967  -------..--...................................................................
ENSBTAP00000015183  -------..--...................................................................
ENSBTAP00000014222  -------..--...................................................................
ENSBTAP00000026288  -------..--...................................................................
ENSBTAP00000002128  -------..--...................................................................
ENSBTAP00000003365  -------..--...................................................................
ENSBTAP00000053738  -------..--...................................................................
ENSBTAP00000009228  -------..--...................................................................
ENSBTAP00000026785  -------..--...................................................................
ENSBTAP00000002578  -------..--...................................................................
ENSBTAP00000000106  -------..--...................................................................
ENSBTAP00000028840  -------..--...................................................................
ENSBTAP00000053594  -------..--...................................................................
ENSBTAP00000055414  -------..--...................................................................
ENSBTAP00000026698  -------..--...................................................................
ENSBTAP00000017015  -------..--...................................................................
ENSBTAP00000049908  -------..--...................................................................
ENSBTAP00000021395  -------..--...................................................................
ENSBTAP00000007194  -------..--...................................................................
ENSBTAP00000025455  -------..--...................................................................


                                                                                                    
                                                                                                    
d1bjfa_               ...........................................................................M..
ENSBTAP00000019411  ...........................................................................-..
ENSBTAP00000036057  ...........................................................................-..
ENSBTAP00000038404  ...........................................................................M..
ENSBTAP00000010971  ...........................................................................M..
ENSBTAP00000019803  ...........................................................................-..
ENSBTAP00000014038  ...........................................................................N..
ENSBTAP00000002055  ...........................................................................-..
ENSBTAP00000049731  ...........................................................................-..
ENSBTAP00000005577  ...........................................................................M..
ENSBTAP00000034949  ...........................................................................L..
ENSBTAP00000017447  ...........................................................................E..
ENSBTAP00000010858  ...........................................................................-..
ENSBTAP00000046644  ...........................................................................E..
ENSBTAP00000022814  ...........................................................................M..
ENSBTAP00000019758  ...........................................................................-..
ENSBTAP00000019321  ...........................................................................Mrm
ENSBTAP00000011677  ...........................................................................-..
ENSBTAP00000011680  ...........................................................................-..
ENSBTAP00000021742  ...........................................................................P..
ENSBTAP00000005348  ...........................................................................-..
ENSBTAP00000016609  ...........................................................................E..
ENSBTAP00000012740  ...........................................................................-..
ENSBTAP00000018403  ...........................................................................-..
ENSBTAP00000026407  ...........................................................................-..
ENSBTAP00000052557  ...........................................................................-..
ENSBTAP00000054167  ...........................................................................P..
ENSBTAP00000010319  ...........................................................................-..
ENSBTAP00000041545  ...........................................................................-..
ENSBTAP00000055204  ...........................................................................-..
ENSBTAP00000003718  ...........................................................................P..
ENSBTAP00000011676  ...........................................................................-..
ENSBTAP00000049395  ...........................................................................-..
ENSBTAP00000054983  ...........................................................................-..
ENSBTAP00000052219  ...........................................................................-..
ENSBTAP00000025402  ...........................................................................-..
ENSBTAP00000011678  ...........................................................................-..
ENSBTAP00000000433  ...........................................................................-..
ENSBTAP00000021491  ...........................................................................-..
ENSBTAP00000044733  ...........................................................................-..
ENSBTAP00000010937  ...........................................................................-..
ENSBTAP00000056439  ...........................................................................-..
ENSBTAP00000055780  ...........................................................................-..
ENSBTAP00000038002  ...........................................................................-..
ENSBTAP00000034705  ...........................................................................-..
ENSBTAP00000035936  ...........................................................................Eve
ENSBTAP00000013699  ...........................................................................-..
ENSBTAP00000002564  ...........................................................................-..
ENSBTAP00000011496  ...........................................................................L..
ENSBTAP00000019111  ...........................................................................-..
ENSBTAP00000017036  ...........................................................................-..
ENSBTAP00000003213  ...........................................................................-..
ENSBTAP00000055444  ...........................................................................-..
ENSBTAP00000024550  ...........................................................................-..
ENSBTAP00000015248  ...........................................................................-..
ENSBTAP00000021328  ...........................................................................-..
ENSBTAP00000037091  ...........................................................................-..
ENSBTAP00000029967  ...........................................................................A..
ENSBTAP00000021449  ...........................................................................R..
ENSBTAP00000053176  ...........................................................................-..
ENSBTAP00000042361  ...........................................................................K..
ENSBTAP00000016509  ...........................................................................Pp.
ENSBTAP00000026714  ...........................................................................K..
ENSBTAP00000004690  ...........................................................................-..
ENSBTAP00000010858  ...........................................................................Va.
ENSBTAP00000013117  ...........................................................................-..
ENSBTAP00000017574  ...........................................................................-..
ENSBTAP00000004885  ...........................................................................-..
ENSBTAP00000008961  ...........................................................................-..
ENSBTAP00000028063  ...........................................................................-..
ENSBTAP00000012740  ...........................................................................-..
ENSBTAP00000006283  ...........................................................................A..
ENSBTAP00000014306  ...........................................................................-..
ENSBTAP00000053252  ...........................................................................-..
ENSBTAP00000014304  ...........................................................................-..
ENSBTAP00000045669  ...........................................................................-..
ENSBTAP00000041264  ...........................................................................-..
ENSBTAP00000006711  ...........................................................................-..
ENSBTAP00000017358  ...........................................................................-..
ENSBTAP00000053274  ...........................................................................-..
ENSBTAP00000055296  ...........................................................................-..
ENSBTAP00000016852  ...........................................................................Y..
ENSBTAP00000036380  ...........................................................................-..
ENSBTAP00000041719  ...........................................................................-..
ENSBTAP00000049636  ...........................................................................-..
ENSBTAP00000024444  ...........................................................................-..
ENSBTAP00000004556  ...........................................................................-..
ENSBTAP00000038767  ...........................................................................V..
ENSBTAP00000031285  ...........................................................................-..
ENSBTAP00000011457  ...........................................................................P..
ENSBTAP00000011047  ...........................................................................-..
ENSBTAP00000002564  ...........................................................................-..
ENSBTAP00000037104  ...........................................................................-..
ENSBTAP00000002672  ...........................................................................-..
ENSBTAP00000028269  ...........................................................................-..
ENSBTAP00000016647  ...........................................................................V..
ENSBTAP00000004536  ...........................................................................-..
ENSBTAP00000042177  ...........................................................................-..
ENSBTAP00000028063  ...........................................................................E..
ENSBTAP00000050283  ...........................................................................-..
ENSBTAP00000048539  ...........................................................................A..
ENSBTAP00000045669  ...........................................................................E..
ENSBTAP00000007972  ...........................................................................V..
ENSBTAP00000040815  ...........................................................................-..
ENSBTAP00000025661  ...........................................................................A..
ENSBTAP00000028350  ...........................................................................T..
ENSBTAP00000053274  ...........................................................................E..
ENSBTAP00000021537  ...........................................................................G..
ENSBTAP00000055481  ...........................................................................-..
ENSBTAP00000039155  ...........................................................................-..
ENSBTAP00000029333  ...........................................................................-..
ENSBTAP00000016315  ...........................................................................-..
ENSBTAP00000021091  ...........................................................................-..
ENSBTAP00000021618  ...........................................................................-..
ENSBTAP00000055520  ...........................................................................-..
ENSBTAP00000055624  ...........................................................................-..
ENSBTAP00000016319  ...........................................................................-..
ENSBTAP00000034078  ...........................................................................-..
ENSBTAP00000006645  ...........................................................................-..
ENSBTAP00000021909  ...........................................................................-..
ENSBTAP00000001426  ...........................................................................-..
ENSBTAP00000015802  ...........................................................................-..
ENSBTAP00000032680  ...........................................................................-..
ENSBTAP00000055007  ...........................................................................-..
ENSBTAP00000020148  ...........................................................................-..
ENSBTAP00000052345  ...........................................................................-..
ENSBTAP00000029334  ...........................................................................-..
ENSBTAP00000052345  ...........................................................................-..
ENSBTAP00000056127  ...........................................................................-..
ENSBTAP00000012557  ...........................................................................-..
ENSBTAP00000011888  ...........................................................................-..
ENSBTAP00000017060  ...........................................................................-..
ENSBTAP00000031854  ...........................................................................E..
ENSBTAP00000031823  ...........................................................................-..
ENSBTAP00000021603  ...........................................................................Eis
ENSBTAP00000010838  ...........................................................................-..
ENSBTAP00000014575  ...........................................................................S..
ENSBTAP00000011215  ...........................................................................E..
ENSBTAP00000053698  ...........................................................................H..
ENSBTAP00000006806  ...........................................................................-..
ENSBTAP00000029334  ...........................................................................-..
ENSBTAP00000044105  ...........................................................................-..
ENSBTAP00000026904  ...........................................................................-..
ENSBTAP00000017060  ...........................................................................-..
ENSBTAP00000055520  ...........................................................................-..
ENSBTAP00000044226  ...........................................................................-..
ENSBTAP00000055624  ...........................................................................-..
ENSBTAP00000042182  ...........................................................................-..
ENSBTAP00000010796  ...........................................................................-..
ENSBTAP00000021174  ...........................................................................-..
ENSBTAP00000006275  ...........................................................................-..
ENSBTAP00000020950  ...........................................................................-..
ENSBTAP00000053738  ...........................................................................-..
ENSBTAP00000004963  ...........................................................................-..
ENSBTAP00000023774  ...........................................................................D..
ENSBTAP00000020395  ...........................................................................-..
ENSBTAP00000020150  ...........................................................................-..
ENSBTAP00000025561  ...........................................................................-..
ENSBTAP00000053738  ...........................................................................-..
ENSBTAP00000034009  ...........................................................................-..
ENSBTAP00000020539  ...........................................................................-..
ENSBTAP00000020778  ...........................................................................-..
ENSBTAP00000017461  ...........................................................................-..
ENSBTAP00000044096  ...........................................................................-..
ENSBTAP00000008523  ...........................................................................-..
ENSBTAP00000035196  ...........................................................................-..
ENSBTAP00000041997  ...........................................................................-..
ENSBTAP00000025499  ...........................................................................-..
ENSBTAP00000055481  ...........................................................................-..
ENSBTAP00000002174  ...........................................................................-..
ENSBTAP00000000589  ...........................................................................-..
ENSBTAP00000028239  ...........................................................................-..
ENSBTAP00000014894  ...........................................................................-..
ENSBTAP00000026544  ...........................................................................-..
ENSBTAP00000029333  ...........................................................................-..
ENSBTAP00000041966  ...........................................................................-..
ENSBTAP00000008933  ...........................................................................-..
ENSBTAP00000056088  ...........................................................................-..
ENSBTAP00000033794  ...........................................................................-..
ENSBTAP00000012786  ...........................................................................-..
ENSBTAP00000030018  ...........................................................................-..
ENSBTAP00000040233  ...........................................................................-..
ENSBTAP00000003365  ...........................................................................-..
ENSBTAP00000053176  ...........................................................................L..
ENSBTAP00000024301  ...........................................................................-..
ENSBTAP00000022292  ...........................................................................-..
ENSBTAP00000015611  ...........................................................................-..
ENSBTAP00000012770  ...........................................................................D..
ENSBTAP00000000847  ...........................................................................-..
ENSBTAP00000053738  ...........................................................................-..
ENSBTAP00000054975  ...........................................................................-..
ENSBTAP00000046639  ...........................................................................-..
ENSBTAP00000052345  ...........................................................................-..
ENSBTAP00000053164  ...........................................................................-..
ENSBTAP00000016774  ...........................................................................-..
ENSBTAP00000022630  ...........................................................................-..
ENSBTAP00000010796  ...........................................................................-..
ENSBTAP00000021909  ...........................................................................D..
ENSBTAP00000033974  ...........................................................................-..
ENSBTAP00000006711  ...........................................................................L..
ENSBTAP00000010796  ...........................................................................-..
ENSBTAP00000004912  ...........................................................................-..
ENSBTAP00000005979  ...........................................................................-..
ENSBTAP00000053738  ...........................................................................-..
ENSBTAP00000053746  ...........................................................................Esa
ENSBTAP00000023221  ...........................................................................E..
ENSBTAP00000019429  ...........................................................................-..
ENSBTAP00000052019  ...........................................................................-..
ENSBTAP00000042244  ...........................................................................-..
ENSBTAP00000053738  ...........................................................................-..
ENSBTAP00000018877  ...........................................................................-..
ENSBTAP00000053019  ...........................................................................-..
ENSBTAP00000003073  ...........................................................................E..
ENSBTAP00000012886  ...........................................................................-..
ENSBTAP00000044222  ...........................................................................-..
ENSBTAP00000028499  ...........................................................................-..
ENSBTAP00000047378  ...........................................................................-..
ENSBTAP00000009308  ...........................................................................L..
ENSBTAP00000017060  ...........................................................................-..
ENSBTAP00000050406  ...........................................................................H..
ENSBTAP00000031879  ...........................................................................H..
ENSBTAP00000031854  ...........................................................................Lkd
ENSBTAP00000001250  ...........................................................................T..
ENSBTAP00000026035  ...........................................................................-..
ENSBTAP00000011215  ...........................................................................Lkd
ENSBTAP00000002128  ...........................................................................-..
ENSBTAP00000053194  ...........................................................................-..
ENSBTAP00000056127  ...........................................................................D..
ENSBTAP00000033188  ...........................................................................-..
ENSBTAP00000053548  ...........................................................................-..
ENSBTAP00000011687  ...........................................................................-..
ENSBTAP00000007636  fggmllaysgvqskkltamqkqlkkhfkegkgltfqevenfftflknindvdtalsfyhmagasldkvtmqqvarT..
ENSBTAP00000020950  ...........................................................................Tal
ENSBTAP00000009115  ...........................................................................-..
ENSBTAP00000023873  ...........................................................................-..
ENSBTAP00000054471  ...........................................................................-..
ENSBTAP00000039694  ...........................................................................V..
ENSBTAP00000025205  ...........................................................................-..
ENSBTAP00000047882  ...........................................................................-..
ENSBTAP00000001368  ...........................................................................-..
ENSBTAP00000029786  ...........................................................................-..
ENSBTAP00000028993  ...........................................................................-..
ENSBTAP00000023678  ...........................................................................-..
ENSBTAP00000034710  ...........................................................................-..
ENSBTAP00000031823  ...........................................................................-..
ENSBTAP00000038002  ...........................................................................L..
ENSBTAP00000021074  ...........................................................................-..
ENSBTAP00000026544  ...........................................................................-..
ENSBTAP00000007217  ...........................................................................L..
ENSBTAP00000029792  ...........................................................................-..
ENSBTAP00000044088  edfaewllfftdtenkdvywknvreklsagenisleefksfchfathledfaiamqmfslahrpvrlaefkravkV..
ENSBTAP00000017319  ...........................................................................-..
ENSBTAP00000044100  ...........................................................................-..
ENSBTAP00000033594  ...........................................................................-..
ENSBTAP00000026766  ...........................................................................-..
ENSBTAP00000055894  ...........................................................................-..
ENSBTAP00000015220  ...........................................................................-..
ENSBTAP00000033613  ...........................................................................P..
ENSBTAP00000056320  ...........................................................................E..
ENSBTAP00000025249  .......................................................estslgvfgvgilqlndflvN..
ENSBTAP00000029159  ...........................................................................-..
ENSBTAP00000044088  ...........................................................................V..
ENSBTAP00000016319  ...........................................................................-..
ENSBTAP00000017662  ...........................................................................-..
ENSBTAP00000012479  ...........................................................................-..
ENSBTAP00000029886  ...........................................................................Adq
ENSBTAP00000027388  ...........................................................................-..
ENSBTAP00000039694  ...........................................................................R..
ENSBTAP00000023673  ...........................................................................-..
ENSBTAP00000041488  ...........................................................................-..
ENSBTAP00000001452  ...........................................................................-..
ENSBTAP00000028498  ...........................................................................-..
ENSBTAP00000001426  ...........................................................................-..
ENSBTAP00000020240  ...........................................................................-..
ENSBTAP00000053650  ...........................................................................-..
ENSBTAP00000041651  ...........................................................................D..
ENSBTAP00000005154  ...........................................................................-..
ENSBTAP00000021174  ...........................................................................-..
ENSBTAP00000022068  ...........................................................................-..
ENSBTAP00000026682  ...........................................................................-..
ENSBTAP00000007636  ...........................................................................T..
ENSBTAP00000027954  ...........................................................................-..
ENSBTAP00000020778  ...........................................................................-..
ENSBTAP00000013601  ...........................................................................-..
ENSBTAP00000005477  ...........................................................................-..
ENSBTAP00000055305  ...........................................................................-..
ENSBTAP00000036054  ...........................................................................-..
ENSBTAP00000004912  ...........................................................................-..
ENSBTAP00000022292  ...........................................................................-..
ENSBTAP00000002717  ...........................................................................-..
ENSBTAP00000036015  ...........................................................................-..
ENSBTAP00000051638  ...........................................................................-..
ENSBTAP00000026766  ...........................................................................-..
ENSBTAP00000053738  ...........................................................................-..
ENSBTAP00000016306  ...........................................................................-..
ENSBTAP00000013714  ...........................................................................-..
ENSBTAP00000036550  ...........................................................................-..
ENSBTAP00000053738  ...........................................................................-..
ENSBTAP00000023383  ...........................................................................-..
ENSBTAP00000027030  ...........................................................................-..
ENSBTAP00000053270  ...........................................................................-..
ENSBTAP00000054640  ...........................................................................-..
ENSBTAP00000012770  ...........................................................................L..
ENSBTAP00000009967  ...........................................................................-..
ENSBTAP00000015183  ...........................................................................-..
ENSBTAP00000014222  ...........................................................................-..
ENSBTAP00000026288  ...........................................................................-..
ENSBTAP00000002128  ...........................................................................-..
ENSBTAP00000003365  ...........................................................................-..
ENSBTAP00000053738  ...........................................................................-..
ENSBTAP00000009228  ...........................................................................-..
ENSBTAP00000026785  ...........................................................................-..
ENSBTAP00000002578  ...........................................................................-..
ENSBTAP00000000106  ...........................................................................-..
ENSBTAP00000028840  ...........................................................................-..
ENSBTAP00000053594  ...........................................................................-..
ENSBTAP00000055414  ...........................................................................-..
ENSBTAP00000026698  ...........................................................................-..
ENSBTAP00000017015  ...........................................................................-..
ENSBTAP00000049908  ...........................................................................-..
ENSBTAP00000021395  ...........................................................................-..
ENSBTAP00000007194  ...........................................................................-..
ENSBTAP00000025455  ...........................................................................-..


                               140                  150                       160       170       18
                                 |                    |                         |         |         
d1bjfa_               ....PEDE..STPEKR...........TEKIFRQM....DT....NR....DGK....LSLEEFIRGAKSDPSIVRLL
ENSBTAP00000019411  ....NLGE..KLTDEE...........VDEMIREA....DI....DG....DGQ....VNYEEFVQMM----------
ENSBTAP00000036057  ....NLGE..KLTDEE...........VDEMIREA....DI....DG....DGQ....VNYEEFVQMM----------
ENSBTAP00000038404  ....PEDE..STPEKR...........TEKIFRQM....DT....NR....DGK....LSLEEFIR------------
ENSBTAP00000010971  ....PEDE..STPEKR...........TEKIFRQM....DT....NN....DGK....LSLEEFIR------------
ENSBTAP00000019803  ....AAGF..RLNEHL...........YNMIIRRY....-S....DE....GGN....MDFDNFISCLVRLDAMFRAF
ENSBTAP00000014038  ....NLKD..TQLQQI...........VDKTIINA....DK....DG....DGR....ISFEEFCA------------
ENSBTAP00000002055  ....NLGE..KLTDEE...........VDEMIREA....DI....DG....DGQ....VNYEEFVQMMT---------
ENSBTAP00000049731  ....NLGE..KLTDEE...........VDEMIREA....DI....DG....DGQ....VNYEEFVHMMT---------
ENSBTAP00000005577  ....PEDE..STPEKR...........TDKIFRQM....DT....NN....DGK....LSLEEFIKGAKSDPSIVRLL
ENSBTAP00000034949  ....PEDE..NTPEKR...........AEKIWGFF....GK....KD....DDK....LTEKEFIE------------
ENSBTAP00000017447  ....ILFP..FYDAKR...........AMQIIEMYepdeDL....KK....QGL....ISSDGFCRYLMSDENAP---
ENSBTAP00000010858  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000046644  ....ILYP..PLKQEQ...........VQVLIEKY....EP....NNslakKGQ....ISVDGFMRYLSG--------
ENSBTAP00000022814  ....KMNEdgLTPEQR...........VDKIFSKM....DK....NK....DDQ....ITLDEFKEAAKSDPSIVLL-
ENSBTAP00000019758  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000019321  ....NQDG..LTPQQR...........VDKIFKKM....DQ....DK....DDQ....ITLEEFKEAAKSDPSIVLLL
ENSBTAP00000011677  ....DAGF..HLNNQL...........YDIITMRY....-A....DK....YMN....IDFDSFICCFVRLEGMFRAF
ENSBTAP00000011680  ....DAGF..HLNNQL...........YDIITMRY....-A....DK....YMN....IDFDSFICCFVRLEGMFRAF
ENSBTAP00000021742  ....ALRE..EAPREH...........VESFFQKM....DR....NK....DGV....VTIEEFIESCQKDENIMRSM
ENSBTAP00000005348  ....--SL..VPMEHC...........ITRFFEEC....DP....NK....DKH....ITLQEWGHCF----------
ENSBTAP00000016609  ....VLYP..PLRPSQ...........ARLLIEKY....EP....NKqfleRDQ....MSMEGFSR------------
ENSBTAP00000012740  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000018403  ....QLGE..KVSQDE...........LDAMIREA....DV....DQ....DGR....VNYEEFVRILT---------
ENSBTAP00000026407  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000052557  ....ELGE..NLTDEE...........LQEMIDEA....DR....DG....DGE....VNEDEFLRIMK---------
ENSBTAP00000054167  ....VLKE..DAPRQH...........VETFFQKM....DK....NK....DGV....VTIDEFIESCQKDENIMRSM
ENSBTAP00000010319  ....ELGE..NLSDEE...........LQEMIDEA....DR....DG....DGE....VNEQEFLRIMKK--------
ENSBTAP00000041545  ....KEGE..-RASDL...........ALELIDRY....EP....SE....SGKlrhvLSMDGFLGYL----------
ENSBTAP00000055204  ....GFGY..RLSDQF...........HDILIRKF....DR....QG....RGQ....IAFDDFIQGCIVLQRLTDIF
ENSBTAP00000003718  ....VLKE..DTPRQH...........VDIFFQKM....DK....NK....DGI....VTLDEFLESCQEDDNIMRSL
ENSBTAP00000011676  ....KAGF..TLSDQV...........QQTIAMRY....-A....CS....KLT....MDFDSFIACMIRLETLFKLF
ENSBTAP00000049395  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000054983  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000052219  ....TMGF..RLSPQA...........VNSIAKRY....ST....N-....-GK....ITFDDYIACCVKLRALTDSF
ENSBTAP00000025402  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000011678  ....FAGF..KLNKKL...........YELIITRY....-S....EP....DLA....VDFDNFVCCLVRLETMFRFF
ENSBTAP00000000433  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000021491  ....ELGE..NLTDDE...........LQEMLDEA....DH....DG....DGE....INKEEFLKMMQK--------
ENSBTAP00000044733  ....EAGF..KMPCQL...........HQVIVARF....-A....DD....DLI....IDFDNFVRCLIRLETLFRIF
ENSBTAP00000010937  ....----..-VTTDY...........CIDIIRKF....EV....SE....ENKvknvLGIEGFTNFMR---------
ENSBTAP00000056439  ....----..-VTTDY...........CIDIIRKF....EV....SE....ENKvknvLGIEGFTNFMR---------
ENSBTAP00000055780  ....ATGE..TITEDD...........IEELMKDG....DK....NN....DGR....IDYDEFLEFMK---------
ENSBTAP00000038002  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000034705  ....DQGEh.KATLAH...........AQQLIHTY....EL....NE....TAKqhelMTLDGFMMYLLS--------
ENSBTAP00000035936  ..aeQQGKl.LTPEEV...........VDRIFLLV....DE....NG....DGQ....LSLNEFVEGARRDKWVMKML
ENSBTAP00000013699  ....QMGY..NLSPQF...........TQLLVSRYc...PR....SA....NPA....MQLDRFIQVCTQLQVLTEAF
ENSBTAP00000002564  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000011496  ....PEEE..NTPEKR...........VDRIFAMM....DK....NA....DGK....LTLQEFQEGSKADPSIVQA-
ENSBTAP00000019111  ....ELGE..NMSDEE...........LRAMIEEF....DK....DG....DGE....INQEEFIAIM----------
ENSBTAP00000017036  ....SDST..MTAEEF...........TDTVFSKI....DV....NG....DGE....LSLEEFMEGVQKDQMLLDT-
ENSBTAP00000003213  ....----..-VTLES...........CRDIIEQF....EPcpenKS....KGA....MGIDGFTN------------
ENSBTAP00000055444  ....----..-VTLES...........CRDIIEQF....EPcpenKS....KGA....MGIDGFTN------------
ENSBTAP00000024550  ....AMGY..RLSPQT...........VTTIVKRY....--....SK....NGR....IFFDDYVACCVKLRALTDFF
ENSBTAP00000015248  ....TMGD..RFTDEE...........VDEMYREA....PI....DK....KGN....FNYVEFTRILK---------
ENSBTAP00000021328  ....TMGD..RFTDEE...........VDELYREA....PI....DK....KGN....FNYIEFTRILK---------
ENSBTAP00000037091  ....TMGD..RFTDEE...........VDELYREA....PI....DK....KGN....FNYIEFTRILK---------
ENSBTAP00000029967  ....LLGE..RLSQRE...........VDEILRDI....DL....NG....DGL....VDFEEFVRMM----------
ENSBTAP00000021449  ....LLGD..KLTSQE...........ISEVVQEA....DI....NG....DGT....VDFEEFVKMM----------
ENSBTAP00000053176  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000042361  ....LLGH..QVGHRD...........IEEIIRDV....DL....NG....DGR....VDFEEFVRMM----------
ENSBTAP00000016509  ....QGKL..LTPEEV...........VDRIFLLV....DE....NG....DGQ....LSLNEFVEGARRDKWVMKML
ENSBTAP00000026714  ....LLGH..QVGHRD...........IEEIIRDV....DL....NG....DGR....VDFEEFVRMM----------
ENSBTAP00000004690  ....KAGI..KLNNKV...........TQVLVARY....-A....ND....SLI....MEFDSFISCFLRLKAMFK--
ENSBTAP00000010858  ....SFGG..SNIEPS...........VRSCFQFA....--....NN....KPE....IEAALFLDWMR---------
ENSBTAP00000013117  ....QGVA..HINEEI...........SLEIIHKY....EP....SK....EGQekgwLSIDGFTNYLMSPD------
ENSBTAP00000017574  ....QYTL..DFNKSI...........ASEIIQKYepieEV....KQ....AHQ....MSFEGFRRYMDSSEC-----
ENSBTAP00000004885  ....ILGL..TISEQQ...........AELILQSI....DA....DG....TMT....VDWNEWRDYFLFNP------
ENSBTAP00000008961  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000028063  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000012740  ....----..--IEPS...........VRSCFQQN....--....NN....KPE....ISVKEFIDWMRLE-------
ENSBTAP00000006283  ....LLGE..PLVGPE...........LEEMLQEV....DL....NG....DGT....VDFNEFVMMLS---------
ENSBTAP00000014306  ....TLGE..KMTEEE...........VEMLVAGH....-E....DS....NGC....INYEELVRMV----------
ENSBTAP00000053252  ....QGVT..HITEDM...........CLDIIRRY....EL....SEegrqKGF....LAIDGFTQYLLSS-------
ENSBTAP00000014304  ....TLGE..KMTEEE...........VEMLVAGH....-E....DS....NGC....INYEAFVRHI----------
ENSBTAP00000045669  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000041264  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000006711  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000017358  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000053274  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000055296  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000016852  ....QNGE..WTEEQV...........FRKFLDNF....DSpy..DK....DGV....VTPEEFMNYYA---------
ENSBTAP00000036380  ....QLGE..KLTHKE...........VEDLFREA....GI....EP....NGK....VKYDEFIQ------------
ENSBTAP00000041719  ....TLGE..RMTEEE...........VESVLAGH....-E....DS....SGC....INYEAFLKHI----------
ENSBTAP00000049636  ....TLGE..KMKEEE...........VEALMAGQ....-E....DS....NGC....INYEAFVKHI----------
ENSBTAP00000024444  ....TQAE..RFSKEE...........IDQMFAAF....PP....DV....TGN....LDYKNLVHIITH--------
ENSBTAP00000004556  ....----..DKYEPC...........IKPLFNSC....DS....FK....DGK....LSNNEWCYCFQK--------
ENSBTAP00000038767  ....NISD..EQLGSI...........ADRTIQEA....DQ....DG....DSA....ISFTEFVKVLEK--------
ENSBTAP00000031285  ....AINL..DKYEVC...........IRPFFNSC....DT....YK....DGR....VSTAEWCFCFWRE-------
ENSBTAP00000011457  ....DEGI..K---DL...........VEITLKKM....DH....DH....DGK....LSFADYEQAVREETLLLEAF
ENSBTAP00000011047  ....TLGE..KLTEDE...........VEKLMAGQ....-E....DS....NGC....INYEAFVKHI----------
ENSBTAP00000002564  ....----..------...........V-------....--....--....---....--------------------
ENSBTAP00000037104  ....TQAD..RFSEEE...........VKQMFAAF....PP....DV....CGN....LDYRNLCYVIT---------
ENSBTAP00000002672  ....TQAD..KFSPAE...........VEQMFALT....PM....DL....AGN....IDYKSLCYIIT---------
ENSBTAP00000028269  ....TQCD..RFSQEE...........IKNMWAAF....PP....DV....GGN....VDYKNICYVIT---------
ENSBTAP00000016647  ....QVTE..EQLESI...........ADRTVQEA....DE....DG....DGA....VSFLEFAKSL----------
ENSBTAP00000004536  ....ALGI..SISLEQ...........AEKILHSM....DR....DG....TMT....IDWQEWRDHFLL--------
ENSBTAP00000042177  ....----..SKPKKC...........VKKFVEYC....DV....NN....DKS....ISLQELMGCL----------
ENSBTAP00000028063  ....GPSF..GYTEHS...........VRTCFPQQ....--....--....-KK....IMLNMFLDTMMADPPP----
ENSBTAP00000050283  ....TLGE..KMSEAE...........VEQLLAGQ....-E....DA....NGC....INYEAFVKHI----------
ENSBTAP00000048539  ....AFG-..-VPDLD...........VSTLFREI....AG....PN....SDR....ISYRTFKKFALKHPAYAKLF
ENSBTAP00000045669  ....GPSF..GYTEQS...........ARSCFSQQ....--....--....-KK....VTLNGFLDTLMSDPPP----
ENSBTAP00000007972  ....RSGE..WTEEQV...........LRHFLDNF....DS....SEk...DGQ....VTLAEFQDYYSG--------
ENSBTAP00000040815  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000025661  ....SLG-..-VPDLD...........VSGLFKEI....--....AQ....GDS....VSYEEFKSFALKHPEYAKIF
ENSBTAP00000028350  ....RLSA..SEMKQL...........IDNILEES....DI....DR....DGT....INLSEFQHVISRSPDFASSF
ENSBTAP00000053274  ....GPSF..GYTEQS...........ARSCFSQQ....--....--....-KK....VTLNGFLDTLMSDPPP----
ENSBTAP00000021537  ....ELST..EEVSLI...........CEKVLDEA....DG....DH....DGR....LSLEDFQNMILRAPDFLSTF
ENSBTAP00000055481  ....QSS-..-LPQAQ...........LASIWNLS....DI....DQ....DGK....LTAEEFILAMHLI-------
ENSBTAP00000039155  ....WLGK..KLNNQE...........VEEMIRAA....HM....DA....DGQ....VNCEEFMHLL----------
ENSBTAP00000029333  ....QSS-..-LPQAQ...........LASIWNLS....DI....DQ....DGK....LTAEEFILAMHLI-------
ENSBTAP00000016315  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000021091  ....EAGI..MLSDDV...........CQLMLIRY....-G....GP....DLQ....MNFVRFVRLMLRVENMEDVF
ENSBTAP00000021618  ....CLTK..TQLAEV...........VESMFRES....GF....QD....KQE....LTWEDFHFMLRDHDS-----
ENSBTAP00000055520  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000055624  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000016319  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000034078  ....EEGE..PFSQEE...........MEEMLSAA....ID....PE....SNS....IHYKDYITMM----------
ENSBTAP00000006645  ....DMSE..DLLTDL...........TSHVLNES....DL....DN....DNM....LSFSEFEHAMAKSPDFMNSF
ENSBTAP00000021909  ....PSDY..DHAEAE...........ARHLVYES....DQ....NK....DGK....LTKEEIVD------------
ENSBTAP00000001426  ....PYDE..PKLQEY...........TQTILRMF....DL....NG....DGK....LGLSEMSRL-----------
ENSBTAP00000015802  ....DLGV..KISEQQ...........AEKILKSM....DK....NG....TMT....IDWNEWRDYHLLHP------
ENSBTAP00000032680  ....DLGV..KISEQQ...........AEKILKSM....DK....NG....TMT....IDWNEWRDYHLLHP------
ENSBTAP00000055007  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000020148  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000052345  ....KTG-..-LPSAL...........LAHIWALC....DT....KN....CGK....LSKDQFALAFH---------
ENSBTAP00000029334  ....QSN-..-LSQTQ...........LATIWTLA....DI....DG....DGQ....LKAEEFILAMHL--------
ENSBTAP00000052345  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000056127  ....PQDY..DHAQAE...........ARHLVYES....DK....NK....DEK....LTKEEILD------------
ENSBTAP00000012557  ....HYSV..HIDDSQ...........FDELAERM....DL....NK....DGS....IDFNEFLKAF----------
ENSBTAP00000011888  ....SLPK..EKLDQL...........TLALFESA....DK....DC....SGT....ITFEELRDELQRFPGVLE--
ENSBTAP00000017060  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000031854  ....PLPF..H---DL...........LCQMLDLV....KP....AS....DGK....ITLRDLKRCRM---------
ENSBTAP00000031823  ....PPAQ..DQPLVE...........ANHLLHES....DT....DK....DGR....LSKAEIL-------------
ENSBTAP00000021603  ..nnCLTK..TQLAEV...........VESMFRES....GF....QD....KQE....LTWEDFHFMLRDHD------
ENSBTAP00000010838  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000014575  ....ELDE..DEVVLV...........CDKVIEEA....DL....DG....DGK....LGFADFEDMIAKAPDFL---
ENSBTAP00000011215  ....PLPF..H---DL...........LCQMLDLV....KP....AS....DGK....ITLRDLKRCRM---------
ENSBTAP00000053698  ....AFRD..HLTMKD...........IENI----....--....--....---....--------------------
ENSBTAP00000006806  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000029334  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000044105  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000026904  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000017060  ....HSG-..-LTQNL...........LAHIWALA....DT....RQ....TGK....LSKDQFALAMY---------
ENSBTAP00000055520  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000044226  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000055624  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000042182  ....AAGF..HLNNQL...........TQALTSRY....-R....DS....RLR....VDFERFVSCMAQL-------
ENSBTAP00000010796  ....QYSI..NLSEEE...........FFHILEYY....DK....TL....SSK....ISYNDFLRA-----------
ENSBTAP00000021174  ....TVDD..TKLAEY...........TDLMLKLF....DS....NN....DGK....LELTEMARLL----------
ENSBTAP00000006275  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000020950  ....PNNQ..GIAQEE...........ARHLIDEM....DL....NS....DRK....LSEEEILE------------
ENSBTAP00000053738  ....QYSI..NLSEEE...........FFHILEYY....DK....TL....SSK....ISYNDFLRA-----------
ENSBTAP00000004963  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000023774  ....TFCE..HLSMKD...........IENII---....--....--....---....--------------------
ENSBTAP00000020395  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000020150  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000025561  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000053738  ....GFDI..PLTPRE...........FEKLWMRY....DS....EG....RGH....ITYQEFLQ------------
ENSBTAP00000034009  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000020539  ....HMNI..DITDDC...........ICDLARSI....DF....NK....DGH....IDINEFLEAF----------
ENSBTAP00000020778  ....PMNE..FSALNE...........AKQMIAIA....DE....NQ....NHY....LEPEEVLK------------
ENSBTAP00000017461  ....QVAP..KLSERI...........ILEVF---....--....--....---....--------------------
ENSBTAP00000044096  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000008523  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000035196  ....TELN..HHAYLF...........LQSTFDKH....DL....DR....DCA....LSPDELKDLFKVFP------
ENSBTAP00000041997  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000025499  ....PDAR..DLSVKE...........TKTLLAAG....DK....DG....DGK....IGADEFST------------
ENSBTAP00000055481  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000002174  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000000589  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000028239  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000014894  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000026544  ....SIRG..VDLDKF...........REILLRHC....DV....NK....DGK....IQKSELALC-----------
ENSBTAP00000029333  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000041966  ....LAGI..SITSEL...........LDLMKLRY....-S....DS....TGR....VSFPSLVCLLMRLEAMAKAF
ENSBTAP00000008933  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000056088  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000033794  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000012786  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000030018  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000040233  ....TFCL..KMKDEE...........YKKFAQHY....NI....DK....DAA....VDYNVFLK------------
ENSBTAP00000003365  ....KKGE..KMTREE...........VNAIINLA....DV....NA....DGK....FDYIKFCKLYM---------
ENSBTAP00000053176  ....EWDV..TELNPI...........LHEMMEEI....DY....DH....DGT....VSLEEWIQ------------
ENSBTAP00000024301  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000022292  ....PF--..---NWD...........CEFIRLHF....GH....NR....KKH....LNYTEFTQFL----------
ENSBTAP00000015611  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000012770  ....PVSF..---QDV...........KDEIFDMV....KP....KD....PLK....ISLQDLIN------------
ENSBTAP00000000847  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000053738  ....TFCL..KMKDEE...........YKKFAQHY....NI....DK....DAA....VDYNVFLK------------
ENSBTAP00000054975  ....SGAR..ELTESE...........TKSLMAAA....DN....DG....DGK....IGADEFQEMV----------
ENSBTAP00000046639  ....VISG..HSTEEE...........IKSSFLETlkd.AC....SK....SDE....VSYGEFEDY-----------
ENSBTAP00000052345  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000053164  ....QACL..HLDEKL...........LDQLFEYC....DV....DK....DGL....INYLEFANFLT---------
ENSBTAP00000016774  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000022630  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000010796  ....RHVQ..VLTDEQ...........FDRLWEEM....PV....NS....KGR....LRYLDFLS------------
ENSBTAP00000021909  ....GFNY..KQMMVR...........DERRFKMA....DK....DG....DLI....ATKEEFTAF-----------
ENSBTAP00000033974  ....NVGE..PLNE--...........--QMMKEA....DE....NG....DGT....LNYE----------------
ENSBTAP00000006711  ....EWDP..TELRPI...........LKEMLQGM....DY....DR....DGF....VSLEEWVHGGMTTIPLLV--
ENSBTAP00000010796  ....ECGC..SLKEEE...........LIDLLNRT....SWgia.WH....NNS....INYLDFLRA-----------
ENSBTAP00000004912  ....----..----WD...........SEFVQLHF....GK....ER....KRH....LTYAEFTQFL----------
ENSBTAP00000005979  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000053738  ....RHVQ..VLTDEQ...........FDRLWEEM....PV....NS....KGR....LRYLDFLS------------
ENSBTAP00000053746  ...rSIAD..GAMMEA...........ASVCVGQM....EP....DQv...YEG....ITFDDFLKIWQGI-------
ENSBTAP00000023221  ....EDDM..VEMEEErlrm.......REHVMNEV....DT....NK....DRL....VTLDEFLKA-----------
ENSBTAP00000019429  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000052019  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000042244  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000053738  ....VFCP..FLTTEH...........LVKLCSKF....QD....IA....SGR....ILYKKLLACL----------
ENSBTAP00000018877  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000053019  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000003073  ....DDDM..REMEEErlrm.......REHVMKNV....DT....NQ....DRL....VTLEEFLA------------
ENSBTAP00000012886  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000044222  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000028499  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000047378  ....SIGLq.GLAKEE...........LEDLFNKL....DQ....DG....DGR....VSLEELQL------------
ENSBTAP00000009308  ....PLPG..YRVREI...........TENLMTTG....DL....DQ....DGK....ISFDEFIKVFHGL-------
ENSBTAP00000017060  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000050406  ....SYSE..EEKYAF...........VNWINKAL....EN....D-....---....--------------------
ENSBTAP00000031879  ....SYSE..EEKYAF...........VNWINKAL....EN....D-....---....--------------------
ENSBTAP00000031854  ..apEFHS..RYITTV...........IQRIFYTV....NR....SW....SGK....ITATEIR-------------
ENSBTAP00000001250  ....ALG-..-VAELT...........VTDLFRAI....DQ....ER....KGR....IAFADFKRFAEANPDF----
ENSBTAP00000026035  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000011215  ..apEFHS..RYITTV...........IQRIFYTV....NR....SW....SGK....ITATEIR-------------
ENSBTAP00000002128  ....NLGV..YLSKPE...........FQKIT---....--....--....---....--------------------
ENSBTAP00000053194  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000056127  ....TSDH..HTFKKMlpr........DERRFKAA....DL....DS....DQT....ATREEFTAFL----------
ENSBTAP00000033188  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000053548  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000011687  ....NFLF..NIKKQQ...........LRDLYYNF....DI....TG....DRKl...LNYKEFKL------------
ENSBTAP00000007636  ....VAKV..ELSDHV...........CDVVFALF....DC....DG....NGE....LSNKEFVSIM----------
ENSBTAP00000020950  ddaeEESF..RQLHLK...........DKKRFEKA....NQ....DS....GPG....LNLEEFIA------------
ENSBTAP00000009115  ....----..------...........--------....--....--....---....--------VL----------
ENSBTAP00000023873  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000054471  ....ELP-..-LSLED...........LEDVFDTL....DA....DG....NGF....LTPEEFTTGFS---------
ENSBTAP00000039694  ....ATGL..KLSPHL...........VNTVFKIF....DV....DK....DDQ....LSYKEFIGIM----------
ENSBTAP00000025205  ....ELP-..-LSLED...........LEDVFDTL....DA....DG....NGF....LTPEEFTTGFS---------
ENSBTAP00000047882  ....PMNE..DELINL...........IDGVLRDD....DK....NN....DGY....IDYAEFAK------------
ENSBTAP00000001368  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000029786  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000028993  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000023678  ....SYQL..PVDDSL...........IKELIRMC....-S....HG....EDK....IDYYNFVRAF----------
ENSBTAP00000034710  ....NVGV..QLSPQE...........MCEALRQA....DL....DG....DGT....VSFKDFLGVLTDSHR-----
ENSBTAP00000031823  ....EPGE..EFHDVEdaetykkmlarDERRFRVA....DQ....DG....DSM....ATREELTAFL----------
ENSBTAP00000038002  ....DWDV..SELRPI...........LQEMMKEI....DY....DG....SGS....VSLAEWLR------------
ENSBTAP00000021074  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000026544  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000007217  ....GNGR..WMTPET...........IQEMYSAIka..DP....DG....DGV....LSLQEFSNMD----------
ENSBTAP00000029792  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000044088  ....ATGQ..ELSNNI...........LDTVFKIF....DL....DG....DEC....LSHEEFLGVL----------
ENSBTAP00000017319  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000044100  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000033594  ....VVNE..SHHDVL...........VEDIFDKE....DE....DK....DGF....ISAREF--------------
ENSBTAP00000026766  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000055894  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000015220  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000033613  ....GFD-..--AEMI...........VKNMFTNQ....DR....NG....DGK....VTAEEFK-------------
ENSBTAP00000056320  ....ALPF..E---DC...........MCQMLDLV....KP....QT....EGR....ITLQDLKRCKLANVFFDTFF
ENSBTAP00000025249  ....CQGE..HYTYDE...........ILSIIQKFepsvSM....CH....QGL....MSFEGFARFLMD--------
ENSBTAP00000029159  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000044088  ....ATGQ..ELSNNI...........LDTVFKIF....DL....DG....DEC....LSHEEFLGVLK---------
ENSBTAP00000016319  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000017662  ....LVGI..SLTTAQ...........VEGALRSA....DI....DG....DGH....VNFKDFLTVMT---------
ENSBTAP00000012479  ....KHGL..YLTLSL...........LETLLNHQ....DL....GY....QNE....IKWENFVEWL----------
ENSBTAP00000029886  ....ENNK..LLRGLC...........VDALIELS....DE....NA....DWK....LSFQEFLKCL----------
ENSBTAP00000027388  ....KLGV..PKTHLE...........LKKLIMEV....SS....GP....GET....FSYSDFLKMM----------
ENSBTAP00000039694  ....ADDI..TNLVTD...........TTLLVHFF....GK....KG....KAE....LNFEDFYRFM----------
ENSBTAP00000023673  ....QSDL..PLTPEQ...........LEAVFESL....DQ....AH....TGF....LTAREFCL------------
ENSBTAP00000041488  ....QSDL..PLTPEQ...........LEAVFESL....DQ....AH....TGF....LTAREFCL------------
ENSBTAP00000001452  ....PRDQ..SYQTAV...........LEDFFKKN....DH....DG....DGF....ISSKEY--------------
ENSBTAP00000028498  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000001426  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000020240  ....-SHK..HYTQSE...........TEFLLSCA....ET....DE....NET....LDYEEFVK------------
ENSBTAP00000053650  ....-SHK..HYTQSE...........TEFLLSCA....ET....DE....NET....LDYEEFVK------------
ENSBTAP00000041651  ....SPTT..NPVILV...........VDKVLETQ....DL....NG....DGL....MTPAELVN------------
ENSBTAP00000005154  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000021174  ....D---..------...........--------....--....--....---....--------------------
ENSBTAP00000022068  ....VYG-..---AEQ...........VTDLTRYL....DP....SG....LGV....ISFEDFYRGI----------
ENSBTAP00000026682  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000007636  ....VAKV..ELSDHV...........CDVVFALF....DC....DG....NGE....LSNKEFVSIM----------
ENSBTAP00000027954  ....SHSS..KLDPHK...........REVLLALA....DS....HA....NGQ....ICYQDFVNLM----------
ENSBTAP00000020778  ....AEHF..QEAVAE...........SRAHFRAV....DP....DG....DGH....VSWDEYK-------------
ENSBTAP00000013601  ....SSG-..-LPRET...........LGQIWALA....NR....TT....PGK....LTKEELYAVL----------
ENSBTAP00000005477  ....TKGE..HMTEEE...........MTDCFAT-....--....--....---....--------------------
ENSBTAP00000055305  ....-GQK..QYTQSE...........IDFLLSCA....EA....DE....NDM....FNYIDFVD------------
ENSBTAP00000036054  ....-GQK..QYTQSE...........IDFLLSCA....EA....DE....NDM....FNYIDFVD------------
ENSBTAP00000004912  ....KFGQ..-VTPME...........VDILFQLA....D-....--....---....--------------------
ENSBTAP00000022292  ....--RS..HM----...........--------....--....--....---....--------------------
ENSBTAP00000002717  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000036015  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000051638  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000026766  ....VVDG..KVP-DT...........LRKC----....-F....SE....GEK....VNYEKFRNWLLLNKDAFTF-
ENSBTAP00000053738  ....ECGC..SLKEEE...........LIDLLNRT....SWgia.WH....NNS....INYLDFLRAVE---------
ENSBTAP00000016306  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000013714  ....ALDL..VSDPEY...........INLMKNKL....DP....EG....LGI....ILLGPFL-------------
ENSBTAP00000036550  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000053738  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000023383  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000027030  ....EEGI..ENSQ--...........--EILKAL....DF....SL....DGN....VNLTELTLAL----------
ENSBTAP00000053270  ....EEGI..ENSQ--...........--EILKAL....DF....SL....DGN....VNLTELTLAL----------
ENSBTAP00000054640  ....EEGI..ENSQ--...........--EILKAL....DF....SL....DGN....VNLTELTLAL----------
ENSBTAP00000012770  ....EKSFysFYVCTA...........VRKFFFFL....DP....LR....TGK....IKIQDILAC-----------
ENSBTAP00000009967  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000015183  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000014222  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000026288  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000002128  ....SMDI..LVVPET...........LQEVIKYA....DI....NS....NQM....VDIGDI--------------
ENSBTAP00000003365  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000053738  ....TFVY..RLPRRI...........FIQLMKRF....GL....KT....TTK....VNWKQFLT------------
ENSBTAP00000009228  ....-SQK..QFTGPE...........IQFLLSCS....EA....DE....NEM....INCEEFAN------------
ENSBTAP00000026785  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000002578  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000000106  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000028840  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000053594  ....NSSG..ANLQGE...........LSHIIRQ-....--....--....---....--------------------
ENSBTAP00000055414  ....TYKE..------...........--------....--....--....---....--------------------
ENSBTAP00000026698  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000017015  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000049908  ....TLGL..HLSRAQ...........VKKLLNKV....--....--....---....--------------------
ENSBTAP00000021395  ....----..------...........--------....--....--....---....--------------------
ENSBTAP00000007194  ....TLGL..RLSAEQ...........AKQLVSR-....--....--....---....--------------------
ENSBTAP00000025455  ....TYKE..GM----...........--------....--....--....---....--------------------


                      0                                                                             
                      |                                                                             
d1bjfa_               --qc..........................................................................
ENSBTAP00000019411  --............................................................................
ENSBTAP00000036057  --............................................................................
ENSBTAP00000038404  --g...........................................................................
ENSBTAP00000010971  --g...........................................................................
ENSBTAP00000019803  K-sldkdgtgqiqvniqewlqltm......................................................
ENSBTAP00000014038  --v...........................................................................
ENSBTAP00000002055  --............................................................................
ENSBTAP00000049731  --............................................................................
ENSBTAP00000005577  --qc..........................................................................
ENSBTAP00000034949  --g...........................................................................
ENSBTAP00000017447  --vfldrlely...................................................................
ENSBTAP00000010858  --............................................................................
ENSBTAP00000046644  --eengvvspekldl...............................................................
ENSBTAP00000022814  --lq..........................................................................
ENSBTAP00000019758  --kdidkdl.....................................................................
ENSBTAP00000019321  --qc..........................................................................
ENSBTAP00000011677  N-afdkdgdgiiklnvlewlqltmy.....................................................
ENSBTAP00000011680  N-afdkdgdgiiklnvlewlqltm......................................................
ENSBTAP00000021742  Q-lfdn........................................................................
ENSBTAP00000005348  --eikeedidenll................................................................
ENSBTAP00000016609  --ylggeengilpleald............................................................
ENSBTAP00000012740  --g...........................................................................
ENSBTAP00000018403  --q...........................................................................
ENSBTAP00000026407  --krfkgkskeeafdaicqlvagkepanvgvtkaktggaverltdtskytgshker......................
ENSBTAP00000052557  --k...........................................................................
ENSBTAP00000054167  Q-lf..........................................................................
ENSBTAP00000010319  --t...........................................................................
ENSBTAP00000041545  --cskdgdifnptchply............................................................
ENSBTAP00000055204  R-rydtdqdgwiqvsyeqylsmv.......................................................
ENSBTAP00000003718  --qlfq........................................................................
ENSBTAP00000011676  R-lldkdqngivqlslaewlccv.......................................................
ENSBTAP00000049395  --eeeagpalalslieryepsetakaqrqmtkdgflmyllsadgsafdlahrrvy.......................
ENSBTAP00000054983  --saeeavrevhkliegkapiisgvtkaissptvsrltdtskftgshker............................
ENSBTAP00000052219  R-rrdtaqqgvvnfpyddfiqcvms.....................................................
ENSBTAP00000025402  --qkqrdsrlnsllfpparpdqvqglidkyepsginvqrgqlspegmvwflcgpensvlaqdkl..............
ENSBTAP00000011678  K-tldtdldgvvtfdlfkwlqltm......................................................
ENSBTAP00000000433  --egkdpattgvtkattvggvsrltdtskytgthker.........................................
ENSBTAP00000021491  --t...........................................................................
ENSBTAP00000044733  K-qldpentgmiqldliswlsf........................................................
ENSBTAP00000010937  --spacdifnplhhevy.............................................................
ENSBTAP00000056439  --spacdifnplhhevy.............................................................
ENSBTAP00000055780  --g...........................................................................
ENSBTAP00000038002  --t...........................................................................
ENSBTAP00000034705  --pegaaldlahtrvf..............................................................
ENSBTAP00000035936  Q-mdln........................................................................
ENSBTAP00000013699  R-ekdtavqgsvrlsfedfvtmt.......................................................
ENSBTAP00000002564  --lcg.........................................................................
ENSBTAP00000011496  --lslydg......................................................................
ENSBTAP00000019111  --t...........................................................................
ENSBTAP00000017036  --lt..........................................................................
ENSBTAP00000003213  --ytrspagdifnpehrlv...........................................................
ENSBTAP00000055444  --ytrspagdifnpehrlv...........................................................
ENSBTAP00000024550  R-rrdhlqqgvvsfvyddflqgtm......................................................
ENSBTAP00000015248  --h...........................................................................
ENSBTAP00000021328  --h...........................................................................
ENSBTAP00000037091  --h...........................................................................
ENSBTAP00000029967  --............................................................................
ENSBTAP00000021449  --s...........................................................................
ENSBTAP00000053176  --m...........................................................................
ENSBTAP00000042361  --............................................................................
ENSBTAP00000016509  Q-mdln........................................................................
ENSBTAP00000026714  --............................................................................
ENSBTAP00000004690  --tayfltmdpentgqisldlnqwlqitm.................................................
ENSBTAP00000010858  --lepqsmvwlpvlhrvaaaet........................................................
ENSBTAP00000013117  --cyifdpehkkvc................................................................
ENSBTAP00000017574  --llfdnkcdhvy.................................................................
ENSBTAP00000004885  --vtdieeiirfwkhstgidigdsltipdefte.............................................
ENSBTAP00000008961  --wssllrnwnslav...............................................................
ENSBTAP00000028063  --g...........................................................................
ENSBTAP00000012740  --pqsmvwlpvlhrvaaaet..........................................................
ENSBTAP00000006283  --r...........................................................................
ENSBTAP00000014306  --l...........................................................................
ENSBTAP00000053252  --ecnifdpeqskv................................................................
ENSBTAP00000014304  --l...........................................................................
ENSBTAP00000045669  --g...........................................................................
ENSBTAP00000041264  --wptllknwqllav...............................................................
ENSBTAP00000006711  --qkprqktpehpkegasnseasgadsdiqnadnaakadeacapdmetkitekqvpaknqaaatpvgnlvapssgses
ENSBTAP00000017358  --wgsilrnwnflav...............................................................
ENSBTAP00000053274  --g...........................................................................
ENSBTAP00000055296  --wgsilrnwnflav...............................................................
ENSBTAP00000016852  --gvsasidtdvyfivmmrtaw........................................................
ENSBTAP00000036380  --kl..........................................................................
ENSBTAP00000041719  --l...........................................................................
ENSBTAP00000049636  --m...........................................................................
ENSBTAP00000024444  --g...........................................................................
ENSBTAP00000004556  --pgglpcqne...................................................................
ENSBTAP00000038767  --vdveq.......................................................................
ENSBTAP00000031285  --kppclae.....................................................................
ENSBTAP00000011457  G-pclpdpks....................................................................
ENSBTAP00000011047  --m...........................................................................
ENSBTAP00000002564  --rscfrfstgkpvieasqflewvnlepqsmvwlavlhrvtiae..................................
ENSBTAP00000037104  --hg..........................................................................
ENSBTAP00000002672  --hg..........................................................................
ENSBTAP00000028269  --hg..........................................................................
ENSBTAP00000016647  --ekmnieqkm...................................................................
ENSBTAP00000004536  --hslenvedvlyfwkhs............................................................
ENSBTAP00000042177  --gatreevkad..................................................................
ENSBTAP00000028063  --qclvwlplmhrlahven...........................................................
ENSBTAP00000050283  --m...........................................................................
ENSBTAP00000048539  --ssyldl......................................................................
ENSBTAP00000045669  --qclvwlpllhrlanven...........................................................
ENSBTAP00000007972  --vsasmdtdeefvammtsa..........................................................
ENSBTAP00000040815  --gvskeg......................................................................
ENSBTAP00000025661  --ttyldlqt....................................................................
ENSBTAP00000028350  K-i...........................................................................
ENSBTAP00000053274  --qclvwlpllhrlanven...........................................................
ENSBTAP00000021537  H-i...........................................................................
ENSBTAP00000055481  --dvamsgqplppvlppeyippsfr.....................................................
ENSBTAP00000039155  --v...........................................................................
ENSBTAP00000029333  --dvamsgqplppvlppeyippsfr.....................................................
ENSBTAP00000016315  --rkngyplpeglpptlqpey.........................................................
ENSBTAP00000021091  Q-nltqdgkgiy..................................................................
ENSBTAP00000021618  --elrftqlcv...................................................................
ENSBTAP00000055520  --apaaaalitlsg................................................................
ENSBTAP00000055624  --apaaaalitlsg................................................................
ENSBTAP00000016319  --rkngydlpeklpeslmpkl.........................................................
ENSBTAP00000034078  --............................................................................
ENSBTAP00000006645  R-ihfw........................................................................
ENSBTAP00000021909  --kydlfvgsqatdfgeal...........................................................
ENSBTAP00000001426  --l...........................................................................
ENSBTAP00000015802  --venipeiilywkhs..............................................................
ENSBTAP00000032680  --venipeiilywkhs..............................................................
ENSBTAP00000055007  --............................................................................
ENSBTAP00000020148  --aiachesfiksa................................................................
ENSBTAP00000052345  --linqklikgidpphiltpemipp.....................................................
ENSBTAP00000029334  --tdmakagqplplalppelvppsfr....................................................
ENSBTAP00000052345  --vycalekepvpmslppalvppskr....................................................
ENSBTAP00000056127  --nwnmfvgsqatnygedl...........................................................
ENSBTAP00000012557  --yv..........................................................................
ENSBTAP00000011888  --nl..........................................................................
ENSBTAP00000017060  --lekepvpsvlppslippskr........................................................
ENSBTAP00000031854  --ah..........................................................................
ENSBTAP00000031823  --gnwnmfvgsqatnygedl..........................................................
ENSBTAP00000021603  --selrrtqlc...................................................................
ENSBTAP00000010838  --dyhnhshgaqlc................................................................
ENSBTAP00000014575  --r...........................................................................
ENSBTAP00000011215  --ah..........................................................................
ENSBTAP00000053698  --i...........................................................................
ENSBTAP00000006806  --vacnnffw....................................................................
ENSBTAP00000029334  --lklqgqqlpvvlppimkqpp........................................................
ENSBTAP00000044105  --dyhnhshgaqlc................................................................
ENSBTAP00000026904  --vacndyfveql.................................................................
ENSBTAP00000017060  --fiqqkvskgidppqvlspdmvppser..................................................
ENSBTAP00000055520  --qiptvvgesralcsvesatrscfqgvlspvikeekflswlqseppillwiptcyrlsatem...............
ENSBTAP00000044226  --vacnnffw....................................................................
ENSBTAP00000055624  --qiptvvgesralcsvesatrscfqgvlspvikeekflswlqseppillwiptcyrlsatem...............
ENSBTAP00000042182  --icvfrycsqhldggegvvclthrqwmq.................................................
ENSBTAP00000010796  --f...........................................................................
ENSBTAP00000021174  --p...........................................................................
ENSBTAP00000006275  --acheff......................................................................
ENSBTAP00000020950  --nqdlfltseatdygrqlhd.........................................................
ENSBTAP00000053738  --f...........................................................................
ENSBTAP00000004963  --slhqqsp.....................................................................
ENSBTAP00000023774  --m...........................................................................
ENSBTAP00000020395  --reqadycvshmkpyvdgkgrelptafdyvef.............................................
ENSBTAP00000020150  --tiacndyfvv..................................................................
ENSBTAP00000025561  --mmcneffeg...................................................................
ENSBTAP00000053738  --k...........................................................................
ENSBTAP00000034009  --ahidihk.....................................................................
ENSBTAP00000020539  --rl..........................................................................
ENSBTAP00000020778  --ysefftgsklvdyar.............................................................
ENSBTAP00000017461  --sd..........................................................................
ENSBTAP00000044096  --mhntap......................................................................
ENSBTAP00000008523  --mhntap......................................................................
ENSBTAP00000035196  --yipwgpdvnntvgtnekgwityqgflsqwtl.............................................
ENSBTAP00000041997  --likvkleghelpnelpahlvppskr...................................................
ENSBTAP00000025499  --lv..........................................................................
ENSBTAP00000055481  --lklqgyqlpsalppvmkqq.........................................................
ENSBTAP00000002174  --likvkleghelpadlpphlvppskr...................................................
ENSBTAP00000000589  --imcndffq....................................................................
ENSBTAP00000028239  --ieakleghglptnlprrlvppskr....................................................
ENSBTAP00000014894  --pdqaeyciarm.................................................................
ENSBTAP00000026544  --l...........................................................................
ENSBTAP00000029333  --lklqgyqlpsalppvmkqq.........................................................
ENSBTAP00000041966  Q-nlskdgkglyltemewmnlvm.......................................................
ENSBTAP00000008933  --khlikiklsgyelpsslpphlvppshr.................................................
ENSBTAP00000056088  --tah.........................................................................
ENSBTAP00000033794  --rqlcahyc....................................................................
ENSBTAP00000012786  --pdqaqycikrmp................................................................
ENSBTAP00000030018  --aeqaeycirrm.................................................................
ENSBTAP00000040233  --nl..........................................................................
ENSBTAP00000003365  --a...........................................................................
ENSBTAP00000053176  --g...........................................................................
ENSBTAP00000024301  --ppdqa.......................................................................
ENSBTAP00000022292  --qe..........................................................................
ENSBTAP00000015611  --amacnkv.....................................................................
ENSBTAP00000012770  --............................................................................
ENSBTAP00000000847  --mayndffle...................................................................
ENSBTAP00000053738  --nl..........................................................................
ENSBTAP00000054975  --............................................................................
ENSBTAP00000046639  --y...........................................................................
ENSBTAP00000052345  --vacaqnglevslsslnlavppprfhd..................................................
ENSBTAP00000053164  --wkdktplkeyeekvlikgrkadcanpaeanveesepalllkpedivlkepgssektlrtllrpsdkvsnhykttss
ENSBTAP00000016774  --vgleaheeihk.................................................................
ENSBTAP00000022630  --kk..........................................................................
ENSBTAP00000010796  --sf..........................................................................
ENSBTAP00000021909  --l...........................................................................
ENSBTAP00000033974  --a...........................................................................
ENSBTAP00000006711  --llgmddsg....................................................................
ENSBTAP00000010796  --ve..........................................................................
ENSBTAP00000004912  --le..........................................................................
ENSBTAP00000005979  --vfpaapwgphlpstvrtkagrlplhgylcqwtl...........................................
ENSBTAP00000053738  --sf..........................................................................
ENSBTAP00000053746  --dietkmhvrf..................................................................
ENSBTAP00000023221  --t...........................................................................
ENSBTAP00000019429  --kaa.........................................................................
ENSBTAP00000052019  --qacyh.......................................................................
ENSBTAP00000042244  --gelqe.......................................................................
ENSBTAP00000053738  --gi..........................................................................
ENSBTAP00000018877  --itspianli...................................................................
ENSBTAP00000053019  --i...........................................................................
ENSBTAP00000003073  --st..........................................................................
ENSBTAP00000012886  --............................................................................
ENSBTAP00000044222  --iycheyfk....................................................................
ENSBTAP00000028499  --eirk........................................................................
ENSBTAP00000047378  --glf.........................................................................
ENSBTAP00000009308  --kstevaktfrk.................................................................
ENSBTAP00000017060  --lvacaqsghevtlsnlnlnmpppkfhd.................................................
ENSBTAP00000050406  --pd..........................................................................
ENSBTAP00000031879  --pd..........................................................................
ENSBTAP00000031854  --k...........................................................................
ENSBTAP00000001250  --aeeylyp.....................................................................
ENSBTAP00000026035  --acfet.......................................................................
ENSBTAP00000011215  --k...........................................................................
ENSBTAP00000002128  --eltev.......................................................................
ENSBTAP00000053194  --peq.........................................................................
ENSBTAP00000056127  --h...........................................................................
ENSBTAP00000033188  --pnkd........................................................................
ENSBTAP00000053548  --pnkd........................................................................
ENSBTAP00000011687  --f...........................................................................
ENSBTAP00000007636  --k...........................................................................
ENSBTAP00000020950  --f...........................................................................
ENSBTAP00000009115  --td..........................................................................
ENSBTAP00000023873  --............................................................................
ENSBTAP00000054471  --hfffsqnn....................................................................
ENSBTAP00000039694  --k...........................................................................
ENSBTAP00000025205  --hfffsqnn....................................................................
ENSBTAP00000047882  --s...........................................................................
ENSBTAP00000001368  --rss.........................................................................
ENSBTAP00000029786  --............................................................................
ENSBTAP00000028993  --f...........................................................................
ENSBTAP00000023678  --s...........................................................................
ENSBTAP00000034710  --laqclgkvrnswaydpqglqtlflemlfklmsl...........................................
ENSBTAP00000031823  --h...........................................................................
ENSBTAP00000038002  --a...........................................................................
ENSBTAP00000021074  --vcyldtqsl...................................................................
ENSBTAP00000026544  --lflh........................................................................
ENSBTAP00000007217  --lrdfhkymrshraessqlvrnshhtwly................................................
ENSBTAP00000029792  --............................................................................
ENSBTAP00000044088  --k...........................................................................
ENSBTAP00000017319  --vtim........................................................................
ENSBTAP00000044100  --lhckmgpgfvhnf...............................................................
ENSBTAP00000033594  --t...........................................................................
ENSBTAP00000026766  --k...........................................................................
ENSBTAP00000055894  --l...........................................................................
ENSBTAP00000015220  --k...........................................................................
ENSBTAP00000033613  --............................................................................
ENSBTAP00000056320  --n...........................................................................
ENSBTAP00000025249  --kdnfa.......................................................................
ENSBTAP00000029159  --ra..........................................................................
ENSBTAP00000044088  --n...........................................................................
ENSBTAP00000016319  --klvavaqsgfplrvesintvkdlp....................................................
ENSBTAP00000017662  --dtrrf.......................................................................
ENSBTAP00000012479  --............................................................................
ENSBTAP00000029886  --............................................................................
ENSBTAP00000027388  --l...........................................................................
ENSBTAP00000039694  --dn..........................................................................
ENSBTAP00000023673  --gl..........................................................................
ENSBTAP00000041488  --gl..........................................................................
ENSBTAP00000001452  --nvy.........................................................................
ENSBTAP00000028498  --ge..........................................................................
ENSBTAP00000001426  --dly.........................................................................
ENSBTAP00000020240  --rf..........................................................................
ENSBTAP00000053650  --rf..........................................................................
ENSBTAP00000041651  --f...........................................................................
ENSBTAP00000005154  --gvdghpadnleteklcdyfsehlg....................................................
ENSBTAP00000021174  --ldinniptykksi...............................................................
ENSBTAP00000022068  --eairngdpds..................................................................
ENSBTAP00000026682  --hqqm........................................................................
ENSBTAP00000007636  --k...........................................................................
ENSBTAP00000027954  --............................................................................
ENSBTAP00000020778  --v...........................................................................
ENSBTAP00000013601  --amiaatqrgv..................................................................
ENSBTAP00000005477  --lfglnpe.....................................................................
ENSBTAP00000055305  --rf..........................................................................
ENSBTAP00000036054  --rf..........................................................................
ENSBTAP00000004912  --l...........................................................................
ENSBTAP00000022292  --ltpfveenlvsaaggsishqvsfsyfnafnsllnnmelvrkiystlagtrkdvevtkeefa...............
ENSBTAP00000002717  --heqqelwaqdlnkvrermtkfiddtmretaepflfvdefltylfsrensiwdekydvv..................
ENSBTAP00000036015  --ildkveegafvkehfdelcwtltakknyqvdsngnsmlsnqdafrlwclfn.........................
ENSBTAP00000051638  --lh..........................................................................
ENSBTAP00000026766  --srwlls......................................................................
ENSBTAP00000053738  --nnk.........................................................................
ENSBTAP00000016306  --hs..........................................................................
ENSBTAP00000013714  --qe..........................................................................
ENSBTAP00000036550  --............................................................................
ENSBTAP00000053738  --klgykkegmsyldfa.............................................................
ENSBTAP00000023383  --saqktmdlpfleasalragerpelcrvslpefqqflleyqgelwavdrlqvqefmlsflrdplreieepyffldef
ENSBTAP00000027030  --enellv......................................................................
ENSBTAP00000053270  --enellv......................................................................
ENSBTAP00000054640  --enellv......................................................................
ENSBTAP00000012770  --sfld........................................................................
ENSBTAP00000009967  --glwftgd.....................................................................
ENSBTAP00000015183  --ltlyekd.....................................................................
ENSBTAP00000014222  --kl..........................................................................
ENSBTAP00000026288  --............................................................................
ENSBTAP00000002128  --ift.........................................................................
ENSBTAP00000003365  --eltrqgfmdlnl................................................................
ENSBTAP00000053738  --s...........................................................................
ENSBTAP00000009228  --rf..........................................................................
ENSBTAP00000026785  --lvdkedvhistsqvaeiva.........................................................
ENSBTAP00000002578  --ltknplfiteedafkiwvifnflsedkypliivpeeieyllkklteamgvswqqeqfenykinfddskdg......
ENSBTAP00000000106  --l...........................................................................
ENSBTAP00000028840  --mdnlastykqwsla..............................................................
ENSBTAP00000053594  --l...........................................................................
ENSBTAP00000055414  --gmekesmkk...................................................................
ENSBTAP00000026698  --............................................................................
ENSBTAP00000017015  --heslll......................................................................
ENSBTAP00000049908  --............................................................................
ENSBTAP00000021395  --rnl.........................................................................
ENSBTAP00000007194  --a...........................................................................
ENSBTAP00000025455  --ekesmkk.....................................................................


                                                                                                    
                                                                                                    
d1bjfa_               ..............................................................................
ENSBTAP00000019411  ..............................................................................
ENSBTAP00000036057  ..............................................................................
ENSBTAP00000038404  ..............................................................................
ENSBTAP00000010971  ..............................................................................
ENSBTAP00000019803  ..............................................................................
ENSBTAP00000014038  ..............................................................................
ENSBTAP00000002055  ..............................................................................
ENSBTAP00000049731  ..............................................................................
ENSBTAP00000005577  ..............................................................................
ENSBTAP00000034949  ..............................................................................
ENSBTAP00000017447  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000046644  ..............................................................................
ENSBTAP00000022814  ..............................................................................
ENSBTAP00000019758  ..............................................................................
ENSBTAP00000019321  ..............................................................................
ENSBTAP00000011677  ..............................................................................
ENSBTAP00000011680  ..............................................................................
ENSBTAP00000021742  ..............................................................................
ENSBTAP00000005348  ..............................................................................
ENSBTAP00000016609  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000018403  ..............................................................................
ENSBTAP00000026407  ..............................................................................
ENSBTAP00000052557  ..............................................................................
ENSBTAP00000054167  ..............................................................................
ENSBTAP00000010319  ..............................................................................
ENSBTAP00000041545  ..............................................................................
ENSBTAP00000055204  ..............................................................................
ENSBTAP00000003718  ..............................................................................
ENSBTAP00000011676  ..............................................................................
ENSBTAP00000049395  ..............................................................................
ENSBTAP00000054983  ..............................................................................
ENSBTAP00000052219  ..............................................................................
ENSBTAP00000025402  ..............................................................................
ENSBTAP00000011678  ..............................................................................
ENSBTAP00000000433  ..............................................................................
ENSBTAP00000021491  ..............................................................................
ENSBTAP00000044733  ..............................................................................
ENSBTAP00000010937  ..............................................................................
ENSBTAP00000056439  ..............................................................................
ENSBTAP00000055780  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000034705  ..............................................................................
ENSBTAP00000035936  ..............................................................................
ENSBTAP00000013699  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000011496  ..............................................................................
ENSBTAP00000019111  ..............................................................................
ENSBTAP00000017036  ..............................................................................
ENSBTAP00000003213  ..............................................................................
ENSBTAP00000055444  ..............................................................................
ENSBTAP00000024550  ..............................................................................
ENSBTAP00000015248  ..............................................................................
ENSBTAP00000021328  ..............................................................................
ENSBTAP00000037091  ..............................................................................
ENSBTAP00000029967  ..............................................................................
ENSBTAP00000021449  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000042361  ..............................................................................
ENSBTAP00000016509  ..............................................................................
ENSBTAP00000026714  ..............................................................................
ENSBTAP00000004690  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000013117  ..............................................................................
ENSBTAP00000017574  ..............................................................................
ENSBTAP00000004885  ..............................................................................
ENSBTAP00000008961  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000006283  ..............................................................................
ENSBTAP00000014306  ..............................................................................
ENSBTAP00000053252  ..............................................................................
ENSBTAP00000014304  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000041264  ..............................................................................
ENSBTAP00000006711  pivylkdvvcylsllesgrpqdklefm...................................................
ENSBTAP00000017358  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000055296  ..............................................................................
ENSBTAP00000016852  ..............................................................................
ENSBTAP00000036380  ..............................................................................
ENSBTAP00000041719  ..............................................................................
ENSBTAP00000049636  ..............................................................................
ENSBTAP00000024444  ..............................................................................
ENSBTAP00000004556  ..............................................................................
ENSBTAP00000038767  ..............................................................................
ENSBTAP00000031285  ..............................................................................
ENSBTAP00000011457  ..............................................................................
ENSBTAP00000011047  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000037104  ..............................................................................
ENSBTAP00000002672  ..............................................................................
ENSBTAP00000028269  ..............................................................................
ENSBTAP00000016647  ..............................................................................
ENSBTAP00000004536  ..............................................................................
ENSBTAP00000042177  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000050283  ..............................................................................