SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

EF-hand alignments in Bos taurus 76_3.1

These alignments are sequences aligned to the 0036390 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1df0a1               eieaniee......................................................................
ENSBTAP00000019411  m.............................................................................
ENSBTAP00000036057  m.............................................................................
ENSBTAP00000038404  lrpevmqd......................................................................
ENSBTAP00000010971  lrpemlqdlr....................................................................
ENSBTAP00000019803  ggggggggtamrilggvisaiseaaaqynpepvpp...........................................
ENSBTAP00000014038  le............................................................................
ENSBTAP00000002055  a.............................................................................
ENSBTAP00000049731  a.............................................................................
ENSBTAP00000005577  mgkqnsklrpevlqdlr.............................................................
ENSBTAP00000034949  lskeileelqln..................................................................
ENSBTAP00000017447  vspmtclkkhwmklafmtntngkipvrsitrtfasgktekvifqalkelglpsgkndeiepaaftyekfyeltqkicp
ENSBTAP00000010858  hpkmtelyqsladlnnvrfsayrtamklrrlqkalcldllslsaacdaldqhnlkqndqpmdilqiinclttiydrle
ENSBTAP00000046644  srdaflekaytklklqvtpegriplkniyrlfsadrkrvetaleacslpssrndsipqedftpevyrvflnnlcprp.
ENSBTAP00000022814  mgkqnsklapevmedl..............................................................
ENSBTAP00000019758  ppcldseltefplrmrdwlknvlvtlyerdednnlltekqklrvkkihenekrleagdhpvellardfeknynmyifp
ENSBTAP00000019321  mgktnsklapevledl..............................................................
ENSBTAP00000011677  pqlepgn.......................................................................
ENSBTAP00000011680  ntd...........................................................................
ENSBTAP00000021742  rpegleqlqeqtkf................................................................
ENSBTAP00000005348  pactdfevtqfplrmrdwlknilvqlyepnpehsgylnekqrnkvkkiyldekrllagdhsidlllrdfkknyhmyvy
ENSBTAP00000016609  srntflrkaytklklqv.............................................................
ENSBTAP00000012740  hpkmtelfqsladlnnvrfsayrtaikirrlqkalcldlleln...................................
ENSBTAP00000018403  a.............................................................................
ENSBTAP00000026407  astdv.........................................................................
ENSBTAP00000052557  p.............................................................................
ENSBTAP00000054167  rpealelleaqskf................................................................
ENSBTAP00000010319  anmasttqrk....................................................................
ENSBTAP00000041545  erl...........................................................................
ENSBTAP00000055204  sf............................................................................
ENSBTAP00000003718  leqleaqtnf....................................................................
ENSBTAP00000011676  q.............................................................................
ENSBTAP00000049395  qklrhw........................................................................
ENSBTAP00000054983  lsaleeafrkfavhgdarasgremhgknwsklcrdcqvidgrs...................................
ENSBTAP00000052219  dp............................................................................
ENSBTAP00000025402  srstfldkilvklkmqlnpegkipvknfqmfpadrkrveaalsach................................
ENSBTAP00000011678  anlpdeqvl.....................................................................
ENSBTAP00000000433  ertfqrfavfgessssgtemnnknfsklckdcgimdgktvtstdvdi...............................
ENSBTAP00000021491  srpssdqwkkn...................................................................
ENSBTAP00000044733  se............................................................................
ENSBTAP00000010937  rt............................................................................
ENSBTAP00000056439  rt............................................................................
ENSBTAP00000055780  av............................................................................
ENSBTAP00000038002  maker.........................................................................
ENSBTAP00000034705  erldh.........................................................................
ENSBTAP00000035936  qqfsweeveengavg...............................................................
ENSBTAP00000013699  gvp...........................................................................
ENSBTAP00000002564  hpkmtelyqtlaadlnni............................................................
ENSBTAP00000011496  ykgfik........................................................................
ENSBTAP00000019111  ..............................................................................
ENSBTAP00000017036  elsst.........................................................................
ENSBTAP00000003213  rtr...........................................................................
ENSBTAP00000055444  rtr...........................................................................
ENSBTAP00000024550  p.............................................................................
ENSBTAP00000015248  ..............................................................................
ENSBTAP00000021328  ..............................................................................
ENSBTAP00000037091  ..............................................................................
ENSBTAP00000029967  e.............................................................................
ENSBTAP00000021449  giaekqre......................................................................
ENSBTAP00000053176  ekwahlspsefsqlqkyaeystkklkdvleefhgngvlakynpegkqdil............................
ENSBTAP00000042361  s.............................................................................
ENSBTAP00000016509  qqfsweeveengavg...............................................................
ENSBTAP00000026714  l.............................................................................
ENSBTAP00000004690  et............................................................................
ENSBTAP00000010858  hled..........................................................................
ENSBTAP00000013117  nmrtsw........................................................................
ENSBTAP00000017574  kwfllmvr......................................................................
ENSBTAP00000004885  ptaacq........................................................................
ENSBTAP00000008961  tfritkadaae...................................................................
ENSBTAP00000028063  emraqnfdvirlstyrtacklrfvqkrcnlhlvdiwn.........................................
ENSBTAP00000012740  leekyrylfkevagptemcdqrqlglllhdaiqiprqlgevaafggsniepsvrscfqqn..................
ENSBTAP00000006283  r.............................................................................
ENSBTAP00000014306  ..............................................................................
ENSBTAP00000053252  tprfm.........................................................................
ENSBTAP00000014304  ..............................................................................
ENSBTAP00000045669  qlfaemraqdldrirlstyrtacklrfvqkkcnlhlvdiwnviealrenalnnvdpnmelnvarleavlstifyqlnk
ENSBTAP00000041264  tyqltkvsahtfwrercgar..........................................................
ENSBTAP00000006711  drwvs.........................................................................
ENSBTAP00000017358  fritkadaa.....................................................................
ENSBTAP00000053274  qlfaemraqdldrirlstyrtacklrfvqkkcnlhlvdiwnviealrenalnnvdpnmelnvarleavlstifyqlnk
ENSBTAP00000055296  fritkadaa.....................................................................
ENSBTAP00000016852  i.............................................................................
ENSBTAP00000036380  ..............................................................................
ENSBTAP00000041719  ..............................................................................
ENSBTAP00000049636  ..............................................................................
ENSBTAP00000024444  f.............................................................................
ENSBTAP00000004556  ctdkelrnlasr..................................................................
ENSBTAP00000038767  mgsrastllrdeeleeik............................................................
ENSBTAP00000031285  tctgqdladlgdrlrdwfqllhenskqngsansgaspasgldks..................................
ENSBTAP00000011457  knckhfskfevkclinlfynlvgevterqgviig............................................
ENSBTAP00000011047  ..............................................................................
ENSBTAP00000002564  vkeklqylfsqvansgsqcdqrhlgvllheaiqv............................................
ENSBTAP00000037104  ..............................................................................
ENSBTAP00000002672  f.............................................................................
ENSBTAP00000028269  ..............................................................................
ENSBTAP00000016647  shaaripdvdsl..................................................................
ENSBTAP00000004536  a.............................................................................
ENSBTAP00000042177  qgcpgakkrefltsvldalstdmvhavsdpsspgrlsepdpshtleer..............................
ENSBTAP00000028063  ml............................................................................
ENSBTAP00000050283  ty............................................................................
ENSBTAP00000048539  eftk..........................................................................
ENSBTAP00000045669  kim...........................................................................
ENSBTAP00000007972  i.............................................................................
ENSBTAP00000040815  pgcpegkklefitslldalttdmvqainsaaptgggrfsepdpshtleer............................
ENSBTAP00000025661  eftk..........................................................................
ENSBTAP00000028350  kellaeyqdltfltkqeillahrrfcellpqehrsveeslqarvsleqilslpelkanpfke................
ENSBTAP00000053274  kim...........................................................................
ENSBTAP00000021537  mgnkqtvftheqleayqdctfftrkeimrlfyryqdlapqlvpldytscpdvkvpyeligsmpelkdn..........
ENSBTAP00000055481  pptaewa.......................................................................
ENSBTAP00000039155  ..............................................................................
ENSBTAP00000029333  pptaewa.......................................................................
ENSBTAP00000016315  stsypde.......................................................................
ENSBTAP00000021091  efftklfe......................................................................
ENSBTAP00000021618  lsrae.........................................................................
ENSBTAP00000055520  alnsienstyrtafklrsvqtlcqldligssliqhvlrhqslweages..............................
ENSBTAP00000055624  alnsienstyrtafklrsvqtlcqldligssliqhvlrhqslweages..............................
ENSBTAP00000016319  ddp...........................................................................
ENSBTAP00000034078  h.............................................................................
ENSBTAP00000006645  mgqclryqmhwedleeyqaltfltrneilcihdsflklcppgkyykeatltvdqvsslpalrvnpfrdricrvf....
ENSBTAP00000021909  vrde..........................................................................
ENSBTAP00000001426  qqp...........................................................................
ENSBTAP00000015802  elksi.........................................................................
ENSBTAP00000032680  elksi.........................................................................
ENSBTAP00000055007  ar............................................................................
ENSBTAP00000020148  pte...........................................................................
ENSBTAP00000052345  wi............................................................................
ENSBTAP00000029334  spktgtsewavpqp................................................................
ENSBTAP00000052345  isgtsaae......................................................................
ENSBTAP00000056127  e.............................................................................
ENSBTAP00000012557  kt............................................................................
ENSBTAP00000011888  kw............................................................................
ENSBTAP00000017060  eahwav........................................................................
ENSBTAP00000031854  eeedinq.......................................................................
ENSBTAP00000031823  ard...........................................................................
ENSBTAP00000021603  lsrae.........................................................................
ENSBTAP00000010838  sqle..........................................................................
ENSBTAP00000014575  liiqmpelrenp..................................................................
ENSBTAP00000011215  eeedinq.......................................................................
ENSBTAP00000053698  la............................................................................
ENSBTAP00000006806  selet.........................................................................
ENSBTAP00000029334  gp............................................................................
ENSBTAP00000044105  hle...........................................................................
ENSBTAP00000026904  mptqleia......................................................................
ENSBTAP00000017060  ptvswvv.......................................................................
ENSBTAP00000055520  pltky.........................................................................
ENSBTAP00000044226  selet.........................................................................
ENSBTAP00000055624  pltky.........................................................................
ENSBTAP00000042182  ..............................................................................
ENSBTAP00000010796  lrkkvqgcwrellrec..............................................................
ENSBTAP00000021174  s.............................................................................
ENSBTAP00000006275  mselekavv.....................................................................
ENSBTAP00000020950  k.............................................................................
ENSBTAP00000053738  rkkvqgcwrellrec...............................................................
ENSBTAP00000004963  vnsf..........................................................................
ENSBTAP00000023774  ..............................................................................
ENSBTAP00000020395  le............................................................................
ENSBTAP00000020150  mpsqme........................................................................
ENSBTAP00000025561  pleka.........................................................................
ENSBTAP00000053738  prrlkeff......................................................................
ENSBTAP00000034009  mtkl..........................................................................
ENSBTAP00000020539  dilve.........................................................................
ENSBTAP00000020778  t.............................................................................
ENSBTAP00000017461  rpr...........................................................................
ENSBTAP00000044096  msqm..........................................................................
ENSBTAP00000008523  msqm..........................................................................
ENSBTAP00000035196  hptgplycpeek..................................................................
ENSBTAP00000041997  rdkpmyd.......................................................................
ENSBTAP00000025499  mtdllhaedikkavgaftavdsf.......................................................
ENSBTAP00000055481  pfggsldi......................................................................
ENSBTAP00000002174  kdkpty........................................................................
ENSBTAP00000000589  spleqa........................................................................
ENSBTAP00000028239  tkdk..........................................................................
ENSBTAP00000014894  enq...........................................................................
ENSBTAP00000026544  v.............................................................................
ENSBTAP00000029333  pfggsldi......................................................................
ENSBTAP00000041966  sqq...........................................................................
ENSBTAP00000008933  akdkpvydelfytlspingk..........................................................
ENSBTAP00000056088  mtkl..........................................................................
ENSBTAP00000033794  tpveeslf......................................................................
ENSBTAP00000012786  etqi..........................................................................
ENSBTAP00000030018  enqv..........................................................................
ENSBTAP00000040233  ..............................................................................
ENSBTAP00000003365  prskkfllteeeifymncraayltvfkssl................................................
ENSBTAP00000053176  vihlkd........................................................................
ENSBTAP00000024301  rdak..........................................................................
ENSBTAP00000022292  dp............................................................................
ENSBTAP00000015611  mtnllrsvvtvidtfyk.............................................................
ENSBTAP00000012770  eelskesqetnwfsapsa............................................................
ENSBTAP00000000847  etpleka.......................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000054975  pdtfepqkffqt..................................................................
ENSBTAP00000046639  khl...........................................................................
ENSBTAP00000052345  npl...........................................................................
ENSBTAP00000053164  hhlkkv........................................................................
ENSBTAP00000016774  mltdleca......................................................................
ENSBTAP00000022630  ksp...........................................................................
ENSBTAP00000010796  als...........................................................................
ENSBTAP00000021909  sfdydhdaflgaeeakt.............................................................
ENSBTAP00000033974  m.............................................................................
ENSBTAP00000006711  vylkdvvcyl....................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000004912  llfkqy........................................................................
ENSBTAP00000005979  hptaplydpea...................................................................
ENSBTAP00000053738  als...........................................................................
ENSBTAP00000053746  pirskivraffdnrnlrkgtsglad.....................................................
ENSBTAP00000023221  kevweeadgldpndfd..............................................................
ENSBTAP00000019429  hp............................................................................
ENSBTAP00000052019  mtellnsil.....................................................................
ENSBTAP00000042244  qspsrrvf......................................................................
ENSBTAP00000053738  lkk...........................................................................
ENSBTAP00000018877  ytelekavvvlvenfykyvskhslvk....................................................
ENSBTAP00000053019  tt............................................................................
ENSBTAP00000003073  kevweeldgldpnrfnp.............................................................
ENSBTAP00000012886  sll...........................................................................
ENSBTAP00000044222  slle..........................................................................
ENSBTAP00000028499  aeplteleaa....................................................................
ENSBTAP00000047378  yv............................................................................
ENSBTAP00000009308  s.............................................................................
ENSBTAP00000017060  ply...........................................................................
ENSBTAP00000050406  at............................................................................
ENSBTAP00000031879  at............................................................................
ENSBTAP00000031854  qtlsrieaafmdiedqkadvyemgkiakacgcplywkap.......................................
ENSBTAP00000001250  rllrglglkpekleqdldrhaesarmtqgrrvtlpefaaqlgv...................................
ENSBTAP00000026035  mpqllr........................................................................
ENSBTAP00000011215  tlsrieaafmdiedqkadvyemgkiakacgcplywkap........................................
ENSBTAP00000002128  algnvcetikklq.................................................................
ENSBTAP00000053194  t.............................................................................
ENSBTAP00000056127  iv............................................................................
ENSBTAP00000033188  wrkkymrwmnhk..................................................................
ENSBTAP00000053548  wrkkymrwmnhk..................................................................
ENSBTAP00000011687  l.............................................................................
ENSBTAP00000007636  c.............................................................................
ENSBTAP00000020950  p.............................................................................
ENSBTAP00000009115  r.............................................................................
ENSBTAP00000023873  qpegldqlqaqt..................................................................
ENSBTAP00000054471  mlrr..........................................................................
ENSBTAP00000039694  gkaelnfedfyrfmdn..............................................................
ENSBTAP00000025205  mlrr..........................................................................
ENSBTAP00000047882  eaemspq.......................................................................
ENSBTAP00000001368  eewtsaakpkldqai...............................................................
ENSBTAP00000029786  tkrnvvrtivtetsfttdeleelyalfkaehltscywggnsnaldrhdpslpyleqy.....................
ENSBTAP00000028993  ..............................................................................
ENSBTAP00000023678  dpgvrdlealidtiqkqlkdrp........................................................
ENSBTAP00000034710  p.............................................................................
ENSBTAP00000031823  tp............................................................................
ENSBTAP00000038002  scyfsll.......................................................................
ENSBTAP00000021074  qllrdilc......................................................................
ENSBTAP00000026544  g.............................................................................
ENSBTAP00000007217  ql............................................................................
ENSBTAP00000029792  akrsvvraipgdigfsieeledlymvfkakhlasqywgssrpaavrrdpslpyleqy.....................
ENSBTAP00000044088  dlg...........................................................................
ENSBTAP00000017319  sdlekaia......................................................................
ENSBTAP00000044100  nkhir.........................................................................
ENSBTAP00000033594  gkegkgkippestlif..............................................................
ENSBTAP00000026766  tptfyqtl......................................................................
ENSBTAP00000055894  lcdqkysdeenl..................................................................
ENSBTAP00000015220  a.............................................................................
ENSBTAP00000033613  evsan.........................................................................
ENSBTAP00000056320  k.............................................................................
ENSBTAP00000025249  sdssmsfvefvelfksfsvrsrkdlkdlfdiyavpcdragseaaplytnltidenisglqpdldlltrnvsdlglfik
ENSBTAP00000029159  vspkpdpkt.....................................................................
ENSBTAP00000044088  fgkrgerk......................................................................
ENSBTAP00000016319  lt............................................................................
ENSBTAP00000017662  erae..........................................................................
ENSBTAP00000012479  plssgl........................................................................
ENSBTAP00000029886  kgsnysei......................................................................
ENSBTAP00000027388  flddpkyssdedlp................................................................
ENSBTAP00000039694  slskqelnqmlsetppvwkgssklfrn...................................................
ENSBTAP00000023673  l.............................................................................
ENSBTAP00000041488  l.............................................................................
ENSBTAP00000001452  v.............................................................................
ENSBTAP00000028498  sdve..........................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000020240  nvemilkffdmflklkdltss.........................................................
ENSBTAP00000053650  nvemilkffdmflklkdltss.........................................................
ENSBTAP00000041651  epehms........................................................................
ENSBTAP00000005154  al............................................................................
ENSBTAP00000021174  nfllkfqgvkmc..................................................................
ENSBTAP00000022068  eds...........................................................................
ENSBTAP00000026682  gdinfaeieeanrvlgpiyfttfvffmffillnmflaiindtysevksdlaqqkaemelsdlirkgyhkaliklklkk
ENSBTAP00000007636  hdvlkle.......................................................................
ENSBTAP00000027954  ..............................................................................
ENSBTAP00000020778  v.............................................................................
ENSBTAP00000013601  ..............................................................................
ENSBTAP00000005477  e.............................................................................
ENSBTAP00000055305  nvemilkffdmflklkdltss.........................................................
ENSBTAP00000036054  nvemilkffdmflklkdltss.........................................................
ENSBTAP00000004912  ql............................................................................
ENSBTAP00000022292  nwd...........................................................................
ENSBTAP00000002717  sislrelkti....................................................................
ENSBTAP00000036015  ell...........................................................................
ENSBTAP00000051638  t.............................................................................
ENSBTAP00000026766  kglhfnnlivgl..................................................................
ENSBTAP00000053738  eyfnfmghftkpqqvqeelkelqqstekampar.............................................
ENSBTAP00000016306  kqlk..........................................................................
ENSBTAP00000013714  malvapeap.....................................................................
ENSBTAP00000036550  kqnvlrvvipevsvlpedleelydlfkrehmmscyweqprpmaprhdpsrpyaeqyr.....................
ENSBTAP00000053738  mtkdevieklksciqqqd............................................................
ENSBTAP00000023383  er............................................................................
ENSBTAP00000027030  wieeklqevc....................................................................
ENSBTAP00000053270  wieeklqevc....................................................................
ENSBTAP00000054640  wieeklqevc....................................................................
ENSBTAP00000012770  eelqnlwflldkhqtppmigeea.......................................................
ENSBTAP00000009967  ngtl..........................................................................
ENSBTAP00000015183  lenqltpgdfvqiqrafepsepsqti....................................................
ENSBTAP00000014222  hlrkeqvsdvqkvlqa..............................................................
ENSBTAP00000026288  phlfl.........................................................................
ENSBTAP00000002128  ssvirydvfinrlwdlrffdcl........................................................
ENSBTAP00000003365  stl...........................................................................
ENSBTAP00000053738  sldeietaf.....................................................................
ENSBTAP00000009228  nvemilkffdmflklkdivgs.........................................................
ENSBTAP00000026785  get...........................................................................
ENSBTAP00000002578  sl............................................................................
ENSBTAP00000000106  pvslpg........................................................................
ENSBTAP00000028840  lhcrkik.......................................................................
ENSBTAP00000053594  gee...........................................................................
ENSBTAP00000055414  dpkgmipmvviqnvlyeffqnpdlqletcclpvdiadsmkprlnktefiqlislhiagfksetfekllkhlchcaaef
ENSBTAP00000026698  qs............................................................................
ENSBTAP00000017015  ..............................................................................
ENSBTAP00000049908  d.............................................................................
ENSBTAP00000021395  isl...........................................................................
ENSBTAP00000007194  semefstlqdmpkelepsavl.........................................................
ENSBTAP00000025455  srirr.........................................................................


                                                                          10         20            3
                                                                           |          |             
d1df0a1               ............................................--------IEANEEDI.GDGFRRLFAQLA....G
ENSBTAP00000019411  ............................................--------ADQLTEEQ.IAEFKEAFSLFDk...D
ENSBTAP00000036057  ............................................--------ADQLTEEQ.IAEFKEAFSLFDk...D
ENSBTAP00000038404  ............................................-----LLESTDFTEHE.IQEWYKGFLR-D....C
ENSBTAP00000010971  ............................................-------ENTEFSELE.LQEWYKGFLK-D....C
ENSBTAP00000019803  ............................................--RTHYSNIEANESEE.VRQFRRLFAQLA....G
ENSBTAP00000014038  ............................................-------MCSHFDADE.IKRLGKRFKKLDl...D
ENSBTAP00000002055  ............................................---------DQLTEEQ.IAEFKEAFSLFDk...D
ENSBTAP00000049731  ............................................---------DQLTEEQ.IAEFQEAFSLFDk...D
ENSBTAP00000005577  ............................................-------ENTEFTDHE.LQEWYKGFLK-D....C
ENSBTAP00000034949  ............................................---------TKFTEEE.LSSWYQSF---Lke..C
ENSBTAP00000017447  ............................................----------------.RTDIEDLFKKINg...D
ENSBTAP00000010858  .............................qehnnlvnvplcvdm----------------.------------....-
ENSBTAP00000046644  ............................................----------------.--EIDNIFSEFGa...K
ENSBTAP00000022814  ............................................------VKSTEFNEHE.LKQWYKGFLK-D....C
ENSBTAP00000019758  .........................................vhw----------------.------QFGQLDqh..P
ENSBTAP00000019321  ............................................------VQNTEFSEQE.LKQWYKGFLK-D....C
ENSBTAP00000011677  ............................................---------TDQESEE.QRQFRNIFRQIA....G
ENSBTAP00000011680  ............................................-----------QESEE.QRQFRNIFRQIA....G
ENSBTAP00000021742  ............................................---------------T.RKELQVLYRGFKne..C
ENSBTAP00000005348  ..........................................pv----------------.----HWQFSELDqh..P
ENSBTAP00000016609  ............................................----------------.------------....N
ENSBTAP00000012740  ............................................----------------.--TTNEVFEQHKln..Q
ENSBTAP00000018403  ............................................---------EKLSEEQ.VAEFKEAFDRFDk...N
ENSBTAP00000026407  ............................................----------------.-AGLEESFRKFAi...H
ENSBTAP00000052557  ............................................----------ELTEEQ.KQEVREAFDLFDa...D
ENSBTAP00000054167  ............................................---------------T.KKELQILYRGFKne..C
ENSBTAP00000010319  ............................................----RMSPKPELTEEQ.KQEIREAFDLFDa...D
ENSBTAP00000041545  ............................................----------------.DQWLSDWFQRGDk...N
ENSBTAP00000055204  ............................................----------------.---LWNVFQRVDk...D
ENSBTAP00000003718  ............................................------------TKR-.--ELQVLYRGFKne..C
ENSBTAP00000011676  ............................................---------------E.DGQLRSLFEKFA....G
ENSBTAP00000049395  ............................................----------------.---IHSCLRKADk...N
ENSBTAP00000054983  ............................................----------------.------------....-
ENSBTAP00000052219  ............................................----------------.---LYGYFAAVA....G
ENSBTAP00000025402  ............................................----------------.------------....-
ENSBTAP00000011678  ............................................-----------SEEEI.DENFKSLFRQLA....G
ENSBTAP00000000433  ............................................----------------.------VFSKVKa...K
ENSBTAP00000021491  ............................................------AAKIELNETQ.KQEIKEAFDLFDv...D
ENSBTAP00000044733  ............................................-------------DDI.DDGFRRLFAQLA....G
ENSBTAP00000010937  ............................................---------------H.DQWVKQTFEEADk...N
ENSBTAP00000056439  ............................................---------------H.DQWVKQTFEEADk...N
ENSBTAP00000055780  ............................................---------EQLTEEQ.KNEFKAAFDIFVlg..A
ENSBTAP00000038002  ............................................----------------.------------....-
ENSBTAP00000034705  ............................................----------------.--WIHSYLHRADs...N
ENSBTAP00000035936  ............................................-------------AAD.AAQLQEWYKKFLee..C
ENSBTAP00000013699  ............................................-------------PNV.DPEAYSWFQSVDs...D
ENSBTAP00000002564  ............................................----------------.------------....-
ENSBTAP00000011496  ............................................----------------.-----------D....C
ENSBTAP00000019111  ............................................-----------LSEEQ.KQEIKDAFELFDt...D
ENSBTAP00000017036  ............................................----------------.--ECHQWYKKFMte..C
ENSBTAP00000003213  ............................................----------------.DQWLKQTFDEADk...N
ENSBTAP00000055444  ............................................----------------.DQWLKQTFDEADk...N
ENSBTAP00000024550  ............................................----------------.---MWKCFLAIA....G
ENSBTAP00000015248  ............................................-----------FDQSQ.IQEFKEAFNMIDq...N
ENSBTAP00000021328  ............................................-----------FDQSQ.IQEFKEAFNMIDq...N
ENSBTAP00000037091  ............................................-----------FDQSQ.IQEFKEAFNMIDq...N
ENSBTAP00000029967  ............................................-----------LRPEE.IEELQAAFQEFDr...D
ENSBTAP00000021449  ............................................---------RPLGPDE.IEELREAFLEFDk...D
ENSBTAP00000053176  ............................................----------------.------------....-
ENSBTAP00000042361  ............................................-----------LRPEE.IEELREAFREFDk...D
ENSBTAP00000016509  ............................................-------------AAD.AAQLQEWYKKFLee..C
ENSBTAP00000026714  ............................................------------RPEE.IEELREAFREFDk...D
ENSBTAP00000004690  ............................................--------------DI.DQDFVRLFHIVAg...G
ENSBTAP00000010858  ............................................----------------.--KYRYLFKQVA....S
ENSBTAP00000013117  ............................................----------------.---VSQMFSEIDv...D
ENSBTAP00000017574  ............................................----------------.-----------Dd...F
ENSBTAP00000004885  ............................................------------DVEP.PTRYETLFQKLDr...N
ENSBTAP00000008961  ............................................----------------.-------FWRKAf...G
ENSBTAP00000028063  ............................................----------------.------------....-
ENSBTAP00000012740  ............................................----------------.------------....N
ENSBTAP00000006283  ............................................----------ELGPEE.LDELQAAFEEFDt...D
ENSBTAP00000014306  ............................................-----------FTEDQ.TAEFKEAFQLFDr...T
ENSBTAP00000053252  ............................................----------------.--WLKTVFEAADi...D
ENSBTAP00000014304  ............................................-----------FTEDQ.TAEFKEAFQLFDr...T
ENSBTAP00000045669  ...........................rmptthqiqveqsisll----------------.------------....-
ENSBTAP00000041264  ............................................----------------.------------....-
ENSBTAP00000006711  ............................................----------------.------------....-
ENSBTAP00000017358  ............................................----------------.-----EFWRKFF....G
ENSBTAP00000053274  ...........................rmptthqiqveqsisll----------------.------------....-
ENSBTAP00000055296  ............................................----------------.-----EFWRKFF....G
ENSBTAP00000016852  ............................................----------------.-KGLGRVFRIMDd...N
ENSBTAP00000036380  ............................................-----------LSQDQ.INEYKECFSLYDk...Q
ENSBTAP00000041719  ............................................-----------FNKDQ.LEEFKEAFELYDr...V
ENSBTAP00000049636  ............................................-----------FSKQQ.QDEFKEAFLLFDr...T
ENSBTAP00000024444  ............................................------------EQTQ.IQEFKEAFTIMDq...N
ENSBTAP00000004556  ............................................----------------.---LKDWFGALHe...D
ENSBTAP00000038767  ............................................-------KETGFSHSQ.ITRLYSRFTSLDk...G
ENSBTAP00000031285  ............................................-----------LGASC.KDSIGWMFSKLDt...S
ENSBTAP00000011457  ............................................----------------.------------....-
ENSBTAP00000011047  ............................................-----------FTPEQ.IEEFKEAFTLFDrtp.K
ENSBTAP00000002564  ............................................----------------.------------....-
ENSBTAP00000037104  ............................................-----------FDQSQ.IQEFKEAFTIMDq...N
ENSBTAP00000002672  ............................................------------EQAQ.IQEFKEAFSCIDq...N
ENSBTAP00000028269  ............................................-----------FDQTQ.IQEFKEAFTVIDq...N
ENSBTAP00000016647  ............................................------RQETGFSQAS.LRRLYDRFNALDr...T
ENSBTAP00000004536  ............................................--------------ER.RQRWGRLFEELDs...N
ENSBTAP00000042177  ............................................----------------.--VVHWYFKLLDk...N
ENSBTAP00000028063  ............................................----------------.-DKLRYVFSQMS....D
ENSBTAP00000050283  ............................................----------------.VTEFKEAFSLFDr...T
ENSBTAP00000048539  ............................................-----ISQNLKLDWDN.IHQCLDKYAEIAva..S
ENSBTAP00000045669  ............................................----------------.-DKLRYIFSMIS....D
ENSBTAP00000007972  ............................................----------------.-QGVARFFRRLDq...D
ENSBTAP00000040815  ............................................----------------.--VVHWYFSQLDs...N
ENSBTAP00000025661  ............................................-----ISRKLKLDWDG.IRKHLDEYAAIAss..S
ENSBTAP00000028350  ............................................----------------.------------....-
ENSBTAP00000053274  ............................................----------------.-DKLRYIFSMIS....D
ENSBTAP00000021537  ............................................----------------.------------....-
ENSBTAP00000055481  ............................................-----------VPQSS.RLKYRQLFNSHDk...T
ENSBTAP00000039155  ............................................----------------.-----EAFSLFHs...D
ENSBTAP00000029333  ............................................-----------VPQSS.RLKYRQLFNSHDk...T
ENSBTAP00000016315  ............................................--------PWRITEEQ.REYYVNQFRSLQp...D
ENSBTAP00000021091  ............................................----------------.------------....-
ENSBTAP00000021618  ............................................----------------.------------....-
ENSBTAP00000055520  ............................................----------------.------------....-
ENSBTAP00000055624  ............................................----------------.------------....-
ENSBTAP00000016319  ............................................---------WKITDEQ.RQYYVNQFKTIQp...D
ENSBTAP00000034078  ............................................----------------.-KKIKEAFEVFDh...E
ENSBTAP00000006645  ............................................----------------.------------....-
ENSBTAP00000021909  ............................................----------------.-----RRFKMADk...D
ENSBTAP00000001426  ............................................-------PYLHLAELT.ATQFLEIWKHFDa...D
ENSBTAP00000015802  ............................................----------------.------------....-
ENSBTAP00000032680  ............................................----------------.------------....-
ENSBTAP00000055007  ............................................---------SYLSEEM.IAEFKAAFDMFDa...D
ENSBTAP00000020148  ............................................------------TERC.IESLIAVFQKHAgrd.G
ENSBTAP00000052345  ............................................-----------VSPAE.KAKYDEIFLKTDk...D
ENSBTAP00000029334  ............................................---------------S.RLKYRQKFNSLDk...S
ENSBTAP00000052345  ............................................-------LPWAVKPED.KAKYDAIFDSLC....P
ENSBTAP00000056127  ............................................----------------.-----RRFKAADl...D
ENSBTAP00000012557  ............................................----------------.--DLIRAFQLQDr...N
ENSBTAP00000011888  ............................................----------------.LQWVTHQFKTIA....G
ENSBTAP00000017060  ............................................------------RVEE.KAKFDGIFESLL....P
ENSBTAP00000031854  ............................................-------ITDYFSYEH.FYVIYCKFWELDs...D
ENSBTAP00000031823  ............................................----------------.----ERRFRVADq...D
ENSBTAP00000021603  ............................................----------------.------------....-
ENSBTAP00000010838  ............................................--------------QA.ITDLINLFHKYS....G
ENSBTAP00000014575  ............................................----------------.------------....-
ENSBTAP00000011215  ............................................-------ITDYFSYEH.FYVIYCKFWELDs...D
ENSBTAP00000053698  ............................................----------NISVEE.LDEIREAFRVLDr...D
ENSBTAP00000006806  ............................................---------------A.METLINVFHAHSgk..E
ENSBTAP00000029334  ............................................-------NMWAITSEE.RTKHDKQFDNLK....P
ENSBTAP00000044105  ............................................--------------QA.ITDLINLFHKYS....G
ENSBTAP00000026904  ............................................----------------.MNIMIRTFHRYScr..E
ENSBTAP00000017060  ............................................------------PVAD.KMRFDEIFLKTDl...D
ENSBTAP00000055520  ............................................----------------.----TALFQLYAe...N
ENSBTAP00000044226  ............................................---------------A.METLINVFHAHSgk..E
ENSBTAP00000055624  ............................................----------------.----TALFQLYAe...N
ENSBTAP00000042182  ............................................----------------.--ELQQLFQELA....G
ENSBTAP00000010796  ............................................----------------.--------KERDf...N
ENSBTAP00000021174  ............................................----------------.--QFFEIWLHFDa...D
ENSBTAP00000006275  ............................................----------------.--ALIDVFHQYSgre.G
ENSBTAP00000020950  ............................................----------------.-----KRFEKANq...D
ENSBTAP00000053738  ............................................----------------.--------KERDf...N
ENSBTAP00000004963  ............................................------------KKSE.IECLIRIFHNVVg...R
ENSBTAP00000023774  ............................................----------------.--EIREAFKVFDr...D
ENSBTAP00000020395  ............................................-QQIQARNTTGVTEEA.LKEFSMMFKHFDk...D
ENSBTAP00000020150  ............................................--------------HA.METMMFTFHKFA....G
ENSBTAP00000025561  ............................................----------------.LDVMVSTFHKYSgk..E
ENSBTAP00000053738  ............................................----------------.-RDPYAAFFKMDt...D
ENSBTAP00000034009  ............................................-------------EDH.LEGIINIFHQYSvrv.G
ENSBTAP00000020539  ............................................----------------.-------FKKHDk...D
ENSBTAP00000020778  ............................................-------------QEV.LENLKDRWYQADnp..P
ENSBTAP00000017461  ............................................--------TWEASPPE.HKKWVEVFKACDe...D
ENSBTAP00000044096  ............................................-------------ESS.IETIINIFHQYSvrl.G
ENSBTAP00000008523  ............................................-------------ESS.IETIINIFHQYSvrl.G
ENSBTAP00000035196  ............................................----------EMKPAC.IKALTRIFKISDq...D
ENSBTAP00000041997  ............................................----------------.-----EIFYTLS....P
ENSBTAP00000025499  ............................................----------------.------------....-
ENSBTAP00000055481  ............................................---------WAITVEE.RAKHDQQFHSLK....P
ENSBTAP00000002174  ............................................----------------.----DEIFYTLS....P
ENSBTAP00000000589  ............................................----------------.LAVMVATFHKYSgq..E
ENSBTAP00000028239  ............................................----------------.-SKYDEIFYNLA....P
ENSBTAP00000014894  ............................................---ILTRDAKGISQEQ.MQEFRASFNHFDk...D
ENSBTAP00000026544  ............................................----------------.--EFMRIWRKYDa...D
ENSBTAP00000029333  ............................................---------WAITVEE.RAKHDQQFHSLK....P
ENSBTAP00000041966  ............................................----------------.-----SIFYKYA....Q
ENSBTAP00000008933  ............................................----------------.------------....-
ENSBTAP00000056088  ............................................-------------EDH.LEGIINIFHQYSvrv.G
ENSBTAP00000033794  ............................................----------------.--QIIHCYHEYAare.G
ENSBTAP00000012786  ............................................----LTRDAKGITQEQ.MNEFRASFNHFDr...R
ENSBTAP00000030018  ............................................----LTRDAKGLSQEQ.LNEFRASFNHFDr...K
ENSBTAP00000040233  ............................................----------------.-DELKRAFHLLDt...A
ENSBTAP00000003365  ............................................----------------.------------....-
ENSBTAP00000053176  ............................................----------------.------------....-
ENSBTAP00000024301  ............................................----------GISQEQ.MNEFRASFNHFDr...D
ENSBTAP00000022292  ............................................----------------.-QELRNIFLQYAstevD
ENSBTAP00000015611  ............................................----------------.-------YTKQD....G
ENSBTAP00000012770  ............................................----------------.-LRVYGQYLNLDk...D
ENSBTAP00000000847  ............................................----------------.LTTMVTTFHKYS....G
ENSBTAP00000053738  ............................................----------------.-DELKRAFHLLDt...A
ENSBTAP00000054975  ............................................---------SGLAKMS.ASQVKDVFRFIDn...D
ENSBTAP00000046639  ............................................----------------.--------QQLDk...E
ENSBTAP00000052345  ............................................----------------.---YEKYYRQVDt...G
ENSBTAP00000053164  ............................................----------------.------------....-
ENSBTAP00000016774  ............................................----------------.INSLIDVYHKYSlkk.G
ENSBTAP00000022630  ............................................----------------.-EELKGIFEKYAake.G
ENSBTAP00000010796  ............................................----------------.-----TAFSALDk...E
ENSBTAP00000021909  ............................................--------FDQLTPEEsKERLGMIVDKIDa...D
ENSBTAP00000033974  ............................................----------------.----------FSe...E
ENSBTAP00000006711  ............................................----------------.------------....-
ENSBTAP00000010796  ............................................----------------.-------FIETDs...E
ENSBTAP00000004912  ............................................----------------.--------ASIEk...N
ENSBTAP00000005979  ............................................---------KQLRPAC.AQALTRIFRLSDq...D
ENSBTAP00000053738  ............................................----------------.-----TAFSALDk...E
ENSBTAP00000053746  ............................................----------------.------------....-
ENSBTAP00000023221  ............................................----------------.------------....-
ENSBTAP00000019429  ............................................-----YSEFPEFSRRL.IKDLESMFKLYDa...G
ENSBTAP00000052019  ............................................----------------.--TVIRVFQKYAke..N
ENSBTAP00000042244  ............................................---NPYTEFKEFSRKQ.IKDMEKMFKEYDa...G
ENSBTAP00000053738  ............................................----------------.------ALLLIKs...K
ENSBTAP00000018877  ............................................----------------.------------....-
ENSBTAP00000053019  ............................................----------TISREE.LEELQEAFNKIDi...D
ENSBTAP00000003073  ............................................----------------.------------....-
ENSBTAP00000012886  ............................................-------------PSD.IDRYKKRFHKFDa...D
ENSBTAP00000044222  ............................................--------------QA.LATLVRTFQEYSq...F
ENSBTAP00000028499  ............................................----------------.IETVVTTFFTFAgre.G
ENSBTAP00000047378  ............................................----------------.-SQLRDVYSSCDt...T
ENSBTAP00000009308  ............................................-----------VSDEE.MLELREAFAKVDt...D
ENSBTAP00000017060  ............................................----------------.----ESYYKQVDp...A
ENSBTAP00000050406  ............................................---------TQISKDE.LDELKEAFAKVDl...N
ENSBTAP00000031879  ............................................---------TQISKDE.LDELKEAFAKVDl...N
ENSBTAP00000031854  ............................................----------------.------MFRAAGg...E
ENSBTAP00000001250  ............................................----------------.------------....-
ENSBTAP00000026035  ............................................---------------N.INGIIEAFRRYArm..E
ENSBTAP00000011215  ............................................----------------.------MFRAAGg...E
ENSBTAP00000002128  ............................................----------------.------------....-
ENSBTAP00000053194  ............................................----------GLSEET.RQEFETTFRHFDe...N
ENSBTAP00000056127  ............................................----------------.--------DRIDs...D
ENSBTAP00000033188  ............................................----------------.KSRVMDFFRRIDk...D
ENSBTAP00000053548  ............................................----------------.KSRVMDFFRRIDk...D
ENSBTAP00000011687  ............................................------------SVRN.VKALVEYFHLLDv...H
ENSBTAP00000007636  ............................................----------------.------------....-
ENSBTAP00000020950  ............................................-------------EEQ.HKRLKSIIKKIDl...D
ENSBTAP00000009115  ............................................----------KLSPSQ.MRAFQDAYNFFNk...D
ENSBTAP00000023873  ............................................----------KFTK--.-KELQSLYRGFKne..C
ENSBTAP00000054471  ............................................----------------.------------....-
ENSBTAP00000039694  ............................................--------------LQ.TEVLEIEFLSYS....N
ENSBTAP00000025205  ............................................----------------.------------....-
ENSBTAP00000047882  ............................................----------------.------------....-
ENSBTAP00000001368  ............................................----------------.------------....-
ENSBTAP00000029786  ............................................----------------.------------....-
ENSBTAP00000028993  ............................................--------------EE.LARLRSVFAACDa...N
ENSBTAP00000023678  ............................................----------------.------------....-
ENSBTAP00000034710  ............................................-----------LTARQ.LAAFQDVFKLFSs...S
ENSBTAP00000031823  ............................................-------------EES.QARLGRIVDRMDrag.D
ENSBTAP00000038002  ............................................----------------.------------....-
ENSBTAP00000021074  ............................................----------------.---VIETFHKYAr...E
ENSBTAP00000026544  ............................................----------------.---FWQVWQRFDv...E
ENSBTAP00000007217  ............................................----------------.----------VA....D
ENSBTAP00000029792  ............................................----------------.------------....-
ENSBTAP00000044088  ............................................----------------.------------....-
ENSBTAP00000017319  ............................................----------------.--TAALVFRNSS....D
ENSBTAP00000044100  ............................................----------------.------------....-
ENSBTAP00000033594  ............................................-------NIDLLEIRN.GPRSHESFQEMDl...N
ENSBTAP00000026766  ............................................------AGVTHLEESD.IIDLEKRYWLLKaq..S
ENSBTAP00000055894  ............................................-------------PEK.LTAFKEKYMEFDl...N
ENSBTAP00000015220  ............................................----------------.------------....-
ENSBTAP00000033613  ............................................----------------.------------....-
ENSBTAP00000056320  ............................................----------------.-------FWELDt...D
ENSBTAP00000025249  skqqlsdnqrqisdaiaaasivtngtgvestslgvfgvgilqln----------------.------------....-
ENSBTAP00000029159  ............................................----------------.------------....-
ENSBTAP00000044088  ............................................----------------.------------....-
ENSBTAP00000016319  ............................................-----------LSDAE.QKYYSDLFSYCDi...E
ENSBTAP00000017662  ............................................---------EHLTMKQ.EEAFRSYFEIF-....N
ENSBTAP00000012479  ............................................----------------.LDKLQKELKVLDp...V
ENSBTAP00000029886  ............................................----------------.---LDKYFKNFD....N
ENSBTAP00000027388  ............................................--------------SK.LEAFKKKYMEFDl...N
ENSBTAP00000039694  ............................................----------------.------------....-
ENSBTAP00000023673  ............................................----------------.------------....-
ENSBTAP00000041488  ............................................----------------.------------....-
ENSBTAP00000001452  ............................................----------------.-----ETFKQIDt...D
ENSBTAP00000028498  ............................................--------------RA.IETLIKNFHQYSve..G
ENSBTAP00000001426  ............................................----------------.------------....-
ENSBTAP00000020240  ............................................----------------.-----DTFKEYDp...D
ENSBTAP00000053650  ............................................----------------.-----DTFKEYDp...D
ENSBTAP00000041651  ............................................----------------.------------....-
ENSBTAP00000005154  ............................................----------------.------------....-
ENSBTAP00000021174  ............................................----------------.------------....-
ENSBTAP00000022068  ............................................----------------.-PRLRAVFDALDg...D
ENSBTAP00000026682  .........................................ntv----------------.------------....-
ENSBTAP00000007636  ............................................----------------.-------FERHD....P
ENSBTAP00000027954  ............................................----------------.---------QFDp...G
ENSBTAP00000020778  ............................................----------------.-----------Dl...N
ENSBTAP00000013601  ............................................----------------.------------....-
ENSBTAP00000005477  ............................................----------------.------------....-
ENSBTAP00000055305  ............................................----------------.-----DTFKEYDp...D
ENSBTAP00000036054  ............................................----------------.-----DTFKEYDp...D
ENSBTAP00000004912  ............................................----------------.------------....-
ENSBTAP00000022292  ............................................----------------.------------....-
ENSBTAP00000002717  ............................................------LPLVNFKVSS.AKFLKDKFLEIG....A
ENSBTAP00000036015  ............................................----------------.-KSIWYAFTALDv...E
ENSBTAP00000051638  ............................................----------------.------------....-
ENSBTAP00000026766  ............................................----------------.------------....-
ENSBTAP00000053738  ............................................----------------.------------....-
ENSBTAP00000016306  ............................................----------------.------------....-
ENSBTAP00000013714  ............................................----------------.SEQARRVFQTYDp...E
ENSBTAP00000036550  ............................................----------------.------------....-
ENSBTAP00000053738  ............................................----------------.------------....-
ENSBTAP00000023383  ............................................----------------.--WLRKQFYSVDr...N
ENSBTAP00000027030  ............................................----------------.--------EDLGi...T
ENSBTAP00000053270  ............................................----------------.--------EDLGi...T
ENSBTAP00000054640  ............................................----------------.--------EDLGi...T
ENSBTAP00000012770  ............................................----------------.------------....-
ENSBTAP00000009967  ............................................------------TIEQ.LDNLRDQF--LDi...A
ENSBTAP00000015183  ............................................----------------.------------....-
ENSBTAP00000014222  ............................................----------------.------------....-
ENSBTAP00000026288  ............................................-------RLHDWSVEH.ETFLREAFSFVD....R
ENSBTAP00000002128  ............................................----------------.------------....-
ENSBTAP00000003365  ............................................----------------.------------....-
ENSBTAP00000053738  ............................................----------------.------------....-
ENSBTAP00000009228  ............................................----------------.-----EAFQDYVt...D
ENSBTAP00000026785  ............................................----------------.------------....-
ENSBTAP00000002578  ............................................------------KDEL.LKGIWHAFTALDl...D
ENSBTAP00000000106  ............................................-------------ISS.IEDLQGLFHKTGq...D
ENSBTAP00000028840  ............................................----------------.---ILELFHKVD....Q
ENSBTAP00000053594  ............................................----------------.------------....-
ENSBTAP00000055414  .....................................reviktd----------------.------------....-
ENSBTAP00000026698  ............................................----------------.------------....-
ENSBTAP00000017015  ............................................-----------LTEEE.MYSLTETFQQCKv...I
ENSBTAP00000049908  ............................................----------------.------------....-
ENSBTAP00000021395  ............................................----------------.------------....N
ENSBTAP00000007194  ............................................----------------.------------....-
ENSBTAP00000025455  ............................................----------------.------------....-


                      0             40                                     50             60        
                      |              |                                      |              |        
d1df0a1               EDA.....EISAFELQT.........IL.................RRVL...AKRED..IKSDG...FSIE.......
ENSBTAP00000019411  GDG.....TITTKELGT.........VM.................RSLG...QNPTE..-----...---A.......
ENSBTAP00000036057  GDG.....TITTKELGT.........VM.................RSLG...QNPTE..-----...---A.......
ENSBTAP00000038404  PSG.....HLSMEEFKK.........IY.................GNFF...PYGDA..-----...--SK.......
ENSBTAP00000010971  PTG.....ILNVDEFKK.........IY.................ANFF...PYGDA..-----...--SK.......
ENSBTAP00000019803  DDM.....EVSATELMN.........IL.................NKVV...TRHPD..LKTDG...FGID.......
ENSBTAP00000014038  NSG.....SLSVEEFMS.........LP.................ELQQ...----N..-----...---P.......
ENSBTAP00000002055  GDG.....TITTKELGT.........VM.................RSLG...QNPTE..-----...---A.......
ENSBTAP00000049731  GDG.....TITTKELGT.........VM.................RSLG...QNPTE..-----...---A.......
ENSBTAP00000005577  PTG.....HLTVDEFKK.........IY.................ANFF...PYGDA..-----...--SK.......
ENSBTAP00000034949  PSG.....RITRQEFQT.........IY.................SKFF...PEADP..-----...--KA.......
ENSBTAP00000017447  KTD.....YLTVDQLVS.........FL.................NEHQrd.PRLNE..ILFPF...YDAK.......
ENSBTAP00000010858  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000046644  SKP.....YLTVDQMMD.........FI.................NLKQrd.PRLNE..ILYPP...LKQE.......
ENSBTAP00000022814  PSG.....RLNLEEFQQ.........LY.................VKFF...PYGDA..-----...--SK.......
ENSBTAP00000019758  IDG.....YLSHTELAP.........LR.................APLI...PM--E..-----...---H.......
ENSBTAP00000019321  PSG.....ILNLEEFQQ.........LY.................IKFF...PYGDA..-----...--SK.......
ENSBTAP00000011677  DDM.....EICADELKN.........VL.................NRVV...NKHKD..LKTQG...FTLE.......
ENSBTAP00000011680  DDM.....EICADELKN.........VL.................NRVV...NKHKD..LKTQG...FTLE.......
ENSBTAP00000021742  PSG.....IVNEENFKQ.........IY.................SQFF...PQGD-..-----...-SST.......
ENSBTAP00000005348  RDR.....VLTHSELAP.........LR.................ASLV...PM--E..-----...---H.......
ENSBTAP00000016609  QDG.....RIPVKNILK.........MF.................SADK...K---R..-----...---V.......
ENSBTAP00000012740  NDQ.....LLSVPDVIN.........CL.................----...-----..-----...----.......
ENSBTAP00000018403  KDG.....TISVQELGT.........VM.................QEVG...LKLSE..-----...---A.......
ENSBTAP00000026407  GDP.....KASGHEMNGknwaklckdCK.................VADG...KAVTG..-----...---T.......
ENSBTAP00000052557  GSG.....TIDVKELKV.........AM.................RALG...FEPRK..-----...---E.......
ENSBTAP00000054167  PSG.....VVNEDTFKE.........IY.................SQFF...PQGD-..-----...-STT.......
ENSBTAP00000010319  GTG.....TIDVKELKV.........AM.................RALG...FEPKK..-----...---E.......
ENSBTAP00000041545  QDG.....RMSFGEVQR.........LL.................HLMN...VEMDQ..-----...---E.......
ENSBTAP00000055204  RSG.....VISDNELQQ.........AL.................SN--...-----..GTWTP...FNPV.......
ENSBTAP00000003718  PSG.....VVNEETFKQ.........IY.................AQFF...PHGDA..-----...--SM.......
ENSBTAP00000011676  KDS.....EIRANELRT.........AL.................NEVF...SKRTD..IKFDG...FDIN.......
ENSBTAP00000049395  KDN.....KMSFKELQN.........FL.................KELN...IQVDD..-----...---S.......
ENSBTAP00000054983  ---.....---------.........--.................----...-----..-----...VTVT.......
ENSBTAP00000052219  QDG.....QIDADELQR.........CL.................TQSG...IA---..GGYKP...FNLE.......
ENSBTAP00000025402  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000011678  EDM.....EISVKELRT.........IL.................NRII...SKHKD..LRTTG...FSLE.......
ENSBTAP00000000433  NAR.....TITFQQFQE.........AM.................KELG...QKRFK..GKSPD...EALE.......
ENSBTAP00000021491  GSG.....TIDVKELKI.........AM.................RALG...FEPKK..-----...---E.......
ENSBTAP00000044733  EDA.....EISAFELQT.........IL.................RRVL...AKRQD..IKSDG...FSIE.......
ENSBTAP00000010937  GDG.....LLNIEEIHQ.........LM.................HKLN...VNLPR..-----...---R.......
ENSBTAP00000056439  GDG.....LLNIEEIHQ.........LM.................HKLN...VNLPR..-----...---R.......
ENSBTAP00000055780  EDG.....CISTKELGK.........VM.................RMLG...QNPTP..-----...---E.......
ENSBTAP00000038002  --G.....LISPSDFAQ.........LQ.................KYME...YSTKK..-----...--VS.......
ENSBTAP00000034705  QDS.....KMSFKEIKN.........LL.................RMVN...LDMND..-----...---M.......
ENSBTAP00000035936  PSG.....TLFMHEFKR.........FF.................KVPD...NEEAT..-----...---Q.......
ENSBTAP00000013699  HSG.....YISIKELKQ.........AL.................VN--...-----..SNWSS...FNDE.......
ENSBTAP00000002564  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000011496  PSG.....QLDAAGFQK.........IY.................KQFF...PFGDP..-----...--TK.......
ENSBTAP00000019111  KDE.....AIDYHELKV.........AM.................RALG...FDVKK..-----...---A.......
ENSBTAP00000017036  PSG.....QLTLYEFRQ.........FF.................GLKN...LSPW-..-----...-ASQ.......
ENSBTAP00000003213  GDG.....SLSIGEVLQ.........LL.................HKLN...VNLPR..-----...---Q.......
ENSBTAP00000055444  GDG.....SLSIGEVLQ.........LL.................HKLN...VNLPR..-----...---Q.......
ENSBTAP00000024550  QDG.....EVDAEELQK.........CL.................TQSG...IS---..GTYSP...FSLE.......
ENSBTAP00000015248  RDG.....FIDKEDLHD.........ML.................ASMG...KNPTD..-----...---E.......
ENSBTAP00000021328  RDG.....FIDKEDLHD.........ML.................ASLG...KNPTD..-----...---E.......
ENSBTAP00000037091  RDG.....FIDKEDLHD.........ML.................ASLG...KNPTD..-----...---A.......
ENSBTAP00000029967  RDG.....YIGYQELGA.........CM.................RTLG...YMPTE..-----...---M.......
ENSBTAP00000021449  RDG.....FISCKDLGN.........LM.................RTMG...YMPTE..-----...---M.......
ENSBTAP00000053176  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000042361  KDG.....YINCRDLGN.........CM.................RTMG...YMPTE..-----...---M.......
ENSBTAP00000016509  PSG.....TLFMHEFKR.........FF.................KVPD...NEEAT..-----...---Q.......
ENSBTAP00000026714  KDG.....YINCRDLGN.........CM.................RTMG...YMPTE..-----...---M.......
ENSBTAP00000004690  EGK.....EIGMYELQK.........LL.................NKVV...SRFKN..FKTKG...FSLD.......
ENSBTAP00000010858  STG.....FCDQRRLGL.........LL.................HDSI...QI---..-----...----.......
ENSBTAP00000013117  DLG.....HITLCSAVQ.........CI.................RNLN...PGLKT..-----...---S.......
ENSBTAP00000017574  KGG.....KITLEKALK.........LL.................EKLD...IQCNT..-----...---I.......
ENSBTAP00000004885  GDG.....VVDISELQE.........GL.................KSLG...IPLGQ..-----...---D.......
ENSBTAP00000008961  EKT.....IVPWKSFRQ.........AL.................HEVH...PISSG..-----...---L.......
ENSBTAP00000028063  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000012740  NKP.....EISVKEFID.........WM.................RLE-...-----..-----...----.......
ENSBTAP00000006283  HDG.....YIGYRDLGE.........CM.................RTLG...YMPTE..-----...---M.......
ENSBTAP00000014306  GDG.....KILYSQCGD.........VM.................RALG...QNPTN..-----...---A.......
ENSBTAP00000053252  GNG.....IMLEDTSVE.........LI.................KQLN...PTLKE..-----...---S.......
ENSBTAP00000014304  GDG.....KILYSQCGD.........VM.................RALG...QNPTN..-----...---A.......
ENSBTAP00000045669  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000041264  --C.....VLPWAEFEA.........VL.................CICH...PVEPG..-----...---S.......
ENSBTAP00000006711  ---.....-LTPEEFGQ.........LQ.................K---...-----..--YAE...YSSK.......
ENSBTAP00000017358  DKT.....IVPWKVFRQ.........CL.................HEVH...QISSG..-----...---L.......
ENSBTAP00000053274  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000055296  DKT.....IVPWKVFRQ.........CL.................HEVH...QISSG..-----...---L.......
ENSBTAP00000016852  NNR.....TLDFKEFVK.........GL.................NDYA...VVMEK..-----...---E.......
ENSBTAP00000036380  QRG.....KIKATDLLT.........VM.................RCLG...ASPTP..-----...---G.......
ENSBTAP00000041719  GDG.....KIQFSQCGD.........VM.................RALG...QNPTN..-----...---A.......
ENSBTAP00000049636  GEC.....KITLSQVGD.........VL.................RALG...TNPTN..-----...---A.......
ENSBTAP00000024444  RDG.....FIDKNDLRD.........TF.................AALGr..VNVKN..-----...---E.......
ENSBTAP00000004556  ANR.....VINPTSSET.........AQ.................GRFD...-----..TSILP...ICKD.......
ENSBTAP00000038767  ENG.....TLSREDFQR.........IP.................ELAI...NPLGD..-----...----.......
ENSBTAP00000031285  ADL.....FLDQTELAA.........IN.................----...LDKYE..-----...---V.......
ENSBTAP00000011457  ---.....-LDRNAFRN.........IL.................HMTF...GMTDD..-----...---M.......
ENSBTAP00000011047  CEM.....KITYGQCGD.........VL.................RALG...QNPTQ..-----...---A.......
ENSBTAP00000002564  ---.....---------.........--.................----...--P--..-----...----.......
ENSBTAP00000037104  RDG.....FIDKEDLRD.........TF.................AAPGcr.INVKN..-----...---E.......
ENSBTAP00000002672  RDG.....IICKSDLRE.........TY.................SQLGk..VNVPE..-----...---E.......
ENSBTAP00000028269  RDG.....IIDKEDLRD.........TF.................AAMGr..LNVKN..-----...---E.......
ENSBTAP00000016647  GKG.....YLSRMDLQQ.........IG.................ALAV...NPLGD..-----...----.......
ENSBTAP00000004536  KDG.....RVDIRELRQ.........GL.................ARLG...GGDPD..-----...--RG.......
ENSBTAP00000042177  NSG.....DIGKKEIKP.........FK.................RFLR...KKSKP..-----...--KK.......
ENSBTAP00000028063  SNG.....LMIFSKFDQ.........FL.................KEVL...KLPTA..-----...----.......
ENSBTAP00000050283  PTGel...KIAYGQCGD.........VL.................RALG...QNPTN..-----...---A.......
ENSBTAP00000048539  KGG.....KIGIEEFAN.........YL.................KLPI...----S..-----...---K.......
ENSBTAP00000045669  SSG.....VMVYGRYDQ.........FL.................REVL...KLPT-..-----...----.......
ENSBTAP00000007972  GSR.....SLDVRELQR.........GL.................AELG...LVLDT..-----...---A.......
ENSBTAP00000040815  SSS.....DINKREMKP.........FK.................RYVK...KKAKP..-----...--KK.......
ENSBTAP00000025661  KGG.....RIGIEEFAE.........YL.................KL--...--PVS..-----...---D.......
ENSBTAP00000028350  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000053274  SSG.....VMVYGRYDQ.........FL.................REVL...KLPT-..-----...----.......
ENSBTAP00000021537  ---.....---------.........--.................----...-----..-----...---P.......
ENSBTAP00000055481  MSG.....HLTGPQART.........IL.................MQSS...LP--Q..-----...---A.......
ENSBTAP00000039155  SNS.....TIPMQELGT.........VL.................WPLG...PNPTK..-----...---A.......
ENSBTAP00000029333  MSG.....HLTGPQART.........IL.................MQSS...LP--Q..-----...---A.......
ENSBTAP00000016315  PSS.....FISGSVAKN.........FF.................TKSK...LSI--..-----...---P.......
ENSBTAP00000021091  KYP.....EINAIQLQN.........IL.................NHMP...WSGLG..SKQPL...FSLE.......
ENSBTAP00000021618  ---.....---------.........FA.................ESLG...LKPQD..-----...---M.......
ENSBTAP00000055520  ---.....TLSVQQLFQ.........AL.................QEMF...QKVRV..EKPGQ...MHPRasel...
ENSBTAP00000055624  ---.....TLSVQQLFQ.........AL.................QEMF...QKVRV..EKPGQ...MHPRasel...
ENSBTAP00000016319  LNG.....FIPGSAAKE.........FF.................TKSK...LPI--..-----...---L.......
ENSBTAP00000034078  SNN.....TVDVREVGT.........II.................RSLG...CCPSE..-----...---G.......
ENSBTAP00000006645  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000021909  GDL.....IATKEEFTA.........FL.................HPE-...-----..-EYDY...MKDI.......
ENSBTAP00000001426  GNG.....YIEGKELEN.........FF.................QELE...KARKG..SGMVSksdNLGE.......
ENSBTAP00000015802  ---.....---------.........-F.................KLSV...FIPSQ..--EFS...TYRQ.......
ENSBTAP00000032680  ---.....---------.........-F.................KLSV...FIPSQ..--EFS...TYRQ.......
ENSBTAP00000055007  GGG.....DISVKELGT.........VM.................RMLG...QTPTK..-----...---E.......
ENSBTAP00000020148  NNS.....KLSKAEFLI.........FM.................NTEL...GA---..FTKNQ...KDPG.......
ENSBTAP00000052345  MDG.....FVSGLEVRE.........IF.................LKTG...LPS--..-----...---A.......
ENSBTAP00000029334  MSG.....YLSGFQARN.........AL.................LQSN...LSQ--..-----...---T.......
ENSBTAP00000052345  VNG.....FLSGDKVKP.........VL.................LNSK...LPV--..-----...---D.......
ENSBTAP00000056127  SDQ.....TATREEFTA.........FL.................HP--...-----..EEFEH...MKEI.......
ENSBTAP00000012557  KSG.....KLSMGQWAF.........SM.................ENVLg..LNLPW..-----...---R.......
ENSBTAP00000011888  EDG.....EINLQDFKK.........AL.................KVK-...---ES..-----...---F.......
ENSBTAP00000017060  VNG.....LLSGDKVKP.........VL.................MNSK...LPL--..-----...---D.......
ENSBTAP00000031854  HDL.....YISQADLSR.........YN.................DQAS...SN---..-----...---R.......
ENSBTAP00000031823  GDS.....MATREELTA.........FL.................HP--...-----..EEFPH...MRDI.......
ENSBTAP00000021603  ---.....---------.........FA.................ESLG...LKPQD..-----...---M.......
ENSBTAP00000010838  SDD.....TIEKEDLLR.........LM.................KDNF...PNFLG..-ACEK...RGRD.......
ENSBTAP00000014575  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000011215  HDL.....YISQADLSR.........YN.................DQAS...SN---..-----...---R.......
ENSBTAP00000053698  GNG.....FISKQELGM.........AM.................RSLG...YMPSE..-----...---V.......
ENSBTAP00000006806  --Gdky..KLSKKELKE.........LL.................QTEL...SG---..FLDAQ...KDAD.......
ENSBTAP00000029334  SGG.....YITGDQART.........FF.................LQSG...LPA--..-----...---P.......
ENSBTAP00000044105  SDD.....TIEKEDLLR.........LM.................KENF...PNFLS..-ACEK...RGRQ.......
ENSBTAP00000026904  GDRf....KLNKGELKM.........LL.................QREL...TE---..FLSCQ...KDPE.......
ENSBTAP00000017060  LDG.....YVSGQEVKE.........IF.................MHSG...LTQ--..-----...---N.......
ENSBTAP00000055520  NRGgh...D--------.........--.................----...-----..-----...----.......
ENSBTAP00000044226  --Gdky..KLSKKELKE.........LL.................QTEL...SG---..FLDAQ...KDAD.......
ENSBTAP00000055624  NRGgh...D--------.........--.................----...-----..-----...----.......
ENSBTAP00000042182  EEE.....ELGAPQLQI.........LL.................SIAL...EPARAhaQTPRE...IGLR.......
ENSBTAP00000010796  KQG.....EIPGPEFLA.........LV.................EKFN...LDISR..-----...---D.......
ENSBTAP00000021174  GSG.....YLEGKELQN.........LI.................QELQ...QARKK..--AGL...ELSP.......
ENSBTAP00000006275  DKH.....KLKKSELKE.........LI.................NNEL...SHFLE..EIKEQ...---E.......
ENSBTAP00000020950  SGP.....GLNLEEFIA.........FE.................HP--...-----..EEVDY...MTEF.......
ENSBTAP00000053738  KQG.....EIPGPEFLA.........LV.................EKFN...LDISR..-----...---D.......
ENSBTAP00000004963  GDVklanvGLDRNTFRV.........IL.................HSIF...GMTDD..-----...---V.......
ENSBTAP00000023774  GNG.....FISKQELGT.........AM.................RSLG...YMPNE..-----...---V.......
ENSBTAP00000020395  KSG.....RLNHQEFKS.........CL.................RSLG...YDLP-..MVEEG...EPDP.......
ENSBTAP00000020150  DKG.....YLTKEDLRV.........LM.................EKEF...PG---..FLENQ...KDPL.......
ENSBTAP00000025561  --Gdkf..KLNKSELKE.........LL.................TREL...PS---..FLGKR...TDET.......
ENSBTAP00000053738  RDG.....ILTMHDLHR.........LL.................QHLL...FNLKD..-----...---E.......
ENSBTAP00000034009  HFD.....TLNKRELKQ.........LI.................TKEL...PK---..TLQNT...KDQP.......
ENSBTAP00000020539  ETG.....LIALSDWAA.........AV.................ESVL...HLGLP..-----...--WR.......
ENSBTAP00000020778  PDL.....LLTESEFLS.........FL.................HP--...-----..EHSRG...MLQF.......
ENSBTAP00000017461  NKG.....YLSREDFKV.........AV.................VMLFg..YKPSK..-----...---I.......
ENSBTAP00000044096  HYD.....TLIQKEFKQ.........LV.................QKEL...PNF--..LKKQK...KNEA.......
ENSBTAP00000008523  HYD.....TLIQKEFKQ.........LV.................QKEL...PNF--..LKKQK...KNEA.......
ENSBTAP00000035196  NDG.....TLNDAELNF.........FQ.................RICF...NTPLA..----P...QALE.......
ENSBTAP00000041997  VDG.....KITGANAKK.........EM.................VR--...SKLPN..-----...---S.......
ENSBTAP00000025499  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000055481  ISG.....FITGNWIEK.........LF.................FQSG...LPQ--..-----...---P.......
ENSBTAP00000002174  VNG.....KITGANAKK.........EM.................VK--...SKLPN..-----...---T.......
ENSBTAP00000000589  GDKf....KLSKGEMKE.........LL.................HKEL...PS---..FVGEK...VDEE.......
ENSBTAP00000028239  ADG.....KLSGTKAKT.........WM.................--VG...TKLPN..-----...---S.......
ENSBTAP00000014894  HGG.....ALGPEEFKA.........CL.................ISLG...YD---..VENDR...QGDA.......
ENSBTAP00000026544  SSG.....FISAAELCN.........FL.................RDLF...LHHKK..AISEA...KLEE.......
ENSBTAP00000029333  ISG.....FITGNWIEK.........LF.................FQSG...LPQ--..-----...---P.......
ENSBTAP00000041966  QGL.....DIDATQLQS.........LL.................NREF...LRGPP..--GDP...FSLD.......
ENSBTAP00000008933  ---.....-ISGINAKK.........EM.................V--T...SKLPN..-----...---S.......
ENSBTAP00000056088  HFD.....TLNKRELKQ.........LI.................TKEL...PKT--..LQQNT...KDQP.......
ENSBTAP00000033794  DAE.....TLSLEELKA.........LL.................MDNV...PRFME..-TLGR...KEPY.......
ENSBTAP00000012786  KNG.....LMDHEDFRA.........CL.................ISMG...YDLGE..-----...---A.......
ENSBTAP00000030018  RNG.....MMEPDDFRA.........CL.................ISMG...YDLGE..-----...---V.......
ENSBTAP00000040233  NNM.....TVTKSELRR.........VI.................TTFL...LPLTR..-----...---E.......
ENSBTAP00000003365  -DN.....IISKDQLYL.........AL.................QHAG...RNPSQ..-----...----.......
ENSBTAP00000053176  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000024301  HSG.....TLGPEEFKA.........CL.................ISLG...YD---..IGNDP...QGEA.......
ENSBTAP00000022292  GEH.....YMTPEDFVQ.........RY.................LGLY...NDPNS..-----...-NPK.......
ENSBTAP00000015611  ECG.....TLSKDELKE.........LL.................EKEF...RP---..ILKNP...DDPD.......
ENSBTAP00000012770  HNG.....MLSKEELSR.........YG.................TATM...TN---..-----...---V.......
ENSBTAP00000000847  REGskl..TLSRKELKE.........LI.................KKELclgEKMRE..-----...---S.......
ENSBTAP00000053738  NNM.....TVTKSELRR.........VI.................TTFL...LPLTR..-----...---E.......
ENSBTAP00000054975  QSG.....YLDEEELKF.........FL.................QKFEsgaRELTE..-----...---S.......
ENSBTAP00000046639  GNG.....LLDKADFKQ.........AL.................KLFR...LEVSE..-----...---N.......
ENSBTAP00000052345  NTG.....RVLASDAAV.........FL.................KKSG...LPD--..-----...---L.......
ENSBTAP00000053164  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000016774  NYH.....AVYRDDLKQ.........LL.................ETEC...PKFMK..-----...--KK.......
ENSBTAP00000022630  DPN.....QLSKEELKL.........LL.................QTEF...PSLLK..-----...-GPS.......
ENSBTAP00000010796  DTG.....FVKASDFGQ.........VL.................KDFC...YKLTD..-----...---N.......
ENSBTAP00000021909  KDG.....FVTEGELKS.........WI.................KHAQ...KKYIY..-----...---D.......
ENSBTAP00000033974  GKG.....QVKTDELEW.........LV.................SLLG...INSTK..-----...---S.......
ENSBTAP00000006711  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000010796  GNG.....ILRRRDMKN.........AL.................YGFD...IPLTP..-----...---R.......
ENSBTAP00000004912  GEF.....FMSPNDFVT.........RY.................LNIFge.SQP--..-----...-NPK.......
ENSBTAP00000005979  MDQ.....ALSDQELNA.........FQ.................TSCF...GHPLA..-----...--PQ.......
ENSBTAP00000053738  DTG.....FVKASDFGQ.........VL.................KDFC...YKLTD..-----...---N.......
ENSBTAP00000053746  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000023221  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000019429  RDG.....FIDLMELKL.........MM.................EKLG...APQTH..-----...---L.......
ENSBTAP00000052019  GDSt....SLCKEELKQ.........LL.................LAEF...GD---..ILRRP...NDPE.......
ENSBTAP00000042244  RDG.....FIDLMELKL.........MM.................EKLG...APQTH..-----...---L.......
ENSBTAP00000053738  PDG.....QITGQELQR.........IL.................NCMV...VKISD..-----...---S.......
ENSBTAP00000018877  --N.....KISKSSFRK.........ML.................QKEL...NH---..MLTDT...GNRK.......
ENSBTAP00000053019  NSG.....YVSDYELQD.........LF.................KEAS...LPLPG..YKVR-...---E.......
ENSBTAP00000003073  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000012886  QKG.....FITIVDVQR.........VL.................ESIG...VQMDE..-----...---N.......
ENSBTAP00000044222  SGN.....PLCQAKFKE.........LL.................EKEL...PTWAP..---TT...LREC.......
ENSBTAP00000028499  RKG.....SLSVNEFKE.........LV.................TQQL...PHLLK..-----...-DVG.......
ENSBTAP00000047378  GTG.....FLDREELTQ.........LC.................LKLH...LEK--..-----...---Q.......
ENSBTAP00000009308  GNG.....YISCSELND.........LF.................KAAC...LPLPG..YRVR-...---E.......
ENSBTAP00000017060  YTG.....RVGASEAAL.........FL.................KKSG...LSD--..-----...---I.......
ENSBTAP00000050406  SNG.....FICDYELHE.........LF.................KEAN...MPLPG..YKVR-...---E.......
ENSBTAP00000031879  SNG.....FICDYELHE.........LF.................KEAN...MPLPG..YKVR-...---E.......
ENSBTAP00000031854  RTG.....FVSAQSFIT.........IW.................RKLL...SNHHD..-----...---D.......
ENSBTAP00000001250  ---.....---------.........--.................----...--PES..-----...---E.......
ENSBTAP00000026035  GDCa....VLERGELKR.........LL.................EKEF...AD---..VIVKP...HDPA.......
ENSBTAP00000011215  RTG.....FVSAQSFIT.........IW.................RKLL...SNHHD..-----...---D.......
ENSBTAP00000002128  -EN.....YIDAEELQS.........IL.................PSIG...ITLSD..-----...---K.......
ENSBTAP00000053194  LTG.....RLSHKDFRS.........CL.................RGLN...YYLP-..MVEEG...EPEP.......
ENSBTAP00000056127  GDG.....FVTTEELKT.........WI.................KRVQ...KRYIY..-----...---D.......
ENSBTAP00000033188  QDG.....KITRQEFID.........GI.................LASK...FPTTK..-----...---L.......
ENSBTAP00000053548  QDG.....KITRQEFID.........GI.................LSSK...FPTSR..-----...---L.......
ENSBTAP00000011687  HKK.....TLNDVLFYH.........FL.................HH-V...TDLTR..-----...---N.......
ENSBTAP00000007636  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000020950  SDG.....FLTESELSS.........WI.................QMSF...KHYAM..-----...---Q.......
ENSBTAP00000009115  KTG.....CIDLHGMMC.........TL.................AKLG...MNLTK..-----...---H.......
ENSBTAP00000023873  PTG.....LVDEDTFKL.........IY.................SQFF...PQGDA..-----...--TT.......
ENSBTAP00000054471  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000039694  GMN.....TISEEDFAH.........IL.................LR--...--YTN..VEN--...---T.......
ENSBTAP00000025205  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000047882  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000001368  ---.....---------.........--.................---M...VEHIE..-----...---K.......
ENSBTAP00000029786  ---.....RIDLEQFKG.........MF.................ALLF...P----..WACGT...HSDV.......
ENSBTAP00000028993  RSG.....RLEREEFRA.........LC.................AELR...VRP--..-----...---A.......
ENSBTAP00000023678  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000034710  PTG.....SVDMRSMKA.........AL.................SNVG...VQLSP..-----...---Q.......
ENSBTAP00000031823  GDG.....WVSLAELRS.........WI.................AHTQ...QRHIR..-----...---D.......
ENSBTAP00000038002  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000021074  DAA.....TLTCTELKQ.........LI.................QSEF...EDIFQ..----P...CAIH.......
ENSBTAP00000026544  EKG.....YIEEKELDA.........FF.................YHMLtk.LGVDD..AVKEE...NVQK.......
ENSBTAP00000007217  RDH.....FIRTLSLKP.........LL.................FEIP...GFLSD..-----...---E.......
ENSBTAP00000029792  ---.....RIDAHQFRE.........LF.................AS--...--LTP..WACGA...HTPV.......
ENSBTAP00000044088  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000017319  PDG.....KLRKATAKN.........LL.................QTQF...KN---..FAEGQ...ETKA.......
ENSBTAP00000044100  ---.....---------.........--.................----...-----..-----...---K.......
ENSBTAP00000033594  DDW.....KLSKNEVKV.........YL.................KKEF...EKHGA..VVNES...HHDV.......
ENSBTAP00000026766  RTG.....RFDLETFGP.........LV.................S---...-----..---PP...IRPS.......
ENSBTAP00000055894  NEG.....EIDLMSLKR.........MM.................EKLG...VPKTH..-----...---L.......
ENSBTAP00000015220  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000033613  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000056320  HDL.....LIDAQDLAR.........--.................----...-----..HNDHA...ISTK.......
ENSBTAP00000025249  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000029159  ---.....---------.........--.................----...-----..--ISK...HVQR.......
ENSBTAP00000044088  ---.....-LHYKEFRR.........FM.................ENLQ...AEVQE..MEFLQ...FSKGlsfmrke
ENSBTAP00000016319  STK.....KVSANGRVL.........EL.................FR-A...AQLPN..-----...---D.......
ENSBTAP00000017662  GHG.....EVDAQSLEN.........IL.................LLVG...ISLTT..-----...---A.......
ENSBTAP00000012479  SSG.....FLLQSQLSH.........LF.................LRLE...VPLQL..-----...---P.......
ENSBTAP00000029886  GDS.....RLDSSEFLK.........FVeqnetainittyadqenN---...-----..-----...---Kllrgl..
ENSBTAP00000027388  EDG.....GIDIMSLKR.........MM.................EKLG...VPKTH..-----...---L.......
ENSBTAP00000039694  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000023673  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000041488  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000001452  NDR.....QLSKTEISH.........YL.................KKEF...EKDEK..PRDQS...YQTA.......
ENSBTAP00000028498  GKE.....TLTPSELRD.........LV.................TQQL...PHLMP..-----...-SNC.......
ENSBTAP00000001426  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000020240  GKG.....VISKRDFHK.........AM.................ES--...-----..--HKH...YTQS.......
ENSBTAP00000053650  GKG.....VISKRDFHK.........AM.................ES--...-----..--HKH...YTQS.......
ENSBTAP00000041651  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000005154  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000021174  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000022068  GDG.....FVRIEDFVQ.........FA.................TVYG...A----..-----...---E.......
ENSBTAP00000026682  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000007636  VDG.....RITERQFGG.........ML.................LAYS...-----..----G...VQSK.......
ENSBTAP00000027954  NTG.....FISTGKFRS.........LL.................DSHS...SKLDP..-----...---H.......
ENSBTAP00000020778  TDR.....RISAKEMQK.........WI.................MQKT...AEHF-..----Q...EAVA.......
ENSBTAP00000013601  ---.....-IDTAKLYP.........IL.................MSSG...LPR--..-----...---E.......
ENSBTAP00000005477  ---.....HICLSELPF.........VM.................RAIG...FYPSE..-----...---G.......
ENSBTAP00000055305  GKG.....IISKKEFQK.........AM.................----...-----..EGQKQ...YTQS.......
ENSBTAP00000036054  GKG.....IISKKEFQK.........AM.................----...-----..EGQKQ...YTQS.......
ENSBTAP00000004912  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000022292  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000002717  HKD.....ELSFEQFHL.........FY.................KKLM...FEQQK..SILDE...FKKD.......
ENSBTAP00000036015  KSG.....KVSKSQLKV.........LS.................HNLY...TV---..-LHIP...HDPV.......
ENSBTAP00000051638  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000026766  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000053738  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000016306  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000013714  DNG.....FIPDSLLED.........VM.................KALD...LVSDP..-----...---E.......
ENSBTAP00000036550  ---.....-IDAQQFAR.........LF.................QLV-...---SP..WTCGA...HTEI.......
ENSBTAP00000053738  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000023383  RED.....RISAKDLKN.........ML.................SQVN...YRVPN..-----...--MR.......
ENSBTAP00000027030  RDG.....HLNRKKLVS.........IC.................EQYGl..QNVDG..-----...---E.......
ENSBTAP00000053270  RDG.....HLNRKKLVS.........IC.................EQYGl..QNVDG..-----...---E.......
ENSBTAP00000054640  RDG.....HLNRKKLVS.........IC.................EQYGl..QNVDG..-----...---E.......
ENSBTAP00000012770  ---.....MINYENFLK.........VG.................EKAG...PKCKQ..-----...--FF.......
ENSBTAP00000009967  PKG.....IIGNKAFAD.........LLldlvt............LNLG...TNNFP..SSWMN...LTQP.......
ENSBTAP00000015183  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000014222  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000026288  GDG.....TVTKEDFVL.........TL.................EERQ...DFVNS..-----...---E.......
ENSBTAP00000002128  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000003365  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000053738  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000009228  PRG.....LISKKDFKK.........AM.................----...-----..DSQKQ...FTGP.......
ENSBTAP00000026785  ---.....VISVSELIN.........AM.................KQIK...HI-PE..-----...---S.......
ENSBTAP00000002578  HSG.....KVSKSQLKV.........LS.................HNLC...TVLKV..----P...HDPV.......
ENSBTAP00000000106  VDG.....KLTYQQIED.........TL.................ESVG...PEPER..-----...----.......
ENSBTAP00000028840  GKH.....QISREEFIV.........AL.................KAIG...VPLKN..-----...---Q.......
ENSBTAP00000053594  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000055414  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000026698  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000017015  PDC.....SLTLEDFLR.........YR.................HQTAk..RGNSD..RALSE...EQEE.......
ENSBTAP00000049908  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000021395  PSV.....RVKVEKLEM.........AL.................NYLG...IQPTK..-----...---E.......
ENSBTAP00000007194  ---.....---------.........--.................----...-----..-----...----.......
ENSBTAP00000025455  ---.....---------.........--.................----...-----..-----...----.......


                              70                                      80                            
                               |                                       |                            
d1df0a1               .TCKIMVDML.....DED.......GS.GK..............LG...LKEFYILWT....................
ENSBTAP00000019411  .ELQDMINEV.....DAD.......GN.GT..............ID...FPEFLTMMArkmkdtd.............
ENSBTAP00000036057  .ELQDMINEV.....DAD.......GN.GT..............ID...FPEFLTMMArkmkdtd.............
ENSBTAP00000038404  .FAEHVFRTF.....DAN.......GD.GT..............ID...FREFIIALSvtsrgk..............
ENSBTAP00000010971  .FAEHVFRTF.....DTN.......SD.GT..............ID...FREFIIALSvtsrgr..............
ENSBTAP00000019803  .TCRSMVAVM.....DSD.......TT.GK..............LG...FEEFKYLWN....................
ENSBTAP00000014038  .LVQRVIDIF.....DTD.......GN.GE..............VD...FKEFIEGVSqfsvkgd.............
ENSBTAP00000002055  .ELQDMINEV.....DAD.......GN.GT..............ID...FPEFLTMMArkmkdtd.............
ENSBTAP00000049731  .ELQDMINEV.....DAD.......GN.GT..............ID...FPEFLTMMArkmkdtd.............
ENSBTAP00000005577  .FAEHVFRTF.....DTN.......GD.GT..............ID...FREFIIALSvtsrgk..............
ENSBTAP00000034949  .YAQHVFRSF.....DAN.......SD.GT..............LD...FKEYVIALHmtsagk..............
ENSBTAP00000017447  .RAMQIIEMY.....EPDedlk...KQ.GL..............IS...SDGFCRYLM....................
ENSBTAP00000010858  .CLNWLLNVY.....DTG.......RT.GR..............IR...VLSFK----....................
ENSBTAP00000046644  .QVQVLIEKY.....EPNnsla...KK.GQ..............IS...VDGFMRYLS....................
ENSBTAP00000022814  .FAQHAFRTF.....DKN.......GD.GT..............ID...FREFICALSitsrgs..............
ENSBTAP00000019758  .CTTRFFETC.....DLD.......ND.KY..............IA...LDEWAGCFG....................
ENSBTAP00000019321  .FAQHAFRTF.....DKN.......GD.GT..............ID...FREFICALSvtsrgs..............
ENSBTAP00000011677  .SCRSMIALM.....DTD.......GS.GR..............LN...LQEFHHLWK....................
ENSBTAP00000011680  .SCRSMIALM.....DTD.......GS.GR..............LN...LQEFHHLWK....................
ENSBTAP00000021742  .YATFLFNAF.....DTN.......HD.GS..............VS...FEDFVAGLSvilrgt..............
ENSBTAP00000005348  .CITRFFEEC.....DPN.......KD.KH..............IT...LQEWGHCFEi...................
ENSBTAP00000016609  .ETALESCGL.....NFN.......RS.ES..............IR...PDEFSLEIFerflnklc............
ENSBTAP00000012740  .---------.....---.......--.--..............--...--------Tttydgleqmhknlvnvplc.
ENSBTAP00000018403  .ELKKLISQL.....DTD.......KN.GS..............IS...FQEFLEAMAaglqts..............
ENSBTAP00000026407  .DVDIVFSKV.....KAK.......SA.RV..............IN...YEEFKKALEelapkrf.............
ENSBTAP00000052557  .EMKRMIADV.....DKE.......GT.GK..............IS...FNDFLAVMTqkmaekd.............
ENSBTAP00000054167  .YAHFLFNAF.....DTD.......HN.GA..............VS...FEDFIKGLSillrgt..............
ENSBTAP00000010319  .EIKKMISEI.....DKE.......GT.GK..............MN...FSDFLTVMTqkmsekd.............
ENSBTAP00000041545  .YAFQLFQTA.....DTS.......QS.GT..............LE...GEEFVEFYKslt.................
ENSBTAP00000055204  .TVRSIISMF.....DRE.......NK.AG..............VN...FSEFTGVWK....................
ENSBTAP00000003718  .YAHYLFHAF.....DTT.......QT.GS..............VK...FEDFVTALSillrgt..............
ENSBTAP00000011676  .TCREMISLM.....DSN.......GT.GS..............LE...LVEFKTLWL....................
ENSBTAP00000049395  .YARKIFKEC.....DHS.......QT.DS..............LE...DEEIETFYKilt.................
ENSBTAP00000054983  .DVDIVFSKI.....KGK.......SC.RT..............IT...FEQFKEALE....................
ENSBTAP00000052219  .TCRLMVSML.....DRD.......MS.GT..............MG...FNEFKELWA....................
ENSBTAP00000025402  .--------L.....PKG.......KN.DA..............IN...PEDFPESVYksflmslc............
ENSBTAP00000011678  .SCRSMVNLM.....DRD.......GN.GK..............LG...LVEFNILWN....................
ENSBTAP00000000433  .NIYKLMEGK.....D--.......--.--..............--...---------....................
ENSBTAP00000021491  .EIKKMIAET.....DKE.......GI.GT..............IS...FEKFFAIMSvkmsekd.............
ENSBTAP00000044733  .TCKIMVDML.....DSD.......GS.GK..............LG...LKEFYILWT....................
ENSBTAP00000010937  .KVRQMFQEA.....DTDe......NQ.GT..............LT...FEEFCVFYKmms.................
ENSBTAP00000056439  .KVRQMFQEA.....DTDe......NQ.GT..............LT...FEEFCVFYKmms.................
ENSBTAP00000055780  .ELQEMIDEV.....DED.......GS.GT..............VD...FDEFLVMMVrcmkddskgk..........
ENSBTAP00000038002  .DVLKLFEDG.....EMAeyl....QG.DA..............IG...YEGFQQFLKiylevdnv............
ENSBTAP00000034705  .YAYGLFKEC.....DRS.......KN.ER..............LEgpeIEEFLRRLL....................
ENSBTAP00000035936  .YVEAMFRAF.....DTN.......GD.NT..............ID...FLEYVAALNlvlrgt..............
ENSBTAP00000013699  .TCLMMINMF.....DKT.......KS.GR..............ID...VYGFSALWK....................
ENSBTAP00000002564  .---------.....---.......--.--..............-K...FSAYRTAMKlrrvqkalrldlv.......
ENSBTAP00000011496  .FATFVFNVF.....DEN.......KD.GR..............IE...FSEFIQALSvtsrgt..............
ENSBTAP00000019111  .DVLKILKDY.....DRE.......AT.GK..............IT...FEDFNEVVTdwilerd.............
ENSBTAP00000017036  .YVEQMFETF.....DFN.......KD.GY..............ID...FMEYVAALSlvlkgk..............
ENSBTAP00000003213  .RVKQMFKEA.....DTDd......HQ.GT..............LG...FEEFCAFYKmms.................
ENSBTAP00000055444  .RVKQMFKEA.....DTDd......HQ.GT..............LG...FEEFCAFYKmms.................
ENSBTAP00000024550  .TCRIMIAML.....DRD.......YS.GK..............MG...FNEFKELWA....................
ENSBTAP00000015248  .YLEGMMSEA.....P--.......--.GP..............IN...FTMFLTMFGeklngtd.............
ENSBTAP00000021328  .YLDAMMNEA.....P--.......--.GP..............IN...FTMFLTMFGeklngtd.............
ENSBTAP00000037091  .YLEAMMNEA.....P--.......--.GP..............IN...FTMFLTMFGeklngtd.............
ENSBTAP00000029967  .ELIEISQQI.....S--.......-G.GK..............VD...FEDFVELMGpkllaetadmi.........
ENSBTAP00000021449  .ELIELGQQI.....RMN.......LG.GR..............VD...FDDFVELMTpkllaetagmi.........
ENSBTAP00000053176  .---------.....---.......-N.QT..............ID...FEGFKLFMKtfleael.............
ENSBTAP00000042361  .ELIELSQQI.....NMN.......LG.GH..............VD...FDDFVELMGpkllaetadmi.........
ENSBTAP00000016509  .YVEAMFRAF.....DTN.......GD.NT..............ID...FLEYVAALNlvlrgt..............
ENSBTAP00000026714  .ELIELSQQI.....NMN.......LG.GH..............VD...FDDFVELMGpkllaetadmi.........
ENSBTAP00000004690  .VCRCMVNLL.....DKD.......GS.GK..............LG...LREFQVLWR....................
ENSBTAP00000010858  .---------.....---.......--.--..............--...---------....................
ENSBTAP00000013117  .KIELKFKEL.....HKS.......RD.KTgtd...........VI...KEEFVEVFHelc.................
ENSBTAP00000017574  .HVKYIFKDN.....DRL.......KQ.GR..............IT...IEEFRTIYRiit.................
ENSBTAP00000004885  .AEEKIFTTG.....DVN.......KD.GK..............LD...FEEFMKYLKd...................
ENSBTAP00000008961  .EAMALKSTI.....DLT.......CN.DY..............IS...VFEFDIFTR....................
ENSBTAP00000028063  .---------.....---.......--.--..............--...---------....................
ENSBTAP00000012740  .---------.....---.......--.--..............--...---------....................
ENSBTAP00000006283  .ELIEVSQHV.....KMR.......MG.GR..............VD...FEEFVEMMGpklreetahml.........
ENSBTAP00000014306  .EVLKVLGNP.....KSD.......EM.NVkv............LD...FEHFLPMLQtvaknkdqg...........
ENSBTAP00000053252  .KIRLKFKEI.....QKS.......KE.KLttr...........VT...EEEFCEAFCelc.................
ENSBTAP00000014304  .EVLKVLGNP.....KSD.......EM.NVkv............LD...FEHFLPMLQtvaknkdqg...........
ENSBTAP00000045669  .---------.....---.......--.--..............--...---------....................
ENSBTAP00000041264  .TALALRSTI.....DLT.......CS.GH..............VS...IFEFDIFTRlfq.................
ENSBTAP00000006711  .KIKYVLAEF.....NEG.......GS.LKqygphep.......IS...YDVFKLFMKayl.................
ENSBTAP00000017358  .EAMALKSTI.....DLT.......CN.DY..............IS...VFEFDIFTR....................
ENSBTAP00000053274  .---------.....---.......--.--..............--...---------....................
ENSBTAP00000055296  .EAMALKSTI.....DLT.......CN.DY..............IS...VFEFDIFTR....................
ENSBTAP00000016852  .EAEELFRRF.....DKD.......GN.GT..............ID...FNEFLLTLRppmsra..............
ENSBTAP00000036380  .EAQRHLQTH.....RID.......RN.GE..............LD...FSTFLTIMHmqikqed.............
ENSBTAP00000041719  .EVLRVLGYP.....KSDel.....KS.RR..............VD...FETFLPMLQavaklpdrg...........
ENSBTAP00000049636  .EVKKVLGNP.....SNEem.....NA.KK..............IE...FEQFLPMLQaisnnkdqg...........
ENSBTAP00000024444  .EIDEMLKEA.....P--.......--.GP..............IN...FTVFLQMFGeklkgad.............
ENSBTAP00000004556  .SLGWMFNKL.....DMN.......YD.LL..............LD...HSEINAIYLdk..................
ENSBTAP00000038767  .---RIINAF.....FPE.......GE.DQ..............VN...FRGFMRTLAhfrpiednekskdvngpepl
ENSBTAP00000031285  .CIRPFFNSC.....DTY.......KD.GR..............VS...TAEWCFCFW....................
ENSBTAP00000011457  .IMDRVFRGF.....DKD.......ND.GC..............IS...VTEWVYGLSvflrgt..............
ENSBTAP00000011047  .EVLRVLGKP.....KQEel.....NS.KM..............MD...FDTFLPMLQhisknkdtg...........
ENSBTAP00000002564  .---------.....---.......--.--..............--...---------....................
ENSBTAP00000037104  .ELEAMVKEA.....P--.......--.GP..............IN...FTVFLTMFGeklkgtd.............
ENSBTAP00000002672  .ELDAMLQEG.....K--.......--.GP..............IN...FTVFLTLFGeklngtd.............
ENSBTAP00000028269  .ELDAMMKEA.....S--.......--.GP..............IN...FTVFLNMFGeklkgad.............
ENSBTAP00000016647  .---RIIDSF.....FPD.......GS.LR..............LD...FPGFVRVLAhfrpvdeeddgnrdpkepep
ENSBTAP00000004536  .AQQGISPEG.....DTD.......PD.GG..............LD...LEEFILYLQe...................
ENSBTAP00000042177  .CVKKFVEYC.....DVN.......ND.KS..............IS...LQELMGCLG....................
ENSBTAP00000028063  .---------.....---.......--.--..............--...---------....................
ENSBTAP00000050283  .EVLRVLGKP.....KPEem.....NS.KM..............LD...FETFLPILQhisrnkeqg...........
ENSBTAP00000048539  .PLQQLFALF.....DRN.......ND.GT..............ID...FREYVIGLTvlcnpvn.............
ENSBTAP00000045669  .---------.....---.......--.--..............--...---------....................
ENSBTAP00000007972  .EMEGVCRRW.....DRD.......GS.GT..............LD...LEEFLRALRppmsqa..............
ENSBTAP00000040815  .CARRFTDYC.....DLN.......KD.KV..............IS...LPELKGCL-....................
ENSBTAP00000025661  .VLRQLFALF.....DRN.......HD.GS..............ID...FREYVIGLAvlcnpan.............
ENSBTAP00000028350  .---RICKVF.....STSp......SR.DS..............LS...FEDFLDLLSvfsdtat.............
ENSBTAP00000053274  .---------.....---.......--.--..............--...---------....................
ENSBTAP00000021537  .FRQRIAQVF.....SED.......GD.GH..............MT...LDNFLDMFSvmsemap.............
ENSBTAP00000055481  .QLASIWNLS.....DID.......QD.GK..............LT...AEEFILAMH....................
ENSBTAP00000039155  .ELQKVVGEL.....DCD.......GR.GP..............VG...FPELLGLMAwkvkagd.............
ENSBTAP00000029333  .QLASIWNLS.....DID.......QD.GK..............LT...AEEFILAMH....................
ENSBTAP00000016315  .ELSYIWELS.....DAD.......CD.GA..............LT...LPEFCAAFH....................
ENSBTAP00000021091  .ACQGILALL.....DLN.......AS.GT..............VS...IQEFRDLWK....................
ENSBTAP00000021618  .FVQSMFSLA.....DKD.......GN.GY..............LS...FREFLDILVvfmkgs..............
ENSBTAP00000055520  .TLSLLTTMY.....DST.......GT.GF..............I-...---------....................
ENSBTAP00000055624  .TLSLLTTMY.....DST.......GT.GF..............I-...---------....................
ENSBTAP00000016319  .ELSHIWELS.....DFD.......KD.GA..............LT...LDEFCAAFH....................
ENSBTAP00000034078  .ELHDLIAEV.....EEEe......PT.GY..............IR...FEKFLPVMTevllerryrpi.........
ENSBTAP00000006645  .---------.....--S.......HN.NV..............FS...FEDVLGMASvfseqac.............
ENSBTAP00000021909  .VVQETMEDI.....DKN.......AD.GF..............ID...LEEYIGDMYshdgnadepe..........
ENSBTAP00000001426  .KMKEFMQKY.....DKN.......SD.GK..............IE...MAELAQILPteenfllcfrqhvg......
ENSBTAP00000015802  .WKQKIVQAG.....DKD.......LD.GQ..............LD...FEEFVHYLQd...................
ENSBTAP00000032680  .WKQKIVQAG.....DKD.......LD.GQ..............LD...FEEFVHYLQd...................
ENSBTAP00000055007  .ELDAIIEEV.....DED.......GS.GT..............ID...FEEFLVMMVrqmkedakgk..........
ENSBTAP00000020148  .VLDRMMKKL.....DLN.......SD.GQ..............LD...FQEFLNLIG....................
ENSBTAP00000052345  .LLAHIWALC.....DTK.......NC.GK..............LS...KDQFALAFH....................
ENSBTAP00000029334  .QLATIWTLA.....DID.......GD.GQ..............LK...AEEFILAMH....................
ENSBTAP00000052345  .ILGRVWELS.....DID.......HD.GM..............LD...RDEFAVAMF....................
ENSBTAP00000056127  .VVLETLEDI.....DKN.......GD.GF..............VD...QDEYIADMFsheesgpepd..........
ENSBTAP00000012557  .SLSSHLVTT.....DKD.......GN.--..............ID...Y------MSgfqdvhiqkpvkevqsslie
ENSBTAP00000011888  .FAERFFVLF.....DSD.......GS.GT..............IT...LQELQKALTllihgs..............
ENSBTAP00000017060  .VLGRVWDLS.....DID.......KD.GH..............LD...RDEFAVAMH....................
ENSBTAP00000031854  .IIERIFSGAvtrgkTVQ.......KE.GR..............MS...YADFVWFLIseedkr..............
ENSBTAP00000031823  .VIAETLEDL.....DRN.......KD.GY..............VQ...VEEYIADLYtaepgeeepa..........
ENSBTAP00000021603  .FVESMFSLA.....DKD.......GN.GY..............LS...FREFLDVLVvfmkgs..............
ENSBTAP00000010838  .YLSNIFEKQ.....DKN.......KD.RK..............ID...FSEFLSLLA....................
ENSBTAP00000014575  .FKERIVEAF.....SED.......GE.GN..............LT...FNDFVDMFSvlcesap.............
ENSBTAP00000011215  .IIERIFSGAvtrgkTVQ.......KE.GR..............MS...YADFVWFLIseedkr..............
ENSBTAP00000053698  .ELAIIMQRL.....DMD.......GD.GQ..............VD...FDEFMTILGpklvssegrdgf........
ENSBTAP00000006806  .AVDKVMKEL.....DEN.......GD.GE..............VD...FQEYVVLVA....................
ENSBTAP00000029334  .VLAEIWALS.....DLN.......KD.GK..............MD...QQEFSIAMK....................
ENSBTAP00000044105  .YLSDIFEKK.....DKN.......KD.KK..............ID...FSEFLSLLA....................
ENSBTAP00000026904  .LVDKIMQDL.....DAN.......KD.NE..............VD...FNEFVVMVA....................
ENSBTAP00000017060  .LLAHIWALA.....DTR.......QT.GK..............LS...KDQFALAMY....................
ENSBTAP00000055520  .---------.....---.......--.--..............--...---------....................
ENSBTAP00000044226  .AVDKVMKEL.....DEN.......GD.GE..............VD...FQEYVVLVA....................
ENSBTAP00000055624  .---------.....---.......--.--..............--...---------....................
ENSBTAP00000042182  .TCEQLLQCF.....G--.......HG.GS..............LD...LYHFQQLWG....................
ENSBTAP00000010796  .ECQQLLIKY.....DLK.......NN.GK..............FA...YCSFIQSCVlllkaketslmqrmkiqnan
ENSBTAP00000021174  .EMKTFVDQY.....GQR.......DD.GK..............IG...IVELAHVLPteenflllfrcqqlk.....
ENSBTAP00000006275  .VVDKVMETL.....DSD.......GD.GE..............CD...FQEFMAFVA....................
ENSBTAP00000020950  .VIQEALEEH.....DKD.......GD.GF..............VS...LEEFLGDYRrdptasedpew.........
ENSBTAP00000053738  .ECQQLLIKY.....DLK.......NN.GK..............FA...YCSFIQSCVlllkaketslmqrmkiqnan
ENSBTAP00000004963  .LMNRVFFAF.....DKD.......ND.NY..............IN...VKEWVKGLSvflrgt..............
ENSBTAP00000023774  .ELEVIIQRL.....DMD.......GD.GQ..............VD...FEEFVTLLGpklstsgipekf........
ENSBTAP00000020395  .EFEAILDTV.....DPN.......RD.GH..............VS...LQEYMAFMIsretenvk............
ENSBTAP00000020150  .AVDKIMKDL.....DQC.......RD.GK..............VG...FQSFFSLIA....................
ENSBTAP00000025561  .AFQKLMSNL.....DCN.......KD.NE..............VD...FQEYCVFLS....................
ENSBTAP00000053738  .EFERLLGLL.....GLR.......LS.IT..............LN...FREFRNLCEkrsfsadddapqrlprpkqk
ENSBTAP00000034009  .TIDKIFQDL.....DAD.......KD.GA..............VS...FEEFVVLVS....................
ENSBTAP00000020539  .MLRPQ--LV.....SSL.......TD.NK..............LA...YKSWLENLAkeklsqqniqsslletlyr.
ENSBTAP00000020778  .MVKEIIRDL.....DQD.......GD.KK..............LS...LSEFISLPVgtvenqqgqdvddsw.....
ENSBTAP00000017461  .EADSVMSSV.....DPN.......TS.G-..............IR...LKEFLDIVRkkkeaql.............
ENSBTAP00000044096  .AINEIMEDL.....DTN.......VD.KQ..............LS...FEEFIMLVA....................
ENSBTAP00000008523  .AINEIMEDL.....DTN.......VD.KQ..............LS...FEEFIMLVA....................
ENSBTAP00000035196  .DVKNVVRKH.....ISDgv.....AD.GG..............LT...LKGFLFLHTlfiqrgrhettwtvlrrfgy
ENSBTAP00000041997  .VLGKIWKLA.....DID.......KD.GM..............LD...DEEFALANH....................
ENSBTAP00000025499  .---------.....---.......--.--..............-D...HKKFFQMVGlkkk................
ENSBTAP00000055481  .VLAQIWALA.....DMN.......ND.GR..............MD...QVEFSIAMK....................
ENSBTAP00000002174  .VLGKIWKLA.....DVD.......RD.GL..............LD...DEEFALANH....................
ENSBTAP00000000589  .GLKKLMGDL.....DEN.......SD.QQ..............VD...FQEYAVFLA....................
ENSBTAP00000028239  .VLGRIWKLS.....DVD.......RD.GM..............LD...DEEFALASH....................
ENSBTAP00000014894  .EFNRIMSVV.....DPN.......HS.GL..............VT...FQAFIDFMSrettdtd.............
ENSBTAP00000026544  .YTGTMMKIF.....DKN.......KD.GR..............LD...LNDLARILAlqenfllqfkmdacssee..
ENSBTAP00000029333  .VLAQIWALA.....DMN.......ND.GR..............MD...QVEFSIAMK....................
ENSBTAP00000041966  .ECRSLVALM.....DLK.......VN.GR..............LD...QEEFSRLWS....................
ENSBTAP00000008933  .VLGKIWKLA.....DCD.......GD.GM..............LD...EEEFALAK-....................
ENSBTAP00000056088  .TIDKIFQDL.....DAD.......KD.GA..............VS...FEEFVVLVS....................
ENSBTAP00000033794  .YITQLFRAA.....DKN.......QD.NQ..............IC...FEEFLYILGklv.................
ENSBTAP00000012786  .EFARIMTLV.....DPN.......GQ.GT..............VT...FQSFIDFMTretadtd.............
ENSBTAP00000030018  .EFARIMTMV.....DPN.......AA.GV..............VT...FQAFIDFMTretaetd.............
ENSBTAP00000040233  .QFQDVLAQI.....PLT.......SS.GA..............VP...YLVFLSRFGgidlninvikrggenemngc
ENSBTAP00000003365  .---KTINKY.....WTS.......QT.AK..............LN...FDDFCIILRkekpt...............
ENSBTAP00000053176  .---------.....---.......--.--..............--...---IVCYLSllergr..............
ENSBTAP00000024301  .EFARIMSIV.....DPN.......RL.GV..............VT...FQAFIDFMSretadtd.............
ENSBTAP00000022292  .IVQLLAGVA.....DQT.......KD.GL..............IS...YQEFLAFESvlca................
ENSBTAP00000015611  .TVDVIMHIL.....DRD.......HD.RR..............LD...FTEFLLMVF....................
ENSBTAP00000012770  .FLDRVFQEC.....-LT.......YD.GE..............MD...YKTYLDFVLalenrk..............
ENSBTAP00000000847  .SIDDLMKSL.....DKN.......SD.QE..............ID...FKEYSVFLT....................
ENSBTAP00000053738  .QFQDVLAQI.....PLT.......SS.GA..............VP...YLVFLSRFGgidlninvikrggenemngc
ENSBTAP00000054975  .ETKSLMAAA.....DND.......GD.GK..............IG...ADEFQEM--....................
ENSBTAP00000046639  .DFESFWLIL.....NSS.......GN.GR..............AD...YGEFKRAIIgemney..............
ENSBTAP00000052345  .VLGKIWDLA.....DTD.......GK.GI..............LN...KQEFFVALR....................
ENSBTAP00000053164  .---------.....---.......--.--..............-N...YQNF-----....................
ENSBTAP00000016774  .DADTWFKEL.....DIN.......QD.GG..............IN...FEEFLVLVI....................
ENSBTAP00000022630  .TLDELFEEL.....DKN.......GD.GE..............VS...FEEFQVLVK....................
ENSBTAP00000010796  .QYHYFLRKL.....RLH.......LT.PY..............IN...WKYFLQNFSsyveetavewaekmprgprp
ENSBTAP00000021909  .NVENQWQEF.....DLN.......QD.GL..............IS...WDEYRNVTYgtylddpdpddgfnykq...
ENSBTAP00000033974  .ELASTAKDV.....DRV.......KK.GF..............FN...CSNLLALMGlywekaqn............
ENSBTAP00000006711  .---------.....---.......--.--..............--...--------Sllesgr..............
ENSBTAP00000010796  .EFEKLWMRY.....DSE.......GR.GH..............IT...YQEFLQKLGinysadihrpyaeeyfnfmg
ENSBTAP00000004912  .TVELLSGVV.....DQT.......KD.GL..............IS...FQEFVAFESvlca................
ENSBTAP00000005979  .ALEDVKMVV.....SKNvvggv..RD.DQ..............LT...LDGFLFLNTlfiqrgrhettwtilrrfgy
ENSBTAP00000053738  .QYHYFLRKL.....RLH.......LT.PY..............IN...WKYFLQNFSsyveetavewaekmprgprp
ENSBTAP00000053746  .---------.....---.......--.-E..............IN...FEDFLTIMSyfrpidttmdeeqvqlc...
ENSBTAP00000023221  .---------.....---.......--.--..............--...---------....................
ENSBTAP00000019429  .GLKSMIKEV.....DED.......FD.GK..............LS...FREFLLIFH....................
ENSBTAP00000052019  .TVETILSLL.....DRN.......RN.EH..............VD...FHEYLLMVF....................
ENSBTAP00000042244  .GLKNMIKEV.....DED.......FD.SK..............LS...FREFLLIFR....................
ENSBTAP00000053738  .EFRELMRIL.....DPG.......CT.GC..............VN...VSRFIELIEespklhkipaykdtkmplfl
ENSBTAP00000018877  .AADKLIQNL.....DAN.......HD.GR..............IS...FDEYWTLIG....................
ENSBTAP00000053019  .IVEKILAVA.....DNN.......KD.SR..............IS...FEEFVSLMQel..................
ENSBTAP00000003073  .---------.....---.......--.--..............--...---------....................
ENSBTAP00000012886  .TLHEILNEV.....DLN.......KN.GQ..............VE...LNEFLQLMS....................
ENSBTAP00000044222  .DYKQFISVL.....DTN.......KD.CQ..............VD...FVEYMRLLA....................
ENSBTAP00000028499  .SLDEKMKSL.....DVN.......QD.SE..............LK...FSEYWRLIG....................
ENSBTAP00000047378  .LPVLLHTLL.....GNN.......QF.AR..............VN...FEEFKDGFIavl.................
ENSBTAP00000009308  .ITENLMTTG.....DLD.......QD.GK..............IS...FDEFIKVFHgl..................
ENSBTAP00000017060  .ILGKIWDLA.....DPE.......GK.GY..............LD...KQGFYVALR....................
ENSBTAP00000050406  .IIQKLMLDG.....DRN.......KD.GK..............IS...FDEFVYIFQev..................
ENSBTAP00000031879  .IIQKLMLDG.....DRN.......KD.GK..............IS...FDEFVYIFQev..................
ENSBTAP00000031854  .ASKFICLLA.....K-P.......SC.SS..............LE...QDDFIPLLQdvvdthpgltflkdapefhs
ENSBTAP00000001250  .SLEDLFSLF.....DEG.......GG.GE..............VD...LREYVVALSvvcrpar.............
ENSBTAP00000026035  .TVDEVLRLL.....DED.......DT.GT..............VE...FKEFLVLVF....................
ENSBTAP00000011215  .ASKFICLLA.....K-P.......SC.SS..............LE...QDDFIPLLQdvvdthpgltflkdapefhs
ENSBTAP00000002128  .EFKKIVTDT.....ARN.......EN.GM..............VK...LDDFVSAVSkeqnlp..............
ENSBTAP00000053194  .KFEKFLDAV.....DPE.......RK.GY..............IS...KDEYIDFLTdkesenir............
ENSBTAP00000056127  .NVAKVWKDY.....DRD.......KD.DK..............IS...WEEYKQATYgyylgnptefqdtsdhhtfk
ENSBTAP00000033188  .EMTAVADIF.....DRD.......GD.GY..............ID...YYEFVAALH....................
ENSBTAP00000053548  .EMSAVADIF.....DRD.......GD.GY..............ID...YYEFVAALH....................
ENSBTAP00000011687  .QITVVFNML.....DWN.......AV.GE..............IG...FDQFYMLVCillaqenhleeqf.......
ENSBTAP00000007636  .---------.....---.......--.GL..............IS...FSDYIFLTTvlst................
ENSBTAP00000020950  .EAKQQFIEY.....DKN.......SD.GS..............VS...WDEYNIQMYdrvidfventalddaeeesf
ENSBTAP00000009115  .DVHNELRCA.....DID.......QD.GK..............VN...FSDFLKVL-....................
ENSBTAP00000023873  .YAHFLFNAF.....DAD.......GN.GA..............IR...FE-------....................
ENSBTAP00000054471  .---------.....---.......--.--..............--...---------....................
ENSBTAP00000039694  .SVFLENVRY.....SIP.......EE.KG..............IT...FDEFRSFFQfln.................
ENSBTAP00000025205  .---------.....---.......--.--..............--...---------....................
ENSBTAP00000047882  .---------.....---.......--.--..............--...---------....................
ENSBTAP00000001368  .MVESVFRNF.....DVD.......GD.GH..............IS...QEEFQIIRG....................
ENSBTAP00000029786  .LASRLFQLL.....DEN.......GD.SL..............IN...FREFVSGLSaachgd..............
ENSBTAP00000028993  .DAEAVFQRL.....DAD.......RD.GA..............IT...FQEFARG--....................
ENSBTAP00000023678  .---------.....---.......--.--..............--...---------....................
ENSBTAP00000034710  .EMCEALRQA.....DLD.......GD.GT..............VS...FKDFLGVLTdshrlaq.............
ENSBTAP00000031823  .SVSAAWNTY.....DTD.......RD.GR..............VG...WEELRNATYghyepgeefhdvedaetykk
ENSBTAP00000038002  .---------.....---.......--.--..............--...--------Eggr.................
ENSBTAP00000021074  .AVERNLNLL.....NID.......SN.GA..............IS...FDEFVLAIF....................
ENSBTAP00000026544  .MKQQFMAPH.....NVS.......KD.GC..............IQ...MKELAGMFLsedenflllfrqetpld...
ENSBTAP00000007217  .ECRLVIHLA.....QMKglq....RS.QI..............LP...TEEYEEAMGt...................
ENSBTAP00000029792  .LAGRMFRLL.....DEN.......KD.SL..............IN...FKEFVTGMSgmyhgd..............
ENSBTAP00000044088  .---------.....---.......DK.GL..............IS...YTEYLFLLTiltk................
ENSBTAP00000017319  .RYKDLLSEL.....DEH.......TE.NK..............LD...FEDFMVLLL....................
ENSBTAP00000044100  .LVESVFRNY.....DHD.......HD.GY..............IS...QEDFESIAA....................
ENSBTAP00000033594  .LVEDIFDKE.....DED.......KD.GF..............IS...AREF-----....................
ENSBTAP00000026766  .LSEGLFNAF.....DEN.......RD.NH..............ID...FKEISCGLSaccrgp..............
ENSBTAP00000055894  .EMKKMISEV.....TGG.......VS.DT..............IS...YRDFVNMM-....................
ENSBTAP00000015220  .---HLFEHM.....DLN.......KD.GE..............VP...VEEFSTFIKaqvsegkgrllpgqd.....
ENSBTAP00000033613  .---------.....---.......--.--..............--...---------....................
ENSBTAP00000056320  .MIDRIFSGAvtrgkKVQ.......KE.GK..............IS...YADFVWFLIseedk...............
ENSBTAP00000025249  .---------.....---.......--.--..............--...---------....................
ENSBTAP00000029159  .MVDSVFKNY.....DHD.......QD.GY..............IS...QEEFEKIAA....................
ENSBTAP00000044088  dFAEWLLFFT.....DTE.......NK.DVywknvreklsagenIS...LEEFKSFCHfat.................
ENSBTAP00000016319  .VVLQIMELC.....GAT.......RL.GY..............FG...RSQFYIALK....................
ENSBTAP00000017662  .QVEGALRSA.....DID.......GD.GH..............VN...FKDFLTVMT....................
ENSBTAP00000012479  .TVKILCQRF.....SRG.......SSpEM..............VN...YEKLLWFLKvaasedteqnkgvedsnvke
ENSBTAP00000029886  .CVDALIELS.....DEN.......AD.WK..............LS...FQEFLKC--....................
ENSBTAP00000027388  .ELKKLIMEV.....SSG.......PG.ET..............FS...YSDFLKMM-....................
ENSBTAP00000039694  .---------.....-LK.......EK.GV..............IS...YTEYLFLLCiltk................
ENSBTAP00000023673  .---------.....---.......--.--..............--...---------....................
ENSBTAP00000041488  .---------.....---.......--.--..............--...---------....................
ENSBTAP00000001452  .VLEDFFKKN.....DHD.......GD.GF..............IS...SKEYN----....................
ENSBTAP00000028498  .GLEEKIANL.....GNC.......ND.SK..............LE...FGSFWELI-....................
ENSBTAP00000001426  .------RMF.....DLN.......GD.GK..............LG...LSEMSRLLPvqenfllkfqgmkl......
ENSBTAP00000020240  .ETEFLLSCA.....ETD.......EN.ET..............LD...YEEFVK---....................
ENSBTAP00000053650  .ETEFLLSCA.....ETD.......EN.ET..............LD...YEEFVK---....................
ENSBTAP00000041651  .---------.....---.......--.--..............--...---------....................
ENSBTAP00000005154  .-FQDVFRRA.....DKN.......DD.GK..............LS...FEEFQNYFA....................
ENSBTAP00000021174  .---------.....---.......--.--..............--...---------....................
ENSBTAP00000022068  .QVTDLTRYL.....DPS.......GL.GV..............IS...FEDFYRGI-....................
ENSBTAP00000026682  .--DDISESL.....-RQ.......GG.GK..............LN...FDELRQDLKgkgh................
ENSBTAP00000007636  .KLTAMQKQL.....KKHfk.....EG.KG..............LT...FQEVENFFTflknindvdtal........
ENSBTAP00000027954  .KREVLLALA.....DSH.......AN.GQ..............IC...YQDFVNLM-....................
ENSBTAP00000020778  .ESRAHFRAV.....DPD.......GD.GH..............VS...WDEYK----....................
ENSBTAP00000013601  .TLGQIWALA.....NRT.......TP.GK..............LT...KEELYAVLA....................
ENSBTAP00000005477  .EIEDMFNEI.....RFSeyvdtgkLT.DK..............IN...LPDFFKVYLnhrppfgn............
ENSBTAP00000055305  .EIDFLLSCA.....EAD.......EN.DM..............FN...YIDFVD---....................
ENSBTAP00000036054  .EIDFLLSCA.....EAD.......EN.DM..............FN...YIDFVD---....................
ENSBTAP00000004912  .---------.....---.......--.--..............--...---------....................
ENSBTAP00000022292  .-CEFIRLHF.....GHN.......RK.KH..............LN...YTEFTQFLQel..................
ENSBTAP00000002717  .SSVFLLGNT.....DRP.......DA.SA..............VH...LHDFQRFLL....................
ENSBTAP00000036015  .ALEEHFR--.....-DD.......DD.GP..............VS...SQGYMPYLNkyild...............
ENSBTAP00000051638  .-----FRLL.....DEN.......SD.CL..............IN...FKEFSSAIDimyngs..............
ENSBTAP00000026766  .---------.....---.......--.--..............--...--------Vlltrgr..............
ENSBTAP00000053738  .---------.....---.......--.--..............--...--------Dklkd................
ENSBTAP00000016306  .---------.....---.......--.--..............--...FEELQCDVSve..................
ENSBTAP00000013714  .YINLMKNKL.....DPE.......GL.GI..............I-...---------....................
ENSBTAP00000036550  .LAERTFRLL.....DEN.......MD.HL..............IE...FKAFVSCLDimynge..............
ENSBTAP00000053738  .---------.....---.......--.--..............--...---------....................
ENSBTAP00000023383  .FLRERLTDL.....E-Q.......RT.SD..............IT...YGQFAQLYRslmysaqk............
ENSBTAP00000027030  .MLEEVFHNL.....DPD.......--.GM..............MS...VEDFFYGLFkngkpltpsastpyrql...
ENSBTAP00000053270  .MLEEVFHNL.....DPD.......--.GM..............MS...VEDFFYGLFkngkpltpsastpyrql...
ENSBTAP00000054640  .MLEEVFHNL.....DPD.......--.GM..............MS...VEDFFYGLFkngkpltpsastpyrql...
ENSBTAP00000012770  .TAKVFAKLL.....HTD.......SY.GR..............IS...IMQFFNYVMrkv.................
ENSBTAP00000009967  .ELQELASLL.....-VT.......NS.ES..............VD...WRKFLLVVAlpwpiplee...........
ENSBTAP00000015183  .---------.....---.......--.-C..............MS...REEFVQRMTeivgwg..............
ENSBTAP00000014222  .---------.....---.......GE.QE..............IQ...FEDFTNTLRelehteh.............
ENSBTAP00000026288  .QLAAIAQLH.....EKV.......RG.GG..............VN...INEFFKGT-....................
ENSBTAP00000002128  .---------.....---.......--.--..............--...--------Kiflyil..............
ENSBTAP00000003365  .---------.....---.......--.--..............--...---------....................
ENSBTAP00000053738  .---------.....---.......--.--..............--...--------Clelsk...............
ENSBTAP00000009228  .EIQFLLSCS.....EAD.......EN.EM..............IN...CEEFAN---....................
ENSBTAP00000026785  .KLLSLASAL.....DDN.......KD.GK..............VD...IDDLVKVIE....................
ENSBTAP00000002578  .ALEEHFR--.....-DD.......DE.GP..............VS...NQGYMPYLNkf..................
ENSBTAP00000000106  .-----LREF.....DSD.......GD.GR..............YS...FLELRAA--....................
ENSBTAP00000028840  .EVEDIVVYL.....S--.......--.--..............--...---------....................
ENSBTAP00000053594  .---------.....---.......--.-S..............VT...LEQFGELLEargagf..............
ENSBTAP00000055414  .---------.....---.......--.--..............--...---------....................
ENSBTAP00000026698  .---------.....---.......--.RR..............IS...QEEFAKQLQls..................
ENSBTAP00000017015  .QAARQFAAL.....DPE.......HR.GH..............VE...WPDFLS---....................
ENSBTAP00000049908  .---------.....---.......--.--..............--...---------....................
ENSBTAP00000021395  .QHQALRQQV.....QVD.......TK.GT..............VS...FGDFVHVA-....................
ENSBTAP00000007194  .---------.....---.......--.--..............--...---------....................
ENSBTAP00000025455  .---------.....---.......--.--..............--...---------....................


                                                              90                                    
                                                               |                                    
d1df0a1               ........................................KI....................................
ENSBTAP00000019411  ........................................SE....................................
ENSBTAP00000036057  ........................................SE....................................
ENSBTAP00000038404  ........................................LE....................................
ENSBTAP00000010971  ........................................LE....................................
ENSBTAP00000019803  ........................................NI....................................
ENSBTAP00000014038  ........................................KE....................................
ENSBTAP00000002055  ........................................SE....................................
ENSBTAP00000049731  ........................................SE....................................
ENSBTAP00000005577  ........................................LE....................................
ENSBTAP00000034949  ........................................TN....................................
ENSBTAP00000017447  ........................................--....................................
ENSBTAP00000010858  ........................................--....................................
ENSBTAP00000046644  ........................................--....................................
ENSBTAP00000022814  ........................................FE....................................
ENSBTAP00000019758  ........................................--....................................
ENSBTAP00000019321  ........................................FE....................................
ENSBTAP00000011677  ........................................KI....................................
ENSBTAP00000011680  ........................................KI....................................
ENSBTAP00000021742  ........................................TD....................................
ENSBTAP00000005348  ........................................K-....................................
ENSBTAP00000016609  ........................................LR....................................
ENSBTAP00000012740  ........................................VD....................................
ENSBTAP00000018403  ........................................DT....................................
ENSBTAP00000026407  ........................................K-....................................
ENSBTAP00000052557  ........................................TK....................................
ENSBTAP00000054167  ........................................VQ....................................
ENSBTAP00000010319  ........................................TK....................................
ENSBTAP00000041545  ........................................QR....................................
ENSBTAP00000055204  ........................................YI....................................
ENSBTAP00000003718  ........................................VH....................................
ENSBTAP00000011676  ........................................KI....................................
ENSBTAP00000049395  ........................................QR....................................
ENSBTAP00000054983  ........................................--....................................
ENSBTAP00000052219  ........................................VL....................................
ENSBTAP00000025402  ........................................PR....................................
ENSBTAP00000011678  ........................................RI....................................
ENSBTAP00000000433  ........................................--....................................
ENSBTAP00000021491  ........................................EK....................................
ENSBTAP00000044733  ........................................KI....................................
ENSBTAP00000010937  ........................................LR....................................
ENSBTAP00000056439  ........................................LR....................................
ENSBTAP00000055780  ........................................SE....................................
ENSBTAP00000038002  ........................................PD....................................
ENSBTAP00000034705  ........................................KR....................................
ENSBTAP00000035936  ........................................LE....................................
ENSBTAP00000013699  ........................................FI....................................
ENSBTAP00000002564  ........................................TL....................................
ENSBTAP00000011496  ........................................LD....................................
ENSBTAP00000019111  ........................................PH....................................
ENSBTAP00000017036  ........................................VE....................................
ENSBTAP00000003213  ........................................TR....................................
ENSBTAP00000055444  ........................................TR....................................
ENSBTAP00000024550  ........................................AL....................................
ENSBTAP00000015248  ........................................PE....................................
ENSBTAP00000021328  ........................................PE....................................
ENSBTAP00000037091  ........................................PE....................................
ENSBTAP00000029967  ........................................GV....................................
ENSBTAP00000021449  ........................................GV....................................
ENSBTAP00000053176  ........................................P-....................................
ENSBTAP00000042361  ........................................GV....................................
ENSBTAP00000016509  ........................................LE....................................
ENSBTAP00000026714  ........................................GV....................................
ENSBTAP00000004690  ........................................KI....................................
ENSBTAP00000010858  ........................................--....................................
ENSBTAP00000013117  ........................................TR....................................
ENSBTAP00000017574  ........................................YR....................................
ENSBTAP00000004885  ........................................HE....................................
ENSBTAP00000008961  ........................................--....................................
ENSBTAP00000028063  ........................................--....................................
ENSBTAP00000012740  ........................................--....................................
ENSBTAP00000006283  ........................................GL....................................
ENSBTAP00000014306  ........................................TY....................................
ENSBTAP00000053252  ........................................TR....................................
ENSBTAP00000014304  ........................................TY....................................
ENSBTAP00000045669  ........................................--....................................
ENSBTAP00000041264  ........................................P-....................................
ENSBTAP00000006711  ........................................E-....................................
ENSBTAP00000017358  ........................................--....................................
ENSBTAP00000053274  ........................................--....................................
ENSBTAP00000055296  ........................................--....................................
ENSBTAP00000016852  ........................................RK....................................
ENSBTAP00000036380  ........................................PK....................................
ENSBTAP00000041719  ........................................SY....................................
ENSBTAP00000049636  ........................................TY....................................
ENSBTAP00000024444  ........................................PE....................................
ENSBTAP00000004556  ........................................YE....................................
ENSBTAP00000038767  ......................................nsRS....................................
ENSBTAP00000031285  ........................................--....................................
ENSBTAP00000011457  ........................................LE....................................
ENSBTAP00000011047  ........................................TY....................................
ENSBTAP00000002564  ........................................--....................................
ENSBTAP00000037104  ........................................PE....................................
ENSBTAP00000002672  ........................................PE....................................
ENSBTAP00000028269  ........................................PE....................................
ENSBTAP00000016647  .....................................lnsRM....................................
ENSBTAP00000004536  ........................................RE....................................
ENSBTAP00000042177  ........................................--....................................
ENSBTAP00000028063  ........................................--....................................
ENSBTAP00000050283  ........................................TY....................................
ENSBTAP00000048539  ........................................TE....................................
ENSBTAP00000045669  ........................................--....................................
ENSBTAP00000007972  ........................................RE....................................
ENSBTAP00000040815  ........................................--....................................
ENSBTAP00000025661  ........................................TE....................................
ENSBTAP00000028350  ........................................PD....................................
ENSBTAP00000053274  ........................................--....................................
ENSBTAP00000021537  ........................................RD....................................
ENSBTAP00000055481  ........................................L-....................................
ENSBTAP00000039155  ........................................SE....................................
ENSBTAP00000029333  ........................................L-....................................
ENSBTAP00000016315  ........................................--....................................
ENSBTAP00000021091  ........................................QL....................................
ENSBTAP00000021618  ........................................PE....................................
ENSBTAP00000055520  ........................................--....................................
ENSBTAP00000055624  ........................................--....................................
ENSBTAP00000016319  ........................................--....................................
ENSBTAP00000034078  ........................................PE....................................
ENSBTAP00000006645  ........................................PS....................................
ENSBTAP00000021909  ........................................WV....................................
ENSBTAP00000001426  ........................................SS....................................
ENSBTAP00000015802  ........................................HE....................................
ENSBTAP00000032680  ........................................HE....................................
ENSBTAP00000055007  ........................................TE....................................
ENSBTAP00000020148  ........................................--....................................
ENSBTAP00000052345  ........................................--....................................
ENSBTAP00000029334  ........................................--....................................
ENSBTAP00000052345  ........................................--....................................
ENSBTAP00000056127  ........................................WV....................................
ENSBTAP00000012557  ....................................tvyrYR....................................
ENSBTAP00000011888  ........................................PM....................................
ENSBTAP00000017060  ........................................--....................................
ENSBTAP00000031854  ........................................NP....................................
ENSBTAP00000031823  ........................................WV....................................
ENSBTAP00000021603  ........................................PE....................................
ENSBTAP00000010838  ........................................--....................................
ENSBTAP00000014575  ........................................RE....................................
ENSBTAP00000011215  ........................................NP....................................
ENSBTAP00000053698  ........................................LG....................................
ENSBTAP00000006806  ........................................--....................................
ENSBTAP00000029334  ........................................--....................................
ENSBTAP00000044105  ........................................--....................................
ENSBTAP00000026904  ........................................--....................................
ENSBTAP00000017060  ........................................FI....................................
ENSBTAP00000055520  ........................................--....................................
ENSBTAP00000044226  ........................................--....................................
ENSBTAP00000055624  ........................................--....................................
ENSBTAP00000042182  ........................................HL....................................
ENSBTAP00000010796  ...............kmkeagaetcsfysallriqpkivhCW....................................
ENSBTAP00000021174  ........................................SC....................................
ENSBTAP00000006275  ........................................--....................................
ENSBTAP00000020950  ........................................IL....................................
ENSBTAP00000053738  ...............kmkeagaetcsfysallriqpkivhCW....................................
ENSBTAP00000004963  ........................................FE....................................
ENSBTAP00000023774  ........................................HG....................................
ENSBTAP00000020395  ........................................SS....................................
ENSBTAP00000020150  ........................................--....................................
ENSBTAP00000025561  ........................................CI....................................
ENSBTAP00000053738  ...................vadselaceqahqylvtkaktRW....................................
ENSBTAP00000034009  ........................................--....................................
ENSBTAP00000020539  ........................................NR....................................
ENSBTAP00000020778  ........................................VR....................................
ENSBTAP00000017461  ........................................YR....................................
ENSBTAP00000044096  ........................................--....................................
ENSBTAP00000008523  ........................................--....................................
ENSBTAP00000035196  ............dddldltpeylfpllkippdcttelnhhAY....................................
ENSBTAP00000041997  ........................................--....................................
ENSBTAP00000025499  ........................................SP....................................
ENSBTAP00000055481  ........................................LI....................................
ENSBTAP00000002174  ........................................--....................................
ENSBTAP00000000589  ........................................--....................................
ENSBTAP00000028239  ........................................--....................................
ENSBTAP00000014894  ........................................TA....................................
ENSBTAP00000026544  ........................................RK....................................
ENSBTAP00000029333  ........................................LI....................................
ENSBTAP00000041966  ........................................RL....................................
ENSBTAP00000008933  ........................................--....................................
ENSBTAP00000056088  ........................................--....................................
ENSBTAP00000033794  ........................................K-....................................
ENSBTAP00000012786  ........................................TA....................................
ENSBTAP00000030018  ........................................TA....................................
ENSBTAP00000040233  ........................rtlkdleaqvgekifkNI....................................
ENSBTAP00000003365  ........................................SK....................................
ENSBTAP00000053176  ........................................PE....................................
ENSBTAP00000024301  ........................................TA....................................
ENSBTAP00000022292  ........................................PD....................................
ENSBTAP00000015611  ........................................--....................................
ENSBTAP00000012770  ........................................EP....................................
ENSBTAP00000000847  ........................................TL....................................
ENSBTAP00000053738  ........................rtlkdleaqvgekifkNI....................................
ENSBTAP00000054975  ........................................--....................................
ENSBTAP00000046639  ........................................RK....................................
ENSBTAP00000052345  ........................................--....................................
ENSBTAP00000053164  ........................................--....................................
ENSBTAP00000016774  ........................................--....................................
ENSBTAP00000022630  ........................................--....................................
ENSBTAP00000010796  ...................lspkemanqellarlhkavtsHY....................................
ENSBTAP00000021909  ........................................MM....................................
ENSBTAP00000033974  ........................................QE....................................
ENSBTAP00000006711  ........................................PQ....................................
ENSBTAP00000010796  .........hftkpqqvqeelkelqqstekampardklkdHD....................................
ENSBTAP00000004912  ........................................PD....................................
ENSBTAP00000005979  ............gdsleltadylcpplrvppgcsaelnhrGY....................................
ENSBTAP00000053738  ...................lspkemanqellarlhkavtsHY....................................
ENSBTAP00000053746  ........................................RK....................................
ENSBTAP00000023221  ........................................--....................................
ENSBTAP00000019429  ........................................--....................................
ENSBTAP00000052019  ........................................--....................................
ENSBTAP00000042244  ........................................--....................................
ENSBTAP00000053738  .........................awdsveeiihdsiakNL....................................
ENSBTAP00000018877  ........................................--....................................
ENSBTAP00000053019  ........................................KS....................................
ENSBTAP00000003073  ........................................--....................................
ENSBTAP00000012886  ........................................A-....................................
ENSBTAP00000044222  ........................................--....................................
ENSBTAP00000028499  ........................................--....................................
ENSBTAP00000047378  ........................................SSqsglassdedsgslesvasravppkyvsgskwygrr
ENSBTAP00000009308  ........................................KS....................................
ENSBTAP00000017060  ........................................--....................................
ENSBTAP00000050406  ........................................KS....................................
ENSBTAP00000031879  ........................................KS....................................
ENSBTAP00000031854  ......................................ryIT....................................
ENSBTAP00000001250  ........................................TL....................................
ENSBTAP00000026035  ........................................--....................................
ENSBTAP00000011215  ......................................ryIT....................................
ENSBTAP00000002128  ........................................EY....................................
ENSBTAP00000053194  ........................................SS....................................
ENSBTAP00000056127  .......................................kML....................................
ENSBTAP00000033188  ........................................--....................................
ENSBTAP00000053548  ........................................--....................................
ENSBTAP00000011687  ........................................IF....................................
ENSBTAP00000007636  ........................................PQ....................................
ENSBTAP00000020950  ......................................rqLH....................................
ENSBTAP00000009115  ........................................--....................................
ENSBTAP00000023873  ........................................--....................................
ENSBTAP00000054471  ........................................--....................................
ENSBTAP00000039694  ........................................NL....................................
ENSBTAP00000025205  ........................................--....................................
ENSBTAP00000047882  ........................................--....................................
ENSBTAP00000001368  ........................................-N....................................
ENSBTAP00000029786  ........................................LT....................................
ENSBTAP00000028993  ........................................--....................................
ENSBTAP00000023678  ........................................CR....................................
ENSBTAP00000034710  ........................................C-....................................
ENSBTAP00000031823  ........................................ML....................................
ENSBTAP00000038002  ........................................PE....................................
ENSBTAP00000021074  ........................................--....................................
ENSBTAP00000026544  ........................................SS....................................
ENSBTAP00000007217  ........................................MQ....................................
ENSBTAP00000029792  ........................................LT....................................
ENSBTAP00000044088  ........................................PH....................................
ENSBTAP00000017319  ........................................--....................................
ENSBTAP00000044100  ........................................-N....................................
ENSBTAP00000033594  ........................................--....................................
ENSBTAP00000026766  ........................................L-....................................
ENSBTAP00000055894  ........................................--....................................
ENSBTAP00000015220  ........................................PE....................................
ENSBTAP00000033613  ........................................--....................................
ENSBTAP00000056320  ........................................KT....................................
ENSBTAP00000025249  ........................................--....................................
ENSBTAP00000029159  ........................................--....................................
ENSBTAP00000044088  ........................................HL....................................
ENSBTAP00000016319  ........................................LV....................................
ENSBTAP00000017662  ........................................--....................................
ENSBTAP00000012479  tqssshqssiapqdynsqsevnesllevlkmalratkaklNI....................................
ENSBTAP00000029886  ........................................--....................................
ENSBTAP00000027388  ........................................--....................................
ENSBTAP00000039694  ........................................PH....................................
ENSBTAP00000023673  ........................................--....................................
ENSBTAP00000041488  ........................................--....................................
ENSBTAP00000001452  ........................................--....................................
ENSBTAP00000028498  ........................................--....................................
ENSBTAP00000001426  ........................................TS....................................
ENSBTAP00000020240  ........................................--....................................
ENSBTAP00000053650  ........................................--....................................
ENSBTAP00000041651  ........................................RE....................................
ENSBTAP00000005154  ........................................--....................................
ENSBTAP00000021174  ........................................-G....................................
ENSBTAP00000022068  ........................................--....................................
ENSBTAP00000026682  ........................................TD....................................
ENSBTAP00000007636  ........................................S-....................................
ENSBTAP00000027954  ........................................--....................................
ENSBTAP00000020778  ........................................--....................................
ENSBTAP00000013601  ........................................--....................................
ENSBTAP00000005477  ........................................TM....................................
ENSBTAP00000055305  ........................................--....................................
ENSBTAP00000036054  ........................................--....................................
ENSBTAP00000004912  ........................................--....................................
ENSBTAP00000022292  ........................................QL....................................
ENSBTAP00000002717  ........................................HE....................................
ENSBTAP00000036015  ........................................K-....................................
ENSBTAP00000051638  ........................................FT....................................
ENSBTAP00000026766  ........................................DE....................................
ENSBTAP00000053738  ........................................HD....................................
ENSBTAP00000016306  ........................................ED....................................
ENSBTAP00000013714  ........................................--....................................
ENSBTAP00000036550  ........................................MN....................................
ENSBTAP00000053738  ........................................--....................................
ENSBTAP00000023383  ........................................T-....................................
ENSBTAP00000027030  ........................................KRhismqsfdesgrrttapsammstigfrvfsclddgm
ENSBTAP00000053270  ........................................KRhismqsfdesgrrttapsammstigfrvfsclddgm
ENSBTAP00000054640  ........................................KRhismqsfdesgrrttapsammstigfrvfsclddgm
ENSBTAP00000012770  ........................................WL....................................
ENSBTAP00000009967  ........................................EL....................................
ENSBTAP00000015183  ........................................TE....................................
ENSBTAP00000014222  ........................................ET....................................
ENSBTAP00000026288  ........................................--....................................
ENSBTAP00000002128  ........................................YF....................................
ENSBTAP00000003365  ........................................--....................................
ENSBTAP00000053738  ........................................CY....................................
ENSBTAP00000009228  ........................................--....................................
ENSBTAP00000026785  ........................................--....................................
ENSBTAP00000002578  ........................................IL....................................
ENSBTAP00000000106  ........................................--....................................
ENSBTAP00000028840  ........................................--....................................
ENSBTAP00000053594  ........................................SG....................................
ENSBTAP00000055414  ........................................-Mrrqmfadlflhcdrgkvgfldrqrtlalletfydqs
ENSBTAP00000026698  ........................................DS....................................
ENSBTAP00000017015  ........................................--....................................
ENSBTAP00000049908  ........................................--....................................
ENSBTAP00000021395  ........................................--....................................
ENSBTAP00000007194  ........................................-P....................................
ENSBTAP00000025455  ........................................-E....................................


                                                                                                    
                                                                                                    
d1df0a1               ..............................................................................
ENSBTAP00000019411  ..............................................................................
ENSBTAP00000036057  ..............................................................................
ENSBTAP00000038404  ..............................................................................
ENSBTAP00000010971  ..............................................................................
ENSBTAP00000019803  ..............................................................................
ENSBTAP00000014038  ..............................................................................
ENSBTAP00000002055  ..............................................................................
ENSBTAP00000049731  ..............................................................................
ENSBTAP00000005577  ..............................................................................
ENSBTAP00000034949  ..............................................................................
ENSBTAP00000017447  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000046644  ..............................................................................
ENSBTAP00000022814  ..............................................................................
ENSBTAP00000019758  ..............................................................................
ENSBTAP00000019321  ..............................................................................
ENSBTAP00000011677  ..............................................................................
ENSBTAP00000011680  ..............................................................................
ENSBTAP00000021742  ..............................................................................
ENSBTAP00000005348  ..............................................................................
ENSBTAP00000016609  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000018403  ..............................................................................
ENSBTAP00000026407  ..............................................................................
ENSBTAP00000052557  ..............................................................................
ENSBTAP00000054167  ..............................................................................
ENSBTAP00000010319  ..............................................................................
ENSBTAP00000041545  ..............................................................................
ENSBTAP00000055204  ..............................................................................
ENSBTAP00000003718  ..............................................................................
ENSBTAP00000011676  ..............................................................................
ENSBTAP00000049395  ..............................................................................
ENSBTAP00000054983  ..............................................................................
ENSBTAP00000052219  ..............................................................................
ENSBTAP00000025402  ..............................................................................
ENSBTAP00000011678  ..............................................................................
ENSBTAP00000000433  ..............................................................................
ENSBTAP00000021491  ..............................................................................
ENSBTAP00000044733  ..............................................................................
ENSBTAP00000010937  ..............................................................................
ENSBTAP00000056439  ..............................................................................
ENSBTAP00000055780  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000034705  ..............................................................................
ENSBTAP00000035936  ..............................................................................
ENSBTAP00000013699  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000011496  ..............................................................................
ENSBTAP00000019111  ..............................................................................
ENSBTAP00000017036  ..............................................................................
ENSBTAP00000003213  ..............................................................................
ENSBTAP00000055444  ..............................................................................
ENSBTAP00000024550  ..............................................................................
ENSBTAP00000015248  ..............................................................................
ENSBTAP00000021328  ..............................................................................
ENSBTAP00000037091  ..............................................................................
ENSBTAP00000029967  ..............................................................................
ENSBTAP00000021449  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000042361  ..............................................................................
ENSBTAP00000016509  ..............................................................................
ENSBTAP00000026714  ..............................................................................
ENSBTAP00000004690  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000013117  ..............................................................................
ENSBTAP00000017574  ..............................................................................
ENSBTAP00000004885  ..............................................................................
ENSBTAP00000008961  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000006283  ..............................................................................
ENSBTAP00000014306  ..............................................................................
ENSBTAP00000053252  ..............................................................................
ENSBTAP00000014304  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000041264  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000017358  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000055296  ..............................................................................
ENSBTAP00000016852  ..............................................................................
ENSBTAP00000036380  ..............................................................................
ENSBTAP00000041719  ..............................................................................
ENSBTAP00000049636  ..............................................................................
ENSBTAP00000024444  ..............................................................................
ENSBTAP00000004556  ..............................................................................
ENSBTAP00000038767  ..............................................................................
ENSBTAP00000031285  ..............................................................................
ENSBTAP00000011457  ..............................................................................
ENSBTAP00000011047  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000037104  ..............................................................................
ENSBTAP00000002672  ..............................................................................
ENSBTAP00000028269  ..............................................................................
ENSBTAP00000016647  ..............................................................................
ENSBTAP00000004536  ..............................................................................
ENSBTAP00000042177  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000050283  ..............................................................................
ENSBTAP00000048539  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000007972  ..............................................................................
ENSBTAP00000040815  ..............................................................................
ENSBTAP00000025661  ..............................................................................
ENSBTAP00000028350  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000021537  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000039155  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000016315  ..............................................................................
ENSBTAP00000021091  ..............................................................................
ENSBTAP00000021618  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000034078  ..............................................................................
ENSBTAP00000006645  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000015802  ..............................................................................
ENSBTAP00000032680  ..............................................................................
ENSBTAP00000055007  ..............................................................................
ENSBTAP00000020148  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000012557  ..............................................................................
ENSBTAP00000011888  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000021603  ..............................................................................
ENSBTAP00000010838  ..............................................................................
ENSBTAP00000014575  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000053698  ..............................................................................
ENSBTAP00000006806  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000044105  ..............................................................................
ENSBTAP00000026904  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000044226  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000042182  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000006275  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000004963  ..............................................................................
ENSBTAP00000023774  ..............................................................................
ENSBTAP00000020395  ..............................................................................
ENSBTAP00000020150  ..............................................................................
ENSBTAP00000025561  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000034009  ..............................................................................
ENSBTAP00000020539  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000017461  ..............................................................................
ENSBTAP00000044096  ..............................................................................
ENSBTAP00000008523  ..............................................................................
ENSBTAP00000035196  ..............................................................................
ENSBTAP00000041997  ..............................................................................
ENSBTAP00000025499  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000002174  ..............................................................................
ENSBTAP00000000589  ..............................................................................
ENSBTAP00000028239  ..............................................................................
ENSBTAP00000014894  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000041966  ..............................................................................
ENSBTAP00000008933  ..............................................................................
ENSBTAP00000056088  ..............................................................................
ENSBTAP00000033794  ..............................................................................
ENSBTAP00000012786  ..............................................................................
ENSBTAP00000030018  ..............................................................................
ENSBTAP00000040233  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000024301  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000015611  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000000847  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000054975  ..............................................................................
ENSBTAP00000046639  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000053164  ..............................................................................
ENSBTAP00000016774  ..............................................................................
ENSBTAP00000022630  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000033974  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000005979  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000053746  ..............................................................................
ENSBTAP00000023221  ..............................................................................
ENSBTAP00000019429  ..............................................................................
ENSBTAP00000052019  ..............................................................................
ENSBTAP00000042244  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000018877  ..............................................................................
ENSBTAP00000053019  ..............................................................................
ENSBTAP00000003073  ..............................................................................
ENSBTAP00000012886  ..............................................................................
ENSBTAP00000044222  ..............................................................................
ENSBTAP00000028499  ..............................................................................
ENSBTAP00000047378  shpepcgaaggapglleqparpsarsklrrsaslesveslksdeeadsakepqnelfeaqgqlptwgsevfgsarkpr
ENSBTAP00000009308  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000050406  ..............................................................................
ENSBTAP00000031879  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000001250  ..............................................................................
ENSBTAP00000026035  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000053194  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000033188  ..............................................................................
ENSBTAP00000053548  ..............................................................................
ENSBTAP00000011687  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000009115  ..............................................................................
ENSBTAP00000023873  ..............................................................................
ENSBTAP00000054471  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000025205  ..............................................................................
ENSBTAP00000047882  ..............................................................................
ENSBTAP00000001368  ..............................................................................
ENSBTAP00000029786  ..............................................................................
ENSBTAP00000028993  ..............................................................................
ENSBTAP00000023678  ..............................................................................
ENSBTAP00000034710  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000021074  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000007217  ..............................................................................
ENSBTAP00000029792  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000017319  ..............................................................................
ENSBTAP00000044100  ..............................................................................
ENSBTAP00000033594  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000055894  ..............................................................................
ENSBTAP00000015220  ..............................................................................
ENSBTAP00000033613  ..............................................................................
ENSBTAP00000056320  ..............................................................................
ENSBTAP00000025249  ..............................................................................
ENSBTAP00000029159  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000017662  ..............................................................................
ENSBTAP00000012479  ..............................................................................
ENSBTAP00000029886  ..............................................................................
ENSBTAP00000027388  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000023673  ..............................................................................
ENSBTAP00000041488  ..............................................................................
ENSBTAP00000001452  ..............................................................................
ENSBTAP00000028498  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000020240  ..............................................................................
ENSBTAP00000053650  ..............................................................................
ENSBTAP00000041651  ..............................................................................
ENSBTAP00000005154  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000022068  ..............................................................................
ENSBTAP00000026682  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000027954  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000013601  ..............................................................................
ENSBTAP00000005477  ..............................................................................
ENSBTAP00000055305  ..............................................................................
ENSBTAP00000036054  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000002717  ..............................................................................
ENSBTAP00000036015  ..............................................................................
ENSBTAP00000051638  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000016306  ..............................................................................
ENSBTAP00000013714  ..............................................................................
ENSBTAP00000036550  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000023383  ..............................................................................
ENSBTAP00000027030  gyasverildtwqeegi.............................................................
ENSBTAP00000053270  gyasverildtwqeegi.............................................................
ENSBTAP00000054640  gyasverildtwqeegi.............................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000009967  ..............................................................................
ENSBTAP00000015183  ..............................................................................
ENSBTAP00000014222  ..............................................................................
ENSBTAP00000026288  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000009228  ..............................................................................
ENSBTAP00000026785  ..............................................................................
ENSBTAP00000002578  ..............................................................................
ENSBTAP00000000106  ..............................................................................
ENSBTAP00000028840  ..............................................................................
ENSBTAP00000053594  ..............................................................................
ENSBTAP00000055414  skvlrgtlrnprqwpfvefgeidlpefwgdmdnqkhiyedfdnvllemntlpsekhfsktqskllaspedqhehyres
ENSBTAP00000026698  ..............................................................................
ENSBTAP00000017015  ..............................................................................
ENSBTAP00000049908  ..............................................................................
ENSBTAP00000021395  ..............................................................................
ENSBTAP00000007194  ..............................................................................
ENSBTAP00000025455  ..............................................................................


                                                                                                    
                                                                                                    
d1df0a1               ..............................................................................
ENSBTAP00000019411  ..............................................................................
ENSBTAP00000036057  ..............................................................................
ENSBTAP00000038404  ..............................................................................
ENSBTAP00000010971  ..............................................................................
ENSBTAP00000019803  ..............................................................................
ENSBTAP00000014038  ..............................................................................
ENSBTAP00000002055  ..............................................................................
ENSBTAP00000049731  ..............................................................................
ENSBTAP00000005577  ..............................................................................
ENSBTAP00000034949  ..............................................................................
ENSBTAP00000017447  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000046644  ..............................................................................
ENSBTAP00000022814  ..............................................................................
ENSBTAP00000019758  ..............................................................................
ENSBTAP00000019321  ..............................................................................
ENSBTAP00000011677  ..............................................................................
ENSBTAP00000011680  ..............................................................................
ENSBTAP00000021742  ..............................................................................
ENSBTAP00000005348  ..............................................................................
ENSBTAP00000016609  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000018403  ..............................................................................
ENSBTAP00000026407  ..............................................................................
ENSBTAP00000052557  ..............................................................................
ENSBTAP00000054167  ..............................................................................
ENSBTAP00000010319  ..............................................................................
ENSBTAP00000041545  ..............................................................................
ENSBTAP00000055204  ..............................................................................
ENSBTAP00000003718  ..............................................................................
ENSBTAP00000011676  ..............................................................................
ENSBTAP00000049395  ..............................................................................
ENSBTAP00000054983  ..............................................................................
ENSBTAP00000052219  ..............................................................................
ENSBTAP00000025402  ..............................................................................
ENSBTAP00000011678  ..............................................................................
ENSBTAP00000000433  ..............................................................................
ENSBTAP00000021491  ..............................................................................
ENSBTAP00000044733  ..............................................................................
ENSBTAP00000010937  ..............................................................................
ENSBTAP00000056439  ..............................................................................
ENSBTAP00000055780  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000034705  ..............................................................................
ENSBTAP00000035936  ..............................................................................
ENSBTAP00000013699  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000011496  ..............................................................................
ENSBTAP00000019111  ..............................................................................
ENSBTAP00000017036  ..............................................................................
ENSBTAP00000003213  ..............................................................................
ENSBTAP00000055444  ..............................................................................
ENSBTAP00000024550  ..............................................................................
ENSBTAP00000015248  ..............................................................................
ENSBTAP00000021328  ..............................................................................
ENSBTAP00000037091  ..............................................................................
ENSBTAP00000029967  ..............................................................................
ENSBTAP00000021449  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000042361  ..............................................................................
ENSBTAP00000016509  ..............................................................................
ENSBTAP00000026714  ..............................................................................
ENSBTAP00000004690  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000013117  ..............................................................................
ENSBTAP00000017574  ..............................................................................
ENSBTAP00000004885  ..............................................................................
ENSBTAP00000008961  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000006283  ..............................................................................
ENSBTAP00000014306  ..............................................................................
ENSBTAP00000053252  ..............................................................................
ENSBTAP00000014304  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000041264  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000017358  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000055296  ..............................................................................
ENSBTAP00000016852  ..............................................................................
ENSBTAP00000036380  ..............................................................................
ENSBTAP00000041719  ..............................................................................
ENSBTAP00000049636  ..............................................................................
ENSBTAP00000024444  ..............................................................................
ENSBTAP00000004556  ..............................................................................
ENSBTAP00000038767  ..............................................................................
ENSBTAP00000031285  ..............................................................................
ENSBTAP00000011457  ..............................................................................
ENSBTAP00000011047  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000037104  ..............................................................................
ENSBTAP00000002672  ..............................................................................
ENSBTAP00000028269  ..............................................................................
ENSBTAP00000016647  ..............................................................................
ENSBTAP00000004536  ..............................................................................
ENSBTAP00000042177  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000050283  ..............................................................................
ENSBTAP00000048539  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000007972  ..............................................................................
ENSBTAP00000040815  ..............................................................................
ENSBTAP00000025661  ..............................................................................
ENSBTAP00000028350  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000021537  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000039155  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000016315  ..............................................................................
ENSBTAP00000021091  ..............................................................................
ENSBTAP00000021618  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000034078  ..............................................................................
ENSBTAP00000006645  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000015802  ..............................................................................
ENSBTAP00000032680  ..............................................................................
ENSBTAP00000055007  ..............................................................................
ENSBTAP00000020148  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000012557  ..............................................................................
ENSBTAP00000011888  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000021603  ..............................................................................
ENSBTAP00000010838  ..............................................................................
ENSBTAP00000014575  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000053698  ..............................................................................
ENSBTAP00000006806  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000044105  ..............................................................................
ENSBTAP00000026904  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000044226  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000042182  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000006275  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000004963  ..............................................................................
ENSBTAP00000023774  ..............................................................................
ENSBTAP00000020395  ..............................................................................
ENSBTAP00000020150  ..............................................................................
ENSBTAP00000025561  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000034009  ..............................................................................
ENSBTAP00000020539  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000017461  ..............................................................................
ENSBTAP00000044096  ..............................................................................
ENSBTAP00000008523  ..............................................................................
ENSBTAP00000035196  ..............................................................................
ENSBTAP00000041997  ..............................................................................
ENSBTAP00000025499  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000002174  ..............................................................................
ENSBTAP00000000589  ..............................................................................
ENSBTAP00000028239  ..............................................................................
ENSBTAP00000014894  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000041966  ..............................................................................
ENSBTAP00000008933  ..............................................................................
ENSBTAP00000056088  ..............................................................................
ENSBTAP00000033794  ..............................................................................
ENSBTAP00000012786  ..............................................................................
ENSBTAP00000030018  ..............................................................................
ENSBTAP00000040233  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000024301  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000015611  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000000847  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000054975  ..............................................................................
ENSBTAP00000046639  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000053164  ..............................................................................
ENSBTAP00000016774  ..............................................................................
ENSBTAP00000022630  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000033974  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000005979  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000053746  ..............................................................................
ENSBTAP00000023221  ..............................................................................
ENSBTAP00000019429  ..............................................................................
ENSBTAP00000052019  ..............................................................................
ENSBTAP00000042244  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000018877  ..............................................................................
ENSBTAP00000053019  ..............................................................................
ENSBTAP00000003073  ..............................................................................
ENSBTAP00000012886  ..............................................................................
ENSBTAP00000044222  ..............................................................................
ENSBTAP00000028499  ..............................................................................
ENSBTAP00000047378  shsfdtpe......................................................................
ENSBTAP00000009308  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000050406  ..............................................................................
ENSBTAP00000031879  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000001250  ..............................................................................
ENSBTAP00000026035  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000053194  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000033188  ..............................................................................
ENSBTAP00000053548  ..............................................................................
ENSBTAP00000011687  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000009115  ..............................................................................
ENSBTAP00000023873  ..............................................................................
ENSBTAP00000054471  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000025205  ..............................................................................
ENSBTAP00000047882  ..............................................................................
ENSBTAP00000001368  ..............................................................................
ENSBTAP00000029786  ..............................................................................
ENSBTAP00000028993  ..............................................................................
ENSBTAP00000023678  ..............................................................................
ENSBTAP00000034710  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000021074  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000007217  ..............................................................................
ENSBTAP00000029792  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000017319  ..............................................................................
ENSBTAP00000044100  ..............................................................................
ENSBTAP00000033594  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000055894  ..............................................................................
ENSBTAP00000015220  ..............................................................................
ENSBTAP00000033613  ..............................................................................
ENSBTAP00000056320  ..............................................................................
ENSBTAP00000025249  ..............................................................................
ENSBTAP00000029159  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000017662  ..............................................................................
ENSBTAP00000012479  ..............................................................................
ENSBTAP00000029886  ..............................................................................
ENSBTAP00000027388  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000023673  ..............................................................................
ENSBTAP00000041488  ..............................................................................
ENSBTAP00000001452  ..............................................................................
ENSBTAP00000028498  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000020240  ..............................................................................
ENSBTAP00000053650  ..............................................................................
ENSBTAP00000041651  ..............................................................................
ENSBTAP00000005154  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000022068  ..............................................................................
ENSBTAP00000026682  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000027954  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000013601  ..............................................................................
ENSBTAP00000005477  ..............................................................................
ENSBTAP00000055305  ..............................................................................
ENSBTAP00000036054  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000002717  ..............................................................................
ENSBTAP00000036015  ..............................................................................
ENSBTAP00000051638  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000016306  ..............................................................................
ENSBTAP00000013714  ..............................................................................
ENSBTAP00000036550  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000023383  ..............................................................................
ENSBTAP00000027030  ..............................................................................
ENSBTAP00000053270  ..............................................................................
ENSBTAP00000054640  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000009967  ..............................................................................
ENSBTAP00000015183  ..............................................................................
ENSBTAP00000014222  ..............................................................................
ENSBTAP00000026288  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000009228  ..............................................................................
ENSBTAP00000026785  ..............................................................................
ENSBTAP00000002578  ..............................................................................
ENSBTAP00000000106  ..............................................................................
ENSBTAP00000028840  ..............................................................................
ENSBTAP00000053594  ..............................................................................
ENSBTAP00000055414  tlpqsppeqqrgatveqgpngistreqeqpeestgeqelneesvskegtytgstpeqrssreliteqrphhepiteqg
ENSBTAP00000026698  ..............................................................................
ENSBTAP00000017015  ..............................................................................
ENSBTAP00000049908  ..............................................................................
ENSBTAP00000021395  ..............................................................................
ENSBTAP00000007194  ..............................................................................
ENSBTAP00000025455  ..............................................................................


                                                                                                    
                                                                                                    
d1df0a1               ..............................................................................
ENSBTAP00000019411  ..............................................................................
ENSBTAP00000036057  ..............................................................................
ENSBTAP00000038404  ..............................................................................
ENSBTAP00000010971  ..............................................................................
ENSBTAP00000019803  ..............................................................................
ENSBTAP00000014038  ..............................................................................
ENSBTAP00000002055  ..............................................................................
ENSBTAP00000049731  ..............................................................................
ENSBTAP00000005577  ..............................................................................
ENSBTAP00000034949  ..............................................................................
ENSBTAP00000017447  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000046644  ..............................................................................
ENSBTAP00000022814  ..............................................................................
ENSBTAP00000019758  ..............................................................................
ENSBTAP00000019321  ..............................................................................
ENSBTAP00000011677  ..............................................................................
ENSBTAP00000011680  ..............................................................................
ENSBTAP00000021742  ..............................................................................
ENSBTAP00000005348  ..............................................................................
ENSBTAP00000016609  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000018403  ..............................................................................
ENSBTAP00000026407  ..............................................................................
ENSBTAP00000052557  ..............................................................................
ENSBTAP00000054167  ..............................................................................
ENSBTAP00000010319  ..............................................................................
ENSBTAP00000041545  ..............................................................................
ENSBTAP00000055204  ..............................................................................
ENSBTAP00000003718  ..............................................................................
ENSBTAP00000011676  ..............................................................................
ENSBTAP00000049395  ..............................................................................
ENSBTAP00000054983  ..............................................................................
ENSBTAP00000052219  ..............................................................................
ENSBTAP00000025402  ..............................................................................
ENSBTAP00000011678  ..............................................................................
ENSBTAP00000000433  ..............................................................................
ENSBTAP00000021491  ..............................................................................
ENSBTAP00000044733  ..............................................................................
ENSBTAP00000010937  ..............................................................................
ENSBTAP00000056439  ..............................................................................
ENSBTAP00000055780  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000034705  ..............................................................................
ENSBTAP00000035936  ..............................................................................
ENSBTAP00000013699  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000011496  ..............................................................................
ENSBTAP00000019111  ..............................................................................
ENSBTAP00000017036  ..............................................................................
ENSBTAP00000003213  ..............................................................................
ENSBTAP00000055444  ..............................................................................
ENSBTAP00000024550  ..............................................................................
ENSBTAP00000015248  ..............................................................................
ENSBTAP00000021328  ..............................................................................
ENSBTAP00000037091  ..............................................................................
ENSBTAP00000029967  ..............................................................................
ENSBTAP00000021449  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000042361  ..............................................................................
ENSBTAP00000016509  ..............................................................................
ENSBTAP00000026714  ..............................................................................
ENSBTAP00000004690  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000013117  ..............................................................................
ENSBTAP00000017574  ..............................................................................
ENSBTAP00000004885  ..............................................................................
ENSBTAP00000008961  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000006283  ..............................................................................
ENSBTAP00000014306  ..............................................................................
ENSBTAP00000053252  ..............................................................................
ENSBTAP00000014304  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000041264  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000017358  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000055296  ..............................................................................
ENSBTAP00000016852  ..............................................................................
ENSBTAP00000036380  ..............................................................................
ENSBTAP00000041719  ..............................................................................
ENSBTAP00000049636  ..............................................................................
ENSBTAP00000024444  ..............................................................................
ENSBTAP00000004556  ..............................................................................
ENSBTAP00000038767  ..............................................................................
ENSBTAP00000031285  ..............................................................................
ENSBTAP00000011457  ..............................................................................
ENSBTAP00000011047  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000037104  ..............................................................................
ENSBTAP00000002672  ..............................................................................
ENSBTAP00000028269  ..............................................................................
ENSBTAP00000016647  ..............................................................................
ENSBTAP00000004536  ..............................................................................
ENSBTAP00000042177  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000050283  ..............................................................................
ENSBTAP00000048539  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000007972  ..............................................................................
ENSBTAP00000040815  ..............................................................................
ENSBTAP00000025661  ..............................................................................
ENSBTAP00000028350  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000021537  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000039155  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000016315  ..............................................................................
ENSBTAP00000021091  ..............................................................................
ENSBTAP00000021618  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000034078  ..............................................................................
ENSBTAP00000006645  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000015802  ..............................................................................
ENSBTAP00000032680  ..............................................................................
ENSBTAP00000055007  ..............................................................................
ENSBTAP00000020148  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000012557  ..............................................................................
ENSBTAP00000011888  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000021603  ..............................................................................
ENSBTAP00000010838  ..............................................................................
ENSBTAP00000014575  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000053698  ..............................................................................
ENSBTAP00000006806  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000044105  ..............................................................................
ENSBTAP00000026904  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000044226  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000042182  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000006275  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000004963  ..............................................................................
ENSBTAP00000023774  ..............................................................................
ENSBTAP00000020395  ..............................................................................
ENSBTAP00000020150  ..............................................................................
ENSBTAP00000025561  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000034009  ..............................................................................
ENSBTAP00000020539  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000017461  ..............................................................................
ENSBTAP00000044096  ..............................................................................
ENSBTAP00000008523  ..............................................................................
ENSBTAP00000035196  ..............................................................................
ENSBTAP00000041997  ..............................................................................
ENSBTAP00000025499  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000002174  ..............................................................................
ENSBTAP00000000589  ..............................................................................
ENSBTAP00000028239  ..............................................................................
ENSBTAP00000014894  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000041966  ..............................................................................
ENSBTAP00000008933  ..............................................................................
ENSBTAP00000056088  ..............................................................................
ENSBTAP00000033794  ..............................................................................
ENSBTAP00000012786  ..............................................................................
ENSBTAP00000030018  ..............................................................................
ENSBTAP00000040233  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000024301  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000015611  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000000847  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000054975  ..............................................................................
ENSBTAP00000046639  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000053164  ..............................................................................
ENSBTAP00000016774  ..............................................................................
ENSBTAP00000022630  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000033974  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000005979  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000053746  ..............................................................................
ENSBTAP00000023221  ..............................................................................
ENSBTAP00000019429  ..............................................................................
ENSBTAP00000052019  ..............................................................................
ENSBTAP00000042244  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000018877  ..............................................................................
ENSBTAP00000053019  ..............................................................................
ENSBTAP00000003073  ..............................................................................
ENSBTAP00000012886  ..............................................................................
ENSBTAP00000044222  ..............................................................................
ENSBTAP00000028499  ..............................................................................
ENSBTAP00000047378  ..............................................................................
ENSBTAP00000009308  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000050406  ..............................................................................
ENSBTAP00000031879  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000001250  ..............................................................................
ENSBTAP00000026035  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000053194  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000033188  ..............................................................................
ENSBTAP00000053548  ..............................................................................
ENSBTAP00000011687  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000009115  ..............................................................................
ENSBTAP00000023873  ..............................................................................
ENSBTAP00000054471  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000025205  ..............................................................................
ENSBTAP00000047882  ..............................................................................
ENSBTAP00000001368  ..............................................................................
ENSBTAP00000029786  ..............................................................................
ENSBTAP00000028993  ..............................................................................
ENSBTAP00000023678  ..............................................................................
ENSBTAP00000034710  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000021074  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000007217  ..............................................................................
ENSBTAP00000029792  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000017319  ..............................................................................
ENSBTAP00000044100  ..............................................................................
ENSBTAP00000033594  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000055894  ..............................................................................
ENSBTAP00000015220  ..............................................................................
ENSBTAP00000033613  ..............................................................................
ENSBTAP00000056320  ..............................................................................
ENSBTAP00000025249  ..............................................................................
ENSBTAP00000029159  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000017662  ..............................................................................
ENSBTAP00000012479  ..............................................................................
ENSBTAP00000029886  ..............................................................................
ENSBTAP00000027388  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000023673  ..............................................................................
ENSBTAP00000041488  ..............................................................................
ENSBTAP00000001452  ..............................................................................
ENSBTAP00000028498  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000020240  ..............................................................................
ENSBTAP00000053650  ..............................................................................
ENSBTAP00000041651  ..............................................................................
ENSBTAP00000005154  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000022068  ..............................................................................
ENSBTAP00000026682  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000027954  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000013601  ..............................................................................
ENSBTAP00000005477  ..............................................................................
ENSBTAP00000055305  ..............................................................................
ENSBTAP00000036054  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000002717  ..............................................................................
ENSBTAP00000036015  ..............................................................................
ENSBTAP00000051638  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000016306  ..............................................................................
ENSBTAP00000013714  ..............................................................................
ENSBTAP00000036550  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000023383  ..............................................................................
ENSBTAP00000027030  ..............................................................................
ENSBTAP00000053270  ..............................................................................
ENSBTAP00000054640  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000009967  ..............................................................................
ENSBTAP00000015183  ..............................................................................
ENSBTAP00000014222  ..............................................................................
ENSBTAP00000026288  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000009228  ..............................................................................
ENSBTAP00000026785  ..............................................................................
ENSBTAP00000002578  ..............................................................................
ENSBTAP00000000106  ..............................................................................
ENSBTAP00000028840  ..............................................................................
ENSBTAP00000053594  ..............................................................................
ENSBTAP00000055414  vpqgthiestaeqglseesittegqhegsttgqgshgksteeqgsrresqsdqgqpretmaeqeahresqsdqgphgg
ENSBTAP00000026698  ..............................................................................
ENSBTAP00000017015  ..............................................................................
ENSBTAP00000049908  ..............................................................................
ENSBTAP00000021395  ..............................................................................
ENSBTAP00000007194  ..............................................................................
ENSBTAP00000025455  ..............................................................................


                                                                                                    
                                                                                                    
d1df0a1               ..............................................................................
ENSBTAP00000019411  ..............................................................................
ENSBTAP00000036057  ..............................................................................
ENSBTAP00000038404  ..............................................................................
ENSBTAP00000010971  ..............................................................................
ENSBTAP00000019803  ..............................................................................
ENSBTAP00000014038  ..............................................................................
ENSBTAP00000002055  ..............................................................................
ENSBTAP00000049731  ..............................................................................
ENSBTAP00000005577  ..............................................................................
ENSBTAP00000034949  ..............................................................................
ENSBTAP00000017447  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000046644  ..............................................................................
ENSBTAP00000022814  ..............................................................................
ENSBTAP00000019758  ..............................................................................
ENSBTAP00000019321  ..............................................................................
ENSBTAP00000011677  ..............................................................................
ENSBTAP00000011680  ..............................................................................
ENSBTAP00000021742  ..............................................................................
ENSBTAP00000005348  ..............................................................................
ENSBTAP00000016609  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000018403  ..............................................................................
ENSBTAP00000026407  ..............................................................................
ENSBTAP00000052557  ..............................................................................
ENSBTAP00000054167  ..............................................................................
ENSBTAP00000010319  ..............................................................................
ENSBTAP00000041545  ..............................................................................
ENSBTAP00000055204  ..............................................................................
ENSBTAP00000003718  ..............................................................................
ENSBTAP00000011676  ..............................................................................
ENSBTAP00000049395  ..............................................................................
ENSBTAP00000054983  ..............................................................................
ENSBTAP00000052219  ..............................................................................
ENSBTAP00000025402  ..............................................................................
ENSBTAP00000011678  ..............................................................................
ENSBTAP00000000433  ..............................................................................
ENSBTAP00000021491  ..............................................................................
ENSBTAP00000044733  ..............................................................................
ENSBTAP00000010937  ..............................................................................
ENSBTAP00000056439  ..............................................................................
ENSBTAP00000055780  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000034705  ..............................................................................
ENSBTAP00000035936  ..............................................................................
ENSBTAP00000013699  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000011496  ..............................................................................
ENSBTAP00000019111  ..............................................................................
ENSBTAP00000017036  ..............................................................................
ENSBTAP00000003213  ..............................................................................
ENSBTAP00000055444  ..............................................................................
ENSBTAP00000024550  ..............................................................................
ENSBTAP00000015248  ..............................................................................
ENSBTAP00000021328  ..............................................................................
ENSBTAP00000037091  ..............................................................................
ENSBTAP00000029967  ..............................................................................
ENSBTAP00000021449  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000042361  ..............................................................................
ENSBTAP00000016509  ..............................................................................
ENSBTAP00000026714  ..............................................................................
ENSBTAP00000004690  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000013117  ..............................................................................
ENSBTAP00000017574  ..............................................................................
ENSBTAP00000004885  ..............................................................................
ENSBTAP00000008961  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000006283  ..............................................................................
ENSBTAP00000014306  ..............................................................................
ENSBTAP00000053252  ..............................................................................
ENSBTAP00000014304  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000041264  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000017358  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000055296  ..............................................................................
ENSBTAP00000016852  ..............................................................................
ENSBTAP00000036380  ..............................................................................
ENSBTAP00000041719  ..............................................................................
ENSBTAP00000049636  ..............................................................................
ENSBTAP00000024444  ..............................................................................
ENSBTAP00000004556  ..............................................................................
ENSBTAP00000038767  ..............................................................................
ENSBTAP00000031285  ..............................................................................
ENSBTAP00000011457  ..............................................................................
ENSBTAP00000011047  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000037104  ..............................................................................
ENSBTAP00000002672  ..............................................................................
ENSBTAP00000028269  ..............................................................................
ENSBTAP00000016647  ..............................................................................
ENSBTAP00000004536  ..............................................................................
ENSBTAP00000042177  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000050283  ..............................................................................
ENSBTAP00000048539  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000007972  ..............................................................................
ENSBTAP00000040815  ..............................................................................
ENSBTAP00000025661  ..............................................................................
ENSBTAP00000028350  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000021537  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000039155  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000016315  ..............................................................................
ENSBTAP00000021091  ..............................................................................
ENSBTAP00000021618  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000034078  ..............................................................................
ENSBTAP00000006645  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000015802  ..............................................................................
ENSBTAP00000032680  ..............................................................................
ENSBTAP00000055007  ..............................................................................
ENSBTAP00000020148  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000012557  ..............................................................................
ENSBTAP00000011888  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000021603  ..............................................................................
ENSBTAP00000010838  ..............................................................................
ENSBTAP00000014575  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000053698  ..............................................................................
ENSBTAP00000006806  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000044105  ..............................................................................
ENSBTAP00000026904  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000044226  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000042182  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000006275  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000004963  ..............................................................................
ENSBTAP00000023774  ..............................................................................
ENSBTAP00000020395  ..............................................................................
ENSBTAP00000020150  ..............................................................................
ENSBTAP00000025561  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000034009  ..............................................................................
ENSBTAP00000020539  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000017461  ..............................................................................
ENSBTAP00000044096  ..............................................................................
ENSBTAP00000008523  ..............................................................................
ENSBTAP00000035196  ..............................................................................
ENSBTAP00000041997  ..............................................................................
ENSBTAP00000025499  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000002174  ..............................................................................
ENSBTAP00000000589  ..............................................................................
ENSBTAP00000028239  ..............................................................................
ENSBTAP00000014894  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000041966  ..............................................................................
ENSBTAP00000008933  ..............................................................................
ENSBTAP00000056088  ..............................................................................
ENSBTAP00000033794  ..............................................................................
ENSBTAP00000012786  ..............................................................................
ENSBTAP00000030018  ..............................................................................
ENSBTAP00000040233  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000024301  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000015611  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000000847  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000054975  ..............................................................................
ENSBTAP00000046639  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000053164  ..............................................................................
ENSBTAP00000016774  ..............................................................................
ENSBTAP00000022630  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000033974  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000005979  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000053746  ..............................................................................
ENSBTAP00000023221  ..............................................................................
ENSBTAP00000019429  ..............................................................................
ENSBTAP00000052019  ..............................................................................
ENSBTAP00000042244  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000018877  ..............................................................................
ENSBTAP00000053019  ..............................................................................
ENSBTAP00000003073  ..............................................................................
ENSBTAP00000012886  ..............................................................................
ENSBTAP00000044222  ..............................................................................
ENSBTAP00000028499  ..............................................................................
ENSBTAP00000047378  ..............................................................................
ENSBTAP00000009308  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000050406  ..............................................................................
ENSBTAP00000031879  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000001250  ..............................................................................
ENSBTAP00000026035  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000053194  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000033188  ..............................................................................
ENSBTAP00000053548  ..............................................................................
ENSBTAP00000011687  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000009115  ..............................................................................
ENSBTAP00000023873  ..............................................................................
ENSBTAP00000054471  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000025205  ..............................................................................
ENSBTAP00000047882  ..............................................................................
ENSBTAP00000001368  ..............................................................................
ENSBTAP00000029786  ..............................................................................
ENSBTAP00000028993  ..............................................................................
ENSBTAP00000023678  ..............................................................................
ENSBTAP00000034710  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000021074  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000007217  ..............................................................................
ENSBTAP00000029792  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000017319  ..............................................................................
ENSBTAP00000044100  ..............................................................................
ENSBTAP00000033594  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000055894  ..............................................................................
ENSBTAP00000015220  ..............................................................................
ENSBTAP00000033613  ..............................................................................
ENSBTAP00000056320  ..............................................................................
ENSBTAP00000025249  ..............................................................................
ENSBTAP00000029159  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000017662  ..............................................................................
ENSBTAP00000012479  ..............................................................................
ENSBTAP00000029886  ..............................................................................
ENSBTAP00000027388  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000023673  ..............................................................................
ENSBTAP00000041488  ..............................................................................
ENSBTAP00000001452  ..............................................................................
ENSBTAP00000028498  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000020240  ..............................................................................
ENSBTAP00000053650  ..............................................................................
ENSBTAP00000041651  ..............................................................................
ENSBTAP00000005154  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000022068  ..............................................................................
ENSBTAP00000026682  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000027954  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000013601  ..............................................................................
ENSBTAP00000005477  ..............................................................................
ENSBTAP00000055305  ..............................................................................
ENSBTAP00000036054  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000002717  ..............................................................................
ENSBTAP00000036015  ..............................................................................
ENSBTAP00000051638  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000016306  ..............................................................................
ENSBTAP00000013714  ..............................................................................
ENSBTAP00000036550  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000023383  ..............................................................................
ENSBTAP00000027030  ..............................................................................
ENSBTAP00000053270  ..............................................................................
ENSBTAP00000054640  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000009967  ..............................................................................
ENSBTAP00000015183  ..............................................................................
ENSBTAP00000014222  ..............................................................................
ENSBTAP00000026288  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000009228  ..............................................................................
ENSBTAP00000026785  ..............................................................................
ENSBTAP00000002578  ..............................................................................
ENSBTAP00000000106  ..............................................................................
ENSBTAP00000028840  ..............................................................................
ENSBTAP00000053594  ..............................................................................
ENSBTAP00000055414  etileeqqdtdltsqsrkgsltgesktsresisfehteippqegrtqahayeellfvspelqaktgvsipedhlsepa
ENSBTAP00000026698  ..............................................................................
ENSBTAP00000017015  ..............................................................................
ENSBTAP00000049908  ..............................................................................
ENSBTAP00000021395  ..............................................................................
ENSBTAP00000007194  ..............................................................................
ENSBTAP00000025455  ..............................................................................


                                                                                                    
                                                                                                    
d1df0a1               ..............................................................................
ENSBTAP00000019411  ..............................................................................
ENSBTAP00000036057  ..............................................................................
ENSBTAP00000038404  ..............................................................................
ENSBTAP00000010971  ..............................................................................
ENSBTAP00000019803  ..............................................................................
ENSBTAP00000014038  ..............................................................................
ENSBTAP00000002055  ..............................................................................
ENSBTAP00000049731  ..............................................................................
ENSBTAP00000005577  ..............................................................................
ENSBTAP00000034949  ..............................................................................
ENSBTAP00000017447  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000046644  ..............................................................................
ENSBTAP00000022814  ..............................................................................
ENSBTAP00000019758  ..............................................................................
ENSBTAP00000019321  ..............................................................................
ENSBTAP00000011677  ..............................................................................
ENSBTAP00000011680  ..............................................................................
ENSBTAP00000021742  ..............................................................................
ENSBTAP00000005348  ..............................................................................
ENSBTAP00000016609  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000018403  ..............................................................................
ENSBTAP00000026407  ..............................................................................
ENSBTAP00000052557  ..............................................................................
ENSBTAP00000054167  ..............................................................................
ENSBTAP00000010319  ..............................................................................
ENSBTAP00000041545  ..............................................................................
ENSBTAP00000055204  ..............................................................................
ENSBTAP00000003718  ..............................................................................
ENSBTAP00000011676  ..............................................................................
ENSBTAP00000049395  ..............................................................................
ENSBTAP00000054983  ..............................................................................
ENSBTAP00000052219  ..............................................................................
ENSBTAP00000025402  ..............................................................................
ENSBTAP00000011678  ..............................................................................
ENSBTAP00000000433  ..............................................................................
ENSBTAP00000021491  ..............................................................................
ENSBTAP00000044733  ..............................................................................
ENSBTAP00000010937  ..............................................................................
ENSBTAP00000056439  ..............................................................................
ENSBTAP00000055780  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000034705  ..............................................................................
ENSBTAP00000035936  ..............................................................................
ENSBTAP00000013699  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000011496  ..............................................................................
ENSBTAP00000019111  ..............................................................................
ENSBTAP00000017036  ..............................................................................
ENSBTAP00000003213  ..............................................................................
ENSBTAP00000055444  ..............................................................................
ENSBTAP00000024550  ..............................................................................
ENSBTAP00000015248  ..............................................................................
ENSBTAP00000021328  ..............................................................................
ENSBTAP00000037091  ..............................................................................
ENSBTAP00000029967  ..............................................................................
ENSBTAP00000021449  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000042361  ..............................................................................
ENSBTAP00000016509  ..............................................................................
ENSBTAP00000026714  ..............................................................................
ENSBTAP00000004690  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000013117  ..............................................................................
ENSBTAP00000017574  ..............................................................................
ENSBTAP00000004885  ..............................................................................
ENSBTAP00000008961  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000006283  ..............................................................................
ENSBTAP00000014306  ..............................................................................
ENSBTAP00000053252  ..............................................................................
ENSBTAP00000014304  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000041264  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000017358  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000055296  ..............................................................................
ENSBTAP00000016852  ..............................................................................
ENSBTAP00000036380  ..............................................................................
ENSBTAP00000041719  ..............................................................................
ENSBTAP00000049636  ..............................................................................
ENSBTAP00000024444  ..............................................................................
ENSBTAP00000004556  ..............................................................................
ENSBTAP00000038767  ..............................................................................
ENSBTAP00000031285  ..............................................................................
ENSBTAP00000011457  ..............................................................................
ENSBTAP00000011047  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000037104  ..............................................................................
ENSBTAP00000002672  ..............................................................................
ENSBTAP00000028269  ..............................................................................
ENSBTAP00000016647  ..............................................................................
ENSBTAP00000004536  ..............................................................................
ENSBTAP00000042177  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000050283  ..............................................................................
ENSBTAP00000048539  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000007972  ..............................................................................
ENSBTAP00000040815  ..............................................................................
ENSBTAP00000025661  ..............................................................................
ENSBTAP00000028350  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000021537  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000039155  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000016315  ..............................................................................
ENSBTAP00000021091  ..............................................................................
ENSBTAP00000021618  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000034078  ..............................................................................
ENSBTAP00000006645  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000015802  ..............................................................................
ENSBTAP00000032680  ..............................................................................
ENSBTAP00000055007  ..............................................................................
ENSBTAP00000020148  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000012557  ..............................................................................
ENSBTAP00000011888  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000021603  ..............................................................................
ENSBTAP00000010838  ..............................................................................
ENSBTAP00000014575  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000053698  ..............................................................................
ENSBTAP00000006806  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000044105  ..............................................................................
ENSBTAP00000026904  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000044226  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000042182  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000006275  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000004963  ..............................................................................
ENSBTAP00000023774  ..............................................................................
ENSBTAP00000020395  ..............................................................................
ENSBTAP00000020150  ..............................................................................
ENSBTAP00000025561  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000034009  ..............................................................................
ENSBTAP00000020539  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000017461  ..............................................................................
ENSBTAP00000044096  ..............................................................................
ENSBTAP00000008523  ..............................................................................
ENSBTAP00000035196  ..............................................................................
ENSBTAP00000041997  ..............................................................................
ENSBTAP00000025499  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000002174  ..............................................................................
ENSBTAP00000000589  ..............................................................................
ENSBTAP00000028239  ..............................................................................
ENSBTAP00000014894  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000041966  ..............................................................................
ENSBTAP00000008933  ..............................................................................
ENSBTAP00000056088  ..............................................................................
ENSBTAP00000033794  ..............................................................................
ENSBTAP00000012786  ..............................................................................
ENSBTAP00000030018  ..............................................................................
ENSBTAP00000040233  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000024301  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000015611  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000000847  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000054975  ..............................................................................
ENSBTAP00000046639  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000053164  ..............................................................................
ENSBTAP00000016774  ..............................................................................
ENSBTAP00000022630  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000033974  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000005979  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000053746  ..............................................................................
ENSBTAP00000023221  ..............................................................................
ENSBTAP00000019429  ..............................................................................
ENSBTAP00000052019  ..............................................................................
ENSBTAP00000042244  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000018877  ..............................................................................
ENSBTAP00000053019  ..............................................................................
ENSBTAP00000003073  ..............................................................................
ENSBTAP00000012886  ..............................................................................
ENSBTAP00000044222  ..............................................................................
ENSBTAP00000028499  ..............................................................................
ENSBTAP00000047378  ..............................................................................
ENSBTAP00000009308  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000050406  ..............................................................................
ENSBTAP00000031879  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000001250  ..............................................................................
ENSBTAP00000026035  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000053194  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000033188  ..............................................................................
ENSBTAP00000053548  ..............................................................................
ENSBTAP00000011687  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000009115  ..............................................................................
ENSBTAP00000023873  ..............................................................................
ENSBTAP00000054471  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000025205  ..............................................................................
ENSBTAP00000047882  ..............................................................................
ENSBTAP00000001368  ..............................................................................
ENSBTAP00000029786  ..............................................................................
ENSBTAP00000028993  ..............................................................................
ENSBTAP00000023678  ..............................................................................
ENSBTAP00000034710  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000021074  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000007217  ..............................................................................
ENSBTAP00000029792  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000017319  ..............................................................................
ENSBTAP00000044100  ..............................................................................
ENSBTAP00000033594  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000055894  ..............................................................................
ENSBTAP00000015220  ..............................................................................
ENSBTAP00000033613  ..............................................................................
ENSBTAP00000056320  ..............................................................................
ENSBTAP00000025249  ..............................................................................
ENSBTAP00000029159  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000017662  ..............................................................................
ENSBTAP00000012479  ..............................................................................
ENSBTAP00000029886  ..............................................................................
ENSBTAP00000027388  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000023673  ..............................................................................
ENSBTAP00000041488  ..............................................................................
ENSBTAP00000001452  ..............................................................................
ENSBTAP00000028498  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000020240  ..............................................................................
ENSBTAP00000053650  ..............................................................................
ENSBTAP00000041651  ..............................................................................
ENSBTAP00000005154  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000022068  ..............................................................................
ENSBTAP00000026682  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000027954  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000013601  ..............................................................................
ENSBTAP00000005477  ..............................................................................
ENSBTAP00000055305  ..............................................................................
ENSBTAP00000036054  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000002717  ..............................................................................
ENSBTAP00000036015  ..............................................................................
ENSBTAP00000051638  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000016306  ..............................................................................
ENSBTAP00000013714  ..............................................................................
ENSBTAP00000036550  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000023383  ..............................................................................
ENSBTAP00000027030  ..............................................................................
ENSBTAP00000053270  ..............................................................................
ENSBTAP00000054640  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000009967  ..............................................................................
ENSBTAP00000015183  ..............................................................................
ENSBTAP00000014222  ..............................................................................
ENSBTAP00000026288  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000009228  ..............................................................................
ENSBTAP00000026785  ..............................................................................
ENSBTAP00000002578  ..............................................................................
ENSBTAP00000000106  ..............................................................................
ENSBTAP00000028840  ..............................................................................
ENSBTAP00000053594  ..............................................................................
ENSBTAP00000055414  kkevqkdkscepksqkiegkswtgelltcnwnmkyakhedeeqahliydnsrftdlhsiirniqsykeikgrstfngv
ENSBTAP00000026698  ..............................................................................
ENSBTAP00000017015  ..............................................................................
ENSBTAP00000049908  ..............................................................................
ENSBTAP00000021395  ..............................................................................
ENSBTAP00000007194  ..............................................................................
ENSBTAP00000025455  ..............................................................................


                                                                                        100         
                                                                                          |         
d1df0a1               ...........................................................QKYQKIYREI.........
ENSBTAP00000019411  ...........................................................EEIREAFRVF.........
ENSBTAP00000036057  ...........................................................EEIREAFRVF.........
ENSBTAP00000038404  ...........................................................QKLKWAFSMY.........
ENSBTAP00000010971  ...........................................................QKLMWAFSMY.........
ENSBTAP00000019803  ...........................................................KKWQAVYKQF.........
ENSBTAP00000014038  ...........................................................QKLRFAFRIY.........
ENSBTAP00000002055  ...........................................................EEIREAFRVF.........
ENSBTAP00000049731  ...........................................................EEIREAFRVF.........
ENSBTAP00000005577  ...........................................................QKLKWAFSMY.........
ENSBTAP00000034949  ...........................................................QKLEWAFSLY.........
ENSBTAP00000017447  ...........................................................----------.........
ENSBTAP00000010858  ...........................................................----------.........
ENSBTAP00000046644  ...........................................................----------.........
ENSBTAP00000022814  ...........................................................QKLNWAFNMY.........
ENSBTAP00000019758  ...........................................................----------.........
ENSBTAP00000019321  ...........................................................QKLNWAFEMY.........
ENSBTAP00000011677  ...........................................................KTWQKIFKHY.........
ENSBTAP00000011680  ...........................................................KTWQKIFKHY.........
ENSBTAP00000021742  ...........................................................DRLNWAFNLY.........
ENSBTAP00000005348  ...........................................................----------.........
ENSBTAP00000016609  ...........................................................PDIDKILLEI.........
ENSBTAP00000012740  ...........................................................MCLNWLLNVY.........
ENSBTAP00000018403  ...........................................................EGLREIFRAF.........
ENSBTAP00000026407  ...........................................................----------.........
ENSBTAP00000052557  ...........................................................EEILKAFRLF.........
ENSBTAP00000054167  ...........................................................EKLNWAFNLY.........
ENSBTAP00000010319  ...........................................................EEILKAFKLF.........
ENSBTAP00000041545  ...........................................................PEVQELFEKF.........
ENSBTAP00000055204  ...........................................................TDWQNVFRTY.........
ENSBTAP00000003718  ...........................................................EKLRWTFNLY.........
ENSBTAP00000011676  ...........................................................RKYLDIFRET.........
ENSBTAP00000049395  ...........................................................KEIDRTFEEA.........
ENSBTAP00000054983  ...........................................................----------.........
ENSBTAP00000052219  ...........................................................NGWRQHFISF.........
ENSBTAP00000025402  ...........................................................PEIDEIFTSY.........
ENSBTAP00000011678  ...........................................................RNYLSIFRKF.........
ENSBTAP00000000433  ...........................................................----------.........
ENSBTAP00000021491  ...........................................................EEILKAFKLF.........
ENSBTAP00000044733  ...........................................................QKYQKIYREI.........
ENSBTAP00000010937  ...........................................................RDLYLLLLSY.........
ENSBTAP00000056439  ...........................................................RDLYLLLLSY.........
ENSBTAP00000055780  ...........................................................EELSDLFRMF.........
ENSBTAP00000038002  ...........................................................HLSQALFQ--.........
ENSBTAP00000034705  ...........................................................PELEEIFHRY.........
ENSBTAP00000035936  ...........................................................HKLKWTFKIY.........
ENSBTAP00000013699  ...........................................................QQWKNLFQQY.........
ENSBTAP00000002564  ...........................................................TTALEIFNEH.........
ENSBTAP00000011496  ...........................................................EKLRWAFKLY.........
ENSBTAP00000019111  ...........................................................EEILKAFKLF.........
ENSBTAP00000017036  ...........................................................QKLRWYFKLY.........
ENSBTAP00000003213  ...........................................................RDLYLLMLTY.........
ENSBTAP00000055444  ...........................................................RDLYLLMLTY.........
ENSBTAP00000024550  ...........................................................NSWKQNFITV.........
ENSBTAP00000015248  ...........................................................DVIRNAFACF.........
ENSBTAP00000021328  ...........................................................DVIRNAFACF.........
ENSBTAP00000037091  ...........................................................DVIRNAFACF.........
ENSBTAP00000029967  ...........................................................RELRDAFREF.........
ENSBTAP00000021449  ...........................................................QEMRDAFKEF.........
ENSBTAP00000053176  ...........................................................----------.........
ENSBTAP00000042361  ...........................................................KELRDAFREF.........
ENSBTAP00000016509  ...........................................................HKLKWTFKIY.........
ENSBTAP00000026714  ...........................................................KELRDAFREF.........
ENSBTAP00000004690  ...........................................................KKWTDIFREC.........
ENSBTAP00000010858  ...........................................................----------.........
ENSBTAP00000013117  ...........................................................PEIYFLLVQF.........
ENSBTAP00000017574  ...........................................................EEIIEIFNTY.........
ENSBTAP00000004885  ...........................................................KKMKLAFKSL.........
ENSBTAP00000008961  ...........................................................----------.........
ENSBTAP00000028063  ...........................................................--MIEAFRDNgln......
ENSBTAP00000012740  ...........................................................----------.........
ENSBTAP00000006283  ...........................................................RELRIAFREF.........
ENSBTAP00000014306  ...........................................................EDYVEGLRVF.........
ENSBTAP00000053252  ...........................................................PEVYFLLVQI.........
ENSBTAP00000014304  ...........................................................EDYVEGLRVF.........
ENSBTAP00000045669  ...........................................................--LNFLLAAF.........
ENSBTAP00000041264  ...........................................................----------.........
ENSBTAP00000006711  ...........................................................----------.........
ENSBTAP00000017358  ...........................................................----------.........
ENSBTAP00000053274  ...........................................................--LNFLLAAF.........
ENSBTAP00000055296  ...........................................................----------.........
ENSBTAP00000016852  ...........................................................EVIMQAFRKL.........
ENSBTAP00000036380  ...........................................................KEILLAMLMA.........
ENSBTAP00000041719  ...........................................................QDYLEGLRVF.........
ENSBTAP00000049636  ...........................................................EDFVEGLRVF.........
ENSBTAP00000024444  ...........................................................ETILNAFKVF.........
ENSBTAP00000004556  ...........................................................PCIKPLFNSC.........
ENSBTAP00000038767  ...........................................................NKLHFAFRLY.........
ENSBTAP00000031285  ...........................................................----------.........
ENSBTAP00000011457  ...........................................................EKMKYCFEVF.........
ENSBTAP00000011047  ...........................................................EDFVEGLRVF.........
ENSBTAP00000002564  ...........................................................----------.........
ENSBTAP00000037104  ...........................................................ETILHAFKVF.........
ENSBTAP00000002672  ...........................................................EAILSAFRLF.........
ENSBTAP00000028269  ...........................................................DVITGAFKVL.........
ENSBTAP00000016647  ...........................................................NKLRFAFQLY.........
ENSBTAP00000004536  ...........................................................QRLLLLFHSL.........
ENSBTAP00000042177  ...........................................................----------.........
ENSBTAP00000028063  ...........................................................----------.........
ENSBTAP00000050283  ...........................................................EDFVEGLRVF.........
ENSBTAP00000048539  ...........................................................KILQMSFKLF.........
ENSBTAP00000045669  ...........................................................----------.........
ENSBTAP00000007972  ...........................................................AVVTAAFAKL.........
ENSBTAP00000040815  ...........................................................----------.........
ENSBTAP00000025661  ...........................................................EIIQVAFKLF.........
ENSBTAP00000028350  ...........................................................IKSHYAFRIF.........
ENSBTAP00000053274  ...........................................................----------.........
ENSBTAP00000021537  ...........................................................LKAYYAFKIY.........
ENSBTAP00000055481  ...........................................................----------.........
ENSBTAP00000039155  ...........................................................DHIWEAFHVF.........
ENSBTAP00000029333  ...........................................................----------.........
ENSBTAP00000016315  ...........................................................----------.........
ENSBTAP00000021091  ...........................................................MFYQEVFHKQ.........
ENSBTAP00000021618  ...........................................................EKSRLMFRMY.........
ENSBTAP00000055520  ...........................................................----------.........
ENSBTAP00000055624  ...........................................................----------.........
ENSBTAP00000016319  ...........................................................----------.........
ENSBTAP00000034078  ...........................................................DILLRAFEVL.........
ENSBTAP00000006645  ...........................................................LKIEYAFRIY.........
ENSBTAP00000021909  ...........................................................KTEREQFVEFr........
ENSBTAP00000001426  ...........................................................TEFMEAWRKY.........
ENSBTAP00000015802  ...........................................................KKLRLVFKSL.........
ENSBTAP00000032680  ...........................................................KKLRLVFKSL.........
ENSBTAP00000055007  ...........................................................EELAECFRIF.........
ENSBTAP00000020148  ...........................................................----------.........
ENSBTAP00000052345  ...........................................................----------.........
ENSBTAP00000029334  ...........................................................----------.........
ENSBTAP00000052345  ...........................................................----------.........
ENSBTAP00000056127  ...........................................................LSEREQFNEFr........
ENSBTAP00000012557  ...........................................................SDLQIIFNII.........
ENSBTAP00000011888  ...........................................................DKLKFLFQVY.........
ENSBTAP00000017060  ...........................................................----------.........
ENSBTAP00000031854  ...........................................................TSIEYWFRCM.........
ENSBTAP00000031823  ...........................................................QTEREQFRDFr........
ENSBTAP00000021603  ...........................................................DKSRLMFTMY.........
ENSBTAP00000010838  ...........................................................----------.........
ENSBTAP00000014575  ...........................................................LKASYAFKIY.........
ENSBTAP00000011215  ...........................................................TSIEYWFRCM.........
ENSBTAP00000053698  ...........................................................NTIDSIFWQF.........
ENSBTAP00000006806  ...........................................................----------.........
ENSBTAP00000029334  ...........................................................----------.........
ENSBTAP00000044105  ...........................................................----------.........
ENSBTAP00000026904  ...........................................................----------.........
ENSBTAP00000017060  ...........................................................Q---------.........
ENSBTAP00000055520  ...........................................................----------.........
ENSBTAP00000044226  ...........................................................----------.........
ENSBTAP00000055624  ...........................................................----------.........
ENSBTAP00000042182  ...........................................................LEWQATFDKF.........
ENSBTAP00000010796  ...........................................................RPMRRTFKAY.........
ENSBTAP00000021174  ...........................................................EEFMKTWRKY.........
ENSBTAP00000006275  ...........................................................----------.........
ENSBTAP00000020950  ...........................................................VEKDRFMNDY.........
ENSBTAP00000053738  ...........................................................RPMRRTFKAY.........
ENSBTAP00000004963  ...........................................................EKLKFCFEVY.........
ENSBTAP00000023774  ...........................................................TDFDTVFWKC.........
ENSBTAP00000020395  ...........................................................EEIESAFRAL.........
ENSBTAP00000020150  ...........................................................----------.........
ENSBTAP00000025561  ...........................................................AMMCN-----.........
ENSBTAP00000053738  ...........................................................SDLSKNFIET.........
ENSBTAP00000034009  ...........................................................----------.........
ENSBTAP00000020539  ...........................................................SNLETIFRII.........
ENSBTAP00000020778  ...........................................................DRKREFEELI.........
ENSBTAP00000017461  ...........................................................NEVRHIFTAF.........
ENSBTAP00000044096  ...........................................................----------.........
ENSBTAP00000008523  ...........................................................----------.........
ENSBTAP00000035196  ...........................................................LFLQSTFDKH.........
ENSBTAP00000041997  ...........................................................----------.........
ENSBTAP00000025499  ...........................................................EDVKKVFHIL.........
ENSBTAP00000055481  ...........................................................K---------.........
ENSBTAP00000002174  ...........................................................----------.........
ENSBTAP00000000589  ...........................................................----------.........
ENSBTAP00000028239  ...........................................................----------.........
ENSBTAP00000014894  ...........................................................DQVIASFKVL.........
ENSBTAP00000026544  ...........................................................RDFEKIFAHY.........
ENSBTAP00000029333  ...........................................................K---------.........
ENSBTAP00000041966  ...........................................................VHCQSVFQNS.........
ENSBTAP00000008933  ...........................................................----------.........
ENSBTAP00000056088  ...........................................................----------.........
ENSBTAP00000033794  ...........................................................----------.........
ENSBTAP00000012786  ...........................................................EQVIASFRIL.........
ENSBTAP00000030018  ...........................................................EQVVASFKIL.........
ENSBTAP00000040233  ...........................................................KTVIKALMLI.........
ENSBTAP00000003365  ...........................................................AELLKSFKQL.........
ENSBTAP00000053176  ...........................................................DKLEFMFRLY.........
ENSBTAP00000024301  ...........................................................DQVMASFKIL.........
ENSBTAP00000022292  ...........................................................SMFIVAFQLF.........
ENSBTAP00000015611  ...........................................................----------.........
ENSBTAP00000012770  ...........................................................AALQYIFKLL.........
ENSBTAP00000000847  ...........................................................----------.........
ENSBTAP00000053738  ...........................................................KTVIKALMLI.........
ENSBTAP00000054975  ...........................................................----------.........
ENSBTAP00000046639  ...........................................................SFVRKAFMKL.........
ENSBTAP00000052345  ...........................................................----------.........
ENSBTAP00000053164  ...........................................................DTLLAAFRHY.........
ENSBTAP00000016774  ...........................................................----------.........
ENSBTAP00000022630  ...........................................................----------.........
ENSBTAP00000010796  ...........................................................HAIAQEFENF.........
ENSBTAP00000021909  ...........................................................VRDERRFKMA.........
ENSBTAP00000033974  ...........................................................GELRAALCIF.........
ENSBTAP00000006711  ...........................................................DKLEFMFRLY.........
ENSBTAP00000010796  ...........................................................QDISKALAKL.........
ENSBTAP00000004912  ...........................................................ALFMVAFQLF.........
ENSBTAP00000005979  ...........................................................QFVQRMFEKH.........
ENSBTAP00000053738  ...........................................................HAIAQEFENF.........
ENSBTAP00000053746  ...........................................................EKLRFLFHMY.........
ENSBTAP00000023221  ...........................................................--PKTFFKLH.........
ENSBTAP00000019429  ...........................................................----------.........
ENSBTAP00000052019  ...........................................................----------.........
ENSBTAP00000042244  ...........................................................----------.........
ENSBTAP00000053738  ...........................................................SAFCNMLRSY.........
ENSBTAP00000018877  ...........................................................----------.........
ENSBTAP00000053019  ...........................................................KDISKTFRK-.........
ENSBTAP00000003073  ...........................................................---KTFFILH.........
ENSBTAP00000012886  ...........................................................----------.........
ENSBTAP00000044222  ...........................................................----------.........
ENSBTAP00000028499  ...........................................................----------.........
ENSBTAP00000047378  ...........................................................TRVWGLWEEL.........
ENSBTAP00000009308  ...........................................................TEVAKTFR--.........
ENSBTAP00000017060  ...........................................................----------.........
ENSBTAP00000050406  ...........................................................SDIAKTFRKA.........
ENSBTAP00000031879  ...........................................................SDIAKTFRKA.........
ENSBTAP00000031854  ...........................................................TVIQRIFYTV.........
ENSBTAP00000001250  ...........................................................DTIQLAFKMF.........
ENSBTAP00000026035  ...........................................................----------.........
ENSBTAP00000011215  ...........................................................TVIQRIFYTV.........
ENSBTAP00000002128  ...........................................................DVLTDVVKAI.........
ENSBTAP00000053194  ...........................................................DELEDSFQAL.........
ENSBTAP00000056127  ...........................................................PRDERRFKAA.........
ENSBTAP00000033188  ...........................................................----------.........
ENSBTAP00000053548  ...........................................................----------.........
ENSBTAP00000011687  ...........................................................RHSRPVFELL.........
ENSBTAP00000007636  ...........................................................RNFEIAFKMF.........
ENSBTAP00000020950  ...........................................................LKDK------.........
ENSBTAP00000009115  ...........................................................----------.........
ENSBTAP00000023873  ...........................................................----------.........
ENSBTAP00000054471  ...........................................................--AQEFFQTC.........
ENSBTAP00000039694  ...........................................................EDFAIALNMY.........
ENSBTAP00000025205  ...........................................................--AQEFFQTC.........
ENSBTAP00000047882  ...........................................................ELQLHYFKMH.........
ENSBTAP00000001368  ...........................................................FPYLSAFGDL.........
ENSBTAP00000029786  ...........................................................EKLKLLYKM-.........
ENSBTAP00000028993  ...........................................................----------.........
ENSBTAP00000023678  ...........................................................DNIREAFQIY.........
ENSBTAP00000034710  ...........................................................----------.........
ENSBTAP00000031823  ...........................................................ARDERRFRVA.........
ENSBTAP00000038002  ...........................................................DKLEFTFKLY.........
ENSBTAP00000021074  ...........................................................----------.........
ENSBTAP00000026544  ...........................................................VEFMRIWRKY.........
ENSBTAP00000007217  ...........................................................ISPLDLFQLL.........
ENSBTAP00000029792  ...........................................................EKLKVLYK--.........
ENSBTAP00000044088  ...........................................................SGFHVAFKML.........
ENSBTAP00000017319  ...........................................................----------.........
ENSBTAP00000044100  ...........................................................FPFLDSFCVL.........
ENSBTAP00000033594  ...........................................................----------.........
ENSBTAP00000026766  ...........................................................----------.........
ENSBTAP00000055894  ...........................................................----------.........
ENSBTAP00000015220  ...........................................................KTIGDMFQNQ.........
ENSBTAP00000033613  ...........................................................-----LFEEI.........
ENSBTAP00000056320  ...........................................................PTSIEYWFRM.........
ENSBTAP00000025249  ...........................................................----------.........
ENSBTAP00000029159  ...........................................................-SFPFSFCVM.........
ENSBTAP00000044088  ...........................................................EDFAIAMQMF.........
ENSBTAP00000016319  ...........................................................AVAQ------.........
ENSBTAP00000017662  ...........................................................----------.........
ENSBTAP00000012479  ...........................................................EKLNLSFRKE.........
ENSBTAP00000029886  ...........................................................----------.........
ENSBTAP00000027388  ...........................................................----------.........
ENSBTAP00000039694  ...........................................................AGFRIAFNMF.........
ENSBTAP00000023673  ...........................................................EQAQELFLLC.........
ENSBTAP00000041488  ...........................................................EQAQELFLLC.........
ENSBTAP00000001452  ...........................................................----------.........
ENSBTAP00000028498  ...........................................................----------.........
ENSBTAP00000001426  ...........................................................EEFNAIFTFY.........
ENSBTAP00000020240  ...........................................................----------.........
ENSBTAP00000053650  ...........................................................----------.........
ENSBTAP00000041651  ...........................................................QVLLYLFALH.........
ENSBTAP00000005154  ...........................................................----------.........
ENSBTAP00000021174  ...........................................................KEFNKAFELY.........
ENSBTAP00000022068  ...........................................................----------.........
ENSBTAP00000026682  ...........................................................AEIEAIFTKY.........
ENSBTAP00000007636  ...........................................................------FYHM.........
ENSBTAP00000027954  ...........................................................----------.........
ENSBTAP00000020778  ...........................................................----------.........
ENSBTAP00000013601  ...........................................................----------.........
ENSBTAP00000005477  ...........................................................SGIQQSFDILgft......
ENSBTAP00000055305  ...........................................................----------.........
ENSBTAP00000036054  ...........................................................----------.........
ENSBTAP00000004912  ...........................................................EHAKQAFVQR.........
ENSBTAP00000022292  ...........................................................EHARQAFALK.........
ENSBTAP00000002717  ...........................................................QQELWA----.........
ENSBTAP00000036015  ...........................................................----------.........
ENSBTAP00000051638  ...........................................................EKLKLLFKLHispaytevq
ENSBTAP00000026766  ...........................................................EKAKYIFSLF.........
ENSBTAP00000053738  ...........................................................QDISKALAKL.........
ENSBTAP00000016306  ...........................................................SRQEWTFTLY.........
ENSBTAP00000013714  ...........................................................----------.........
ENSBTAP00000036550  ...........................................................EKIKLLYR--.........
ENSBTAP00000053738  ...........................................................PAFRKRFLDF.........
ENSBTAP00000023383  ...........................................................----------.........
ENSBTAP00000027030  ...........................................................ENSQEILKAL.........
ENSBTAP00000053270  ...........................................................ENSQEILKAL.........
ENSBTAP00000054640  ...........................................................ENSQEILKAL.........
ENSBTAP00000012770  ...........................................................HQTRIGLSLY.........
ENSBTAP00000009967  ...........................................................LETLQRFKAL.........
ENSBTAP00000015183  ...........................................................EEYGELFDKV.........
ENSBTAP00000014222  ...........................................................TKLTAAFTRF.........
ENSBTAP00000026288  ...........................................................----------.........
ENSBTAP00000002128  ...........................................................AAFQNALKIF.........
ENSBTAP00000003365  ...........................................................---SDIFEVI.........
ENSBTAP00000053738  ...........................................................EKVEKALSAG.........
ENSBTAP00000009228  ...........................................................----------.........
ENSBTAP00000026785  ...........................................................----------.........
ENSBTAP00000002578  ...........................................................EKVQDNFDKI.........
ENSBTAP00000000106  ...........................................................----------.........
ENSBTAP00000028840  ...........................................................----------.........
ENSBTAP00000053594  ...........................................................ERFEEAFAQF.........
ENSBTAP00000055414  svnllqfvqlletfvgedsplsvsealtsffrkgfvetkeekmsglekarqnasrirreLLLKALFQKW.........
ENSBTAP00000026698  ...........................................................QTVAGAFSYF.........
ENSBTAP00000017015  ...........................................................----------.........
ENSBTAP00000049908  ...........................................................--LLMAFVYF.........
ENSBTAP00000021395  ...........................................................----------.........
ENSBTAP00000007194  ...........................................................VDCLLAFVYF.........
ENSBTAP00000025455  ...........................................................LLLKALFQKW.........


                                                                   110       120                    
                                                                     |         |                    
d1df0a1               ..DVDRSG...................................T.MNSYEMRKALEEA................GFK.
ENSBTAP00000019411  ..DKDGNG...................................Y.ISAAELRHVMTNL................GEK.
ENSBTAP00000036057  ..DKDGNG...................................Y.ISAAELRHVMTNL................GEK.
ENSBTAP00000038404  ..DLDGNG...................................Y.ISKAEMLEIVQAIykmvss..........VMK.
ENSBTAP00000010971  ..DLDGNG...................................Y.ISREEMLEIVQAIykmvss..........VMK.
ENSBTAP00000019803  ..DVDRSG...................................T.IGSSELPGAFEAA................GFR.
ENSBTAP00000014038  ..DMDKDG...................................Y.ISNGELFQVLKMMv...............GNN.
ENSBTAP00000002055  ..DKDGNG...................................Y.ISAAELRHVMTNL................GEK.
ENSBTAP00000049731  ..DKDGNG...................................Y.ISAAELRHVMTNL................GEK.
ENSBTAP00000005577  ..DLDGNG...................................Y.ISRSEMLEIVQAIykmvss..........VMK.
ENSBTAP00000034949  ..DVDGNG...................................T.ISKNEVLEIVTAI................FKM.
ENSBTAP00000017447  ..------...................................-.-------------................---.
ENSBTAP00000010858  ..------...................................-.-------------................---.
ENSBTAP00000046644  ..------...................................-.-------------................---.
ENSBTAP00000022814  ..DLDGDG...................................K.ITRVEMLEIIEAI................YKM.
ENSBTAP00000019758  ..------...................................-.-------------................---.
ENSBTAP00000019321  ..DLDGDG...................................R.ITRLEMLEIIEAI................YKM.
ENSBTAP00000011677  ..DTDQSG...................................T.INSYEMRNAVKDA................GFH.
ENSBTAP00000011680  ..DTDQSG...................................T.INSYEMRNAVKDA................GFH.
ENSBTAP00000021742  ..DLNKDG...................................C.ITKEEMLDIMKSI................YDM.
ENSBTAP00000005348  ..------...................................-.-------------................---.
ENSBTAP00000016609  ..GAKGKP...................................Y.LTLEQLMDFIN--................---.
ENSBTAP00000012740  ..DTGRTG...................................K.IRVQSLKIGL---................---.
ENSBTAP00000018403  ..DQDDDG...................................Y.ISVDELRQATSQL................GEK.
ENSBTAP00000026407  ..------...................................-.-------------................---.
ENSBTAP00000052557  ..DDDETG...................................K.ISFKNLKRVAKEL................GEN.
ENSBTAP00000054167  ..DINKDG...................................Y.ITKEEMLDIMKAIydmmgkctypvl....KED.
ENSBTAP00000010319  ..DDDETG...................................K.ISFKNLKRVAKEL................GEN.
ENSBTAP00000041545  ..SSDG-Q...................................K.LTLLEFVDFLQEEqke.............GER.
ENSBTAP00000055204  ..DRDNSG...................................M.IDKNELKQALSGF................GYR.
ENSBTAP00000003718  ..DINKDG...................................Y.INKEEMMDIVKAIydmmgkytypvl....KED.
ENSBTAP00000011676  ..DHNHSG...................................T.IDAHEMRTALKKA................GFT.
ENSBTAP00000049395  ..-TGSKE...................................T.LSVDQLVTFLQHQqr..............EEE.
ENSBTAP00000054983  ..------...................................-.-------------................---.
ENSBTAP00000052219  ..DSDRSG...................................T.VDPQELQKALTTM................GFR.
ENSBTAP00000025402  ..HSKAKP...................................Y.MTKEHLAKFINQK................---.
ENSBTAP00000011678  ..DLDKSG...................................S.MSAYEMRMAIEFA................GFK.
ENSBTAP00000000433  ..------...................................-.-------------................---.
ENSBTAP00000021491  ..DDDDTG...................................S.ISLNNIKRVAKEL................GEN.
ENSBTAP00000044733  ..DVDRSG...................................T.MNSYEMRKALEEA................GFK.
ENSBTAP00000010937  ..-SDKKD...................................H.LTVEELAQFLKVEqk..............MTN.
ENSBTAP00000056439  ..-SDKKD...................................H.LTVEELAQFLKVEqk..............MTN.
ENSBTAP00000055780  ..DKNADG...................................Y.IDLEELKIMLQAT................GET.
ENSBTAP00000038002  ..------...................................-.-------------................---.
ENSBTAP00000034705  ..-SGEDR...................................V.LSASELLEFLEDQ................GEHk
ENSBTAP00000035936  ..DKDRNG...................................C.IDRQELLDIVESI................YKL.
ENSBTAP00000013699  ..DRDCSG...................................S.ISYTELQQALSQM................GYN.
ENSBTAP00000002564  ..DLQASE...................................HvMDVVEVIHCLTAL................YER.
ENSBTAP00000011496  ..DLDNDG...................................Y.ITRNEMLDIVDAIyqmvgntvelpe....EEN.
ENSBTAP00000019111  ..DDDDSG...................................K.ISLRNLRRVAREL................GEN.
ENSBTAP00000017036  ..DVDGNG...................................C.IDRDELLTIIRAIrain............P--.
ENSBTAP00000003213  ..-SNHKD...................................H.LDATDLLRFLEVEqk..............MTG.
ENSBTAP00000055444  ..-SNHKD...................................H.LDATDLLRFLEVEqk..............MTG.
ENSBTAP00000024550  ..DKDGSG...................................S.VEHHELNQAIAAM................GYR.
ENSBTAP00000015248  ..DEEASG...................................F.IHEDHLRELLTTM................GDR.
ENSBTAP00000021328  ..DEEATG...................................T.IQEDYLRELLTTM................GDR.
ENSBTAP00000037091  ..DEEATG...................................T.IQEDYLRELLTTM................GDR.
ENSBTAP00000029967  ..DTNGDG...................................C.ISLGELRAALKALl...............GER.
ENSBTAP00000021449  ..DANGDG...................................E.ITLGELQQAMQRLl...............GDK.
ENSBTAP00000053176  ..------...................................-.-------------................---.
ENSBTAP00000042361  ..DTNGDG...................................E.ISTSELREAMRKLl...............GHQ.
ENSBTAP00000016509  ..DKDRNG...................................C.IDRQELLDIVEVKrpwgppqg........KLL.
ENSBTAP00000026714  ..DTNGDG...................................E.ISTSELREAMRKLl...............GHQ.
ENSBTAP00000004690  ..DQDQSG...................................T.LNSYEMRLAVEKA................GIK.
ENSBTAP00000010858  ..------...................................-.-------------................---.
ENSBTAP00000013117  ..-SSNKE...................................F.LDTKDLMMFLEAEqg..............VAH.
ENSBTAP00000017574  ..SENRKI...................................L.LEKNLVEFLMREQy...............TLD.
ENSBTAP00000004885  ..DKNNDG...................................K.IEASEIVQSLQIL................GLT.
ENSBTAP00000008961  ..------...................................-.-------------................---.
ENSBTAP00000028063  ..TLDHST...................................E.ISVSRLETVISSI................YYQ.
ENSBTAP00000012740  ..------...................................-.-------------................---.
ENSBTAP00000006283  ..DRDRDG...................................R.ITVAELREAAPALl...............GEP.
ENSBTAP00000014306  ..DKEGNG...................................T.VMGAEIRHVLVTL................GEK.
ENSBTAP00000053252  ..-SKNKE...................................Y.LDANDLMLFLEAEqg..............VTH.
ENSBTAP00000014304  ..DKEGNG...................................T.VMGAEIRHVLVTL................GEK.
ENSBTAP00000045669  ..DPEGHG...................................K.ISVF---------................---.
ENSBTAP00000041264  ..------...................................-.-------------................---.
ENSBTAP00000006711  ..------...................................-.-------------................---.
ENSBTAP00000017358  ..------...................................-.-------------................---.
ENSBTAP00000053274  ..DPEGHG...................................K.ISVF---------................---.
ENSBTAP00000055296  ..------...................................-.-------------................---.
ENSBTAP00000016852  ..DKTGDG...................................V.ITIEDLREVYNAKhhpkyqn.........GEW.
ENSBTAP00000036380  ..DKEKKG...................................Y.IMASELRSKLMQL................GEK.
ENSBTAP00000041719  ..DKEQNG...................................K.VMGAELRHVLTTL................GER.
ENSBTAP00000049636  ..DKEGNG...................................T.VMGAELRHVLATL................GEK.
ENSBTAP00000024444  ..DPEGKG...................................V.LKADYIKEMLTTQ................AER.
ENSBTAP00000004556  ..DSFKDG...................................K.LSNNEWCYCFQ--................---.
ENSBTAP00000038767  ..DLDKDD...................................K.ISRDELLQVLRMMv...............GVN.
ENSBTAP00000031285  ..------...................................-.-------------................---.
ENSBTAP00000011457  ..DLNGDS...................................F.ISKEEMFHMLKNSllkqp...........SEE.
ENSBTAP00000011047  ..DKEGNG...................................T.VMGAELRHVLATL................GEK.
ENSBTAP00000002564  ..------...................................-.-------------................---.
ENSBTAP00000037104  ..DTEGKG...................................F.VKADFIKEKLMTQ................ADR.
ENSBTAP00000002672  ..DPSGKG...................................V.VNKDEFRQLLLTQ................ADK.
ENSBTAP00000028269  ..DPEGKG...................................T.IKKKFLEELLTTQ................CDR.
ENSBTAP00000016647  ..DLDRDG...................................K.ISRHEMLQALRLMv...............GVQ.
ENSBTAP00000004536  ..DRNQDG...................................Q.IDVSEIQQSFRAL................GIS.
ENSBTAP00000042177  ..------...................................-.-------------................---.
ENSBTAP00000028063  ..------...................................-.-------------................---.
ENSBTAP00000050283  ..DKESNG...................................T.VMGAELRHVLATL................GEK.
ENSBTAP00000048539  ..DLDKDG...................................F.ITEQELAAILRAA................FG-.
ENSBTAP00000045669  ..------...................................-.-------------................---.
ENSBTAP00000007972  ..DRSGDG...................................V.VTVDDLRGVYSGRthpkvrs.........GEW.
ENSBTAP00000040815  ..------...................................-.-------------................---.
ENSBTAP00000025661  ..DVDEDG...................................F.ITEEEFSTILQASl...............G--.
ENSBTAP00000028350  ..DFDDDG...................................T.LNREDLSQLVNCLtgese...........DTR.
ENSBTAP00000053274  ..------...................................-.-------------................---.
ENSBTAP00000021537  ..DFNNDD...................................Y.ICAWDLEQTVTKLt...............RGE.
ENSBTAP00000055481  ..------...................................-.-------------................---.
ENSBTAP00000039155  ..DKDSKI...................................L.VSTAKRRHAMTWL................GKK.
ENSBTAP00000029333  ..------...................................-.-------------................---.
ENSBTAP00000016315  ..------...................................-.-------------................---.
ENSBTAP00000021091  ..DTNRSG...................................S.LNWAQLRAAMREA................GIM.
ENSBTAP00000021618  ..DFDGNG...................................L.ISKDEFIRMLRSFieis............NNC.
ENSBTAP00000055520  ..------...................................-.-------------................---.
ENSBTAP00000055624  ..------...................................-.-------------................---.
ENSBTAP00000016319  ..------...................................-.-------------................---.
ENSBTAP00000034078  ..DPAKRG...................................F.LSKDELIKYMTEE................GEP.
ENSBTAP00000006645  ..DFNENG...................................F.IDEEDLQRIILRLln..............SDD.
ENSBTAP00000021909  ..DKNRDG...................................K.MDKEETKDWILPS................DYD.
ENSBTAP00000001426  ..DTDRSG...................................Y.IEANELKGFLSDLlkka............NRP.
ENSBTAP00000015802  ..DKKNDG...................................R.IDAQEIMQSLRDL................GVK.
ENSBTAP00000032680  ..DKKNDG...................................R.IDAQEIMQSLRDL................GVK.
ENSBTAP00000055007  ..DR----...................................-.-------------................---.
ENSBTAP00000020148  ..------...................................-.-------------................---.
ENSBTAP00000052345  ..------...................................-.-------------................---.
ENSBTAP00000029334  ..------...................................-.-------------................---.
ENSBTAP00000052345  ..------...................................-.-------------................---.
ENSBTAP00000056127  ..DLNKDG...................................K.LDKDEISHWILPQ................DYD.
ENSBTAP00000012557  ..DSDHSG...................................L.ISMEEFRSMWRLFkshy............SVH.
ENSBTAP00000011888  ..DVDGKHplwdgrrtqregqrerpvsvtaqhwassspetgsgS.IDADELRTVLQSClyes............AIS.
ENSBTAP00000017060  ..------...................................-.-------------................---.
ENSBTAP00000031854  ..DVDGDG...................................V.LSMYELEYFYEEQ................CER.
ENSBTAP00000031823  ..DLNKDG...................................K.LNGSEVGHWVLPP................AQD.
ENSBTAP00000021603  ..DLDGNG...................................F.LSKDEFFTMMRVPptprprsfieis....NNC.
ENSBTAP00000010838  ..------...................................-.-------------................---.
ENSBTAP00000014575  ..DFNTDN...................................F.ICKEDLQLTLARLt...............KSE.
ENSBTAP00000011215  ..DVDGDG...................................V.LSMYELEYFYEEQ................CER.
ENSBTAP00000053698  ..DMQ---...................................R.ITLEELKHILYHAf...............RDH.
ENSBTAP00000006806  ..------...................................-.-------------................---.
ENSBTAP00000029334  ..------...................................-.-------------................---.
ENSBTAP00000044105  ..------...................................-.-------------................---.
ENSBTAP00000026904  ..------...................................-.-------------................---.
ENSBTAP00000017060  ..------...................................-.-------------................---.
ENSBTAP00000055520  ..------...................................-.-------------................---.
ENSBTAP00000044226  ..------...................................-.-------------................---.
ENSBTAP00000055624  ..------...................................-.-------------................---.
ENSBTAP00000042182  ..DEDASG...................................T.MNSYELRLALNAA................GFH.
ENSBTAP00000010796  ..DEGGTG...................................L.LSVADFRKVLRQY................SIN.
ENSBTAP00000021174  ..DTDHSG...................................F.IETEELKNFLKDL................LEK.
ENSBTAP00000006275  ..------...................................-.-------------................---.
ENSBTAP00000020950  ..DRDADG...................................R.LDPQELLSWVVPN................NQG.
ENSBTAP00000053738  ..DEGGTG...................................L.LSVADFRKVLRQY................SIN.
ENSBTAP00000004963  ..YFNGDG...................................Y.ISRERIYDMLKNS................L--.
ENSBTAP00000023774  ..DMQ---...................................K.LTVDELKRLLYDTf...............CEH.
ENSBTAP00000020395  ..SSEGKP...................................Y.VTKEELYQNLT--................---.
ENSBTAP00000020150  ..------...................................-.-------------................---.
ENSBTAP00000025561  ..------...................................-.-------------................---.
ENSBTAP00000053738  ..DSEGNG...................................I.LRRRDMKNALYGF................DIP.
ENSBTAP00000034009  ..------...................................-.-------------................---.
ENSBTAP00000020539  ..DSDHSG...................................S.ISLDEFRHTWKLF................SSH.
ENSBTAP00000020778  ..DANHDG...................................I.VTMAELEDYMDPM................NEF.
ENSBTAP00000017461  ..DRHYRG...................................Y.LTLEDFKKAFKQV................APK.
ENSBTAP00000044096  ..------...................................-.-------------................---.
ENSBTAP00000008523  ..------...................................-.-------------................---.
ENSBTAP00000035196  ..DLDRDC...................................A.LSPDELKDLFKVFpyipw...........GPD.
ENSBTAP00000041997  ..------...................................-.-------------................---.
ENSBTAP00000025499  ..DKDKSG...................................F.IEEEELGFILKGFspd.............ARD.
ENSBTAP00000055481  ..------...................................-.-------------................---.
ENSBTAP00000002174  ..------...................................-.-------------................---.
ENSBTAP00000000589  ..------...................................-.-------------................---.
ENSBTAP00000028239  ..------...................................-.-------------................---.
ENSBTAP00000014894  ..-AGDKN...................................F.ITAEELRREL---................---.
ENSBTAP00000026544  ..DVSKTG...................................A.LEGPEVDGFVKDM................MEL.
ENSBTAP00000029333  ..------...................................-.-------------................---.
ENSBTAP00000041966  ..-PKNAG...................................V.FLSSDLWKAIRDTdfla............GIS.
ENSBTAP00000008933  ..------...................................-.-------------................---.
ENSBTAP00000056088  ..------...................................-.-------------................---.
ENSBTAP00000033794  ..------...................................-.-------------................---.
ENSBTAP00000012786  ..-ASDKP...................................Y.ILAEELRRE----................---.
ENSBTAP00000030018  ..-AGDKN...................................Y.ITAEELRREL---................---.
ENSBTAP00000040233  ..DVNTTG...................................L.VQPHELRRVLETF................CLK.
ENSBTAP00000003365  ..DVNDNG...................................S.ILHTDLYKLLTKK................GEK.
ENSBTAP00000053176  ..DTDGNG...................................F.LDSSELENIISQMmhvae...........YLE.
ENSBTAP00000024301  ..-AGDKN...................................Y.ITVDELRRE----................---.
ENSBTAP00000022292  ..DKSGNG...................................E.VTFENVKEIFGQTti..............HHH.
ENSBTAP00000015611  ..------...................................-.-------------................---.
ENSBTAP00000012770  ..DIENKG...................................Y.LNVFSLNYFFRAI................QEL.
ENSBTAP00000000847  ..------...................................-.-------------................---.
ENSBTAP00000053738  ..DVNTTG...................................L.VQPHELRRVLETF................CLK.
ENSBTAP00000054975  ..------...................................-.-------------................---.
ENSBTAP00000046639  ..DFNKTG...................................S.VSIIDIRKCYCAKmhprvi..........SGH.
ENSBTAP00000052345  ..------...................................-.-------------................---.
ENSBTAP00000053164  ..DKKGDG...................................V.IDRAELQEACDQA................CLH.
ENSBTAP00000016774  ..------...................................-.-------------................---.
ENSBTAP00000022630  ..------...................................-.-------------................---.
ENSBTAP00000010796  ..DTMKTN...................................T.ASRDEFRSICTRH................VQV.
ENSBTAP00000021909  ..DKDGDL...................................I.ATKEEFTAFL---................---.
ENSBTAP00000033974  ..DKEARG...................................Y.IDWDTLKYVLMNV................GEP.
ENSBTAP00000006711  ..DSDENG...................................L.LDQAEMDRIVSQMlhiaq...........YLE.
ENSBTAP00000010796  ..DKSRTG...................................Y.ISLGRLQRLLQEC................GCS.
ENSBTAP00000004912  ..DKAGKG...................................E.VTFEDVKQVFGQTti..............HQH.
ENSBTAP00000005979  ..DQDRDG...................................A.LSPAELQSLFSVF................---.
ENSBTAP00000053738  ..DTMKTN...................................T.ASRDEFRSICTRH................VQV.
ENSBTAP00000053746  ..DSDSDG...................................R.ITLEEYRNVVEELlsg.............NPH.
ENSBTAP00000023221  ..DVNSDG...................................F.LDEQELEALFTKE................LEK.
ENSBTAP00000019429  ..------...................................-.-------------................---.
ENSBTAP00000052019  ..------...................................-.-------------................---.
ENSBTAP00000042244  ..------...................................-.-------------................---.
ENSBTAP00000053738  ..DLGDTG...................................L.IGRNNFKKIMRVF................CPF.
ENSBTAP00000018877  ..------...................................-.-------------................---.
ENSBTAP00000053019  ..------...................................-.-------------................---.
ENSBTAP00000003073  ..DINSDG...................................V.LDEQELEALFTKElekvy...........DPK.
ENSBTAP00000012886  ..------...................................-.-------------................---.
ENSBTAP00000044222  ..------...................................-.-------------................---.
ENSBTAP00000028499  ..------...................................-.-------------................---.
ENSBTAP00000047378  ..GVGSSG...................................H.LTEQELALVCQSI................GLQg
ENSBTAP00000009308  ..------...................................-.-------------................---.
ENSBTAP00000017060  ..------...................................-.-------------................---.
ENSBTAP00000050406  ..------...................................-.-------------................---.
ENSBTAP00000031879  ..------...................................-.-------------................---.
ENSBTAP00000031854  ..NRSWSG...................................K.ITATEIR------................---.
ENSBTAP00000001250  ..-GSQDG...................................S.VEEHALSSILKTAl...............G--.
ENSBTAP00000026035  ..------...................................-.-------------................---.
ENSBTAP00000011215  ..NRSWSG...................................K.ITATEIR------................---.
ENSBTAP00000002128  ..DKIKDE...................................N.IDYGDLNTCLQNL................GVY.
ENSBTAP00000053194  ..-AEGKA...................................Y.ITKEDMKQALT--................---.
ENSBTAP00000056127  ..DLDSDQ...................................T.ATREEFTAFL---................---.
ENSBTAP00000033188  ..------...................................-.-------------................---.
ENSBTAP00000053548  ..------...................................-.-------------................---.
ENSBTAP00000011687  ..DLDGEL...................................K.IGPDHLH--MYNF................LFN.
ENSBTAP00000007636  ..DLNGDG...................................E.VDMEEFEQVQSIIrsqtsmgmrhrdrsttGNT.
ENSBTAP00000020950  ..------...................................-.-------------................---.
ENSBTAP00000009115  ..------...................................-.-------------................---.
ENSBTAP00000023873  ..------...................................-.-------------................---.
ENSBTAP00000054471  ..DKEGKG...................................F.IARADMQRLHKEL................P--.
ENSBTAP00000039694  ..NF-ASR...................................S.IGQDEFKRAVYVAt...............GLK.
ENSBTAP00000025205  ..DKEGKG...................................F.IARADMQRLHKEL................P--.
ENSBTAP00000047882  ..DYDGNN...................................L.LDGLELSTAITHVhkeegse.........QAP.
ENSBTAP00000001368  ..DQNQDG...................................C.ISKEEMVSYF---................---.
ENSBTAP00000029786  ..------...................................-.-------------................---.
ENSBTAP00000028993  ..------...................................-.-------------................---.
ENSBTAP00000023678  ..DKEASG...................................Y.VDRETFFKICGSY................QLP.
ENSBTAP00000034710  ..------...................................-.-------------................---.
ENSBTAP00000031823  ..DQDGDS...................................M.ATREELTAFL---................---.
ENSBTAP00000038002  ..DTDRNG...................................I.LDSSEVDRIIIQMmrm.............AEY.
ENSBTAP00000021074  ..------...................................-.-------------................---.
ENSBTAP00000026544  ..DADSSG...................................F.ISAAELCNFLRDL................---.
ENSBTAP00000007217  ..DQNHDG...................................R.LQLREVLAQNRLGn...............GRW.
ENSBTAP00000029792  ..------...................................-.-------------................---.
ENSBTAP00000044088  ..DADGDE...................................M.VEKKEFFKLQKIIskqddlktaitdetecQ--.
ENSBTAP00000017319  ..------...................................-.-------------................---.
ENSBTAP00000044100  ..DKDQDG...................................L.ISKDEMMAYFLRA................---.
ENSBTAP00000033594  ..------...................................-.-------------................---.
ENSBTAP00000026766  ..------...................................-.-------------................---.
ENSBTAP00000055894  ..------...................................-.-------------................---.
ENSBTAP00000015220  ..DRNQDG...................................K.ITAEELK------................---.
ENSBTAP00000033613  ..DKDGDG...................................E.VLLEEFSEYIHAQvasgk...........GKL.
ENSBTAP00000056320  ..DLDGDV...................................A.LFMFELEYFYEEQ................SRR.
ENSBTAP00000025249  ..------...................................-.-------DFLVNCq...............GEH.
ENSBTAP00000029159  ..DKDREG...................................L.ISRDEITAYFM--................---.
ENSBTAP00000044088  ..SLAH-R...................................P.VRLAEFKRAVKVAt...............GQE.
ENSBTAP00000016319  ..------...................................-.-------------................---.
ENSBTAP00000017662  ..------...................................-.-------------................---.
ENSBTAP00000012479  ..DRSFSG...................................C.LPPPKVRAICGKH................GLY.
ENSBTAP00000029886  ..------...................................-.-------------................---.
ENSBTAP00000027388  ..------...................................-.-------------................---.
ENSBTAP00000039694  ..DTDGNE...................................M.VDKKEFLVLQEIF................RKK.
ENSBTAP00000023673  ..DKEAKG...................................F.ITRHDLQGLQSDL................--P.
ENSBTAP00000041488  ..DKEAKG...................................F.ITRHDLQGLQSDL................--P.
ENSBTAP00000001452  ..------...................................-.-------------................---.
ENSBTAP00000028498  ..------...................................-.-------------................---.
ENSBTAP00000001426  ..DKDGSG...................................Y.IDENELDALLKDL................---.
ENSBTAP00000020240  ..------...................................-.-------------................---.
ENSBTAP00000053650  ..------...................................-.-------------................---.
ENSBTAP00000041651  ..DYDQSG...................................Q.LDGLELLSMLTAAlapga...........SDS.
ENSBTAP00000005154  ..----DG...................................V.LSPGELRELFSGVd...............GHP.
ENSBTAP00000021174  ..DQDGNG...................................Y.IDENELDALLKDL................CEK.
ENSBTAP00000022068  ..------...................................-.-------------................---.
ENSBTAP00000026682  ..DQDGDQ...................................E.LTEHEHQ------................---.
ENSBTAP00000007636  ..---AGA...................................S.LDKVTMQQVARTVa...............KVE.
ENSBTAP00000027954  ..------...................................-.-------------................---.
ENSBTAP00000020778  ..------...................................-.-------------................---.
ENSBTAP00000013601  ..------...................................-.-------------................---.
ENSBTAP00000005477  ..NSKGEK...................................A.IQREDFLNLLHTK................GEH.
ENSBTAP00000055305  ..------...................................-.-------------................---.
ENSBTAP00000036054  ..------...................................-.-------------................---.
ENSBTAP00000004912  ..DSARTG...................................K.VTAIDFRDIMVTIr...............PHV.
ENSBTAP00000022292  ..DKSKSG...................................L.ISGLDFSDIMVTIr...............SHM.
ENSBTAP00000002717  ..------...................................-.-------------................---.
ENSBTAP00000036015  ..------...................................-.-------------................---.
ENSBTAP00000051638  ykDPSKGD...................................E.LSKEEL-------................---.
ENSBTAP00000026766  ..ASESGS...................................Y.VIREEMERMLHVV................DGK.
ENSBTAP00000053738  ..DKSRTG...................................Y.ISLGRLQRLLQEC................GCS.
ENSBTAP00000016306  ..DFDNNG...................................K.VTREDITSLLHTI................YEV.
ENSBTAP00000013714  ..------...................................-.-------------................---.
ENSBTAP00000036550  ..------...................................-.-------------................---.
ENSBTAP00000053738  ..TKEPNG...................................K.IHTHDFKKVLEDY................GMP.
ENSBTAP00000023383  ..------...................................-.-------------................---.
ENSBTAP00000027030  ..DFSLDG...................................N.VNLTELTLAL---................---.
ENSBTAP00000053270  ..DFSLDG...................................N.VNLTELTLAL---................---.
ENSBTAP00000054640  ..DFSLDG...................................N.VNLTELTLAL---................---.
ENSBTAP00000012770  ..DVAGQG...................................Y.LRESDLENYILEL................IPT.
ENSBTAP00000009967  ..DAEQLG...................................T.ITYEQYKQA----................---.
ENSBTAP00000015183  ..DVAQEG...................................F.INWDKLTSFLLL-................---.
ENSBTAP00000014222  ..DQDGNG...................................V.LDEKEQK------................---.
ENSBTAP00000026288  ..------...................................-.-------------................---.
ENSBTAP00000002128  ..HRIKCG...................................R.VPVSEVDKVLDSM................DIL.
ENSBTAP00000003365  ..DLDGNG...................................L.LSLEEYNFFELRTs...............GEK.
ENSBTAP00000053738  ..DPCTSG...................................Y.VSLNYLKIVLDTF................VYR.
ENSBTAP00000009228  ..------...................................-.-------------................---.
ENSBTAP00000026785  ..------...................................-.-------------................---.
ENSBTAP00000002578  ..------...................................-.----EF-------................---.
ENSBTAP00000000106  ..------...................................-.-------------................---.
ENSBTAP00000028840  ..------...................................-.-------------................---.
ENSBTAP00000053594  ..DAEGDG...................................T.VDAENMLEALKNSs...............GAN.
ENSBTAP00000055414  ..DCDGSG...................................F.LDLKEIDELLYTY................KEG.
ENSBTAP00000026698  ..QQDADG...................................L.VDFRDVALALAAL................SGG.
ENSBTAP00000017015  ..------...................................-.-------------................---.
ENSBTAP00000049908  ..DQSHCG...................................Y.LLEKDLEEIFYTL................GLH.
ENSBTAP00000021395  ..------...................................-.-------------................---.
ENSBTAP00000007194  ..DANWCG...................................Y.LHRRDLERILLTL................GLR.
ENSBTAP00000025455  ..DCDGSG...................................F.LDLKEIDELLYTY................KEG.


                           130                       140           150                              
                             |                         |             |                              
d1df0a1               LP.CQLHQV...........IVARFA.....DDELI....IDFDNFVRCLVRLEI.......................
ENSBTAP00000019411  LT.DEEVD-...........------.....-----....---------------.......................
ENSBTAP00000036057  LT.DEEVD-...........------.....-----....---------------.......................
ENSBTAP00000038404  MP.EDEST-...........------.....-----....-----------PEKR.......................
ENSBTAP00000010971  MP.EDEST-...........------.....-----....-----------PEKR.......................
ENSBTAP00000019803  LN.EHLYNM...........IIRRYS.....DEGGN....MDFDNFISCLVRLDA.......................
ENSBTAP00000014038  LK.DTQLQQ...........IVD---.....-----....---------------.......................
ENSBTAP00000002055  LT.DEEVD-...........------.....-----....---------------.......................
ENSBTAP00000049731  LT.DEEVD-...........------.....-----....---------------.......................
ENSBTAP00000005577  MP.EDEST-...........------.....-----....-----------PEKR.......................
ENSBTAP00000034949  IS.PEDTKH...........LPE---.....-----....-------DENTPEKR.......................
ENSBTAP00000017447  --.------...........------.....-----....---------------.......................
ENSBTAP00000010858  --.------...........------.....-----....---------------.......................
ENSBTAP00000046644  --.------...........------.....-----....---------------.......................
ENSBTAP00000022814  VG.TVIMMK...........MNE---.....-----....-------DGLTPEQR.......................
ENSBTAP00000019758  --.------...........------.....-----....---------------.......................
ENSBTAP00000019321  VG.TVIMMR...........MNQ---.....-----....-------DGLTPQQR.......................
ENSBTAP00000011677  LN.NQLYDI...........ITMRYA.....DKYMN....IDFDSFICCFVRLEG.......................
ENSBTAP00000011680  LN.NQLYDI...........ITMRYA.....DKYMN....IDFDSFICCFVRLEG.......................
ENSBTAP00000021742  MG.KYTYPA...........LREEA-.....-----....-----------PREH.......................
ENSBTAP00000005348  --.------...........------.....-----....---------------.......................
ENSBTAP00000016609  --.------...........------.....-----....---------------.......................
ENSBTAP00000012740  --.------...........------.....-----....---------------.......................
ENSBTAP00000018403  VS.QDELD-...........------.....-----....---------------.......................
ENSBTAP00000026407  --.------...........------.....-----....---------------.......................
ENSBTAP00000052557  LT.DEELQ-...........------.....-----....---------------.......................
ENSBTAP00000054167  AP.RQHVE-...........------.....-----....---------------.......................
ENSBTAP00000010319  LS.DEELQ-...........------.....-----....---------------.......................
ENSBTAP00000041545  AS.DLALE-...........LIDRYEp....SESGKlrhvLSMDGFLGYL-----.......................
ENSBTAP00000055204  LS.DQFHDI...........LIRKFDr....QGRGQ....IAFDDFIQGCIVLQR.......................
ENSBTAP00000003718  TP.RQHVD-...........------.....-----....---------------.......................
ENSBTAP00000011676  LS.DQVQQT...........IAMRYA.....CSKLT....MDFDSFIACMIRLET.......................
ENSBTAP00000049395  AG.PALALS...........LIERYEpsetaKAQRQ....MTKDGFLMYLL----.......................
ENSBTAP00000054983  --.------...........------.....-----....---------------.......................
ENSBTAP00000052219  LS.PQAVNS...........IAKRYS.....T-NGK....ITFDDYIACCVKLRA.......................
ENSBTAP00000025402  --.------...........------.....-----....---------------.......................
ENSBTAP00000011678  LN.KKLYEL...........IITRYS.....EPDLA....VDFDNFVCCLVRLET.......................
ENSBTAP00000000433  --.------...........------.....-----....---------------.......................
ENSBTAP00000021491  LT.DDELQ-...........------.....-----....---------------.......................
ENSBTAP00000044733  MP.CQLHQV...........IVARFA.....DDDLI....IDFDNFVRCLIRLET.......................
ENSBTAP00000010937  VT.TDYCID...........IIRKFEv....SEENKvknvLGIEGFTNFM-----.......................
ENSBTAP00000056439  VT.TDYCID...........IIRKFEv....SEENKvknvLGIEGFTNFM-----.......................
ENSBTAP00000055780  IT.EDDIE-...........------.....-----....---------------.......................
ENSBTAP00000038002  --.------...........------.....-----....---------------.......................
ENSBTAP00000034705  AT.LAHAQQ...........LIHTYElnetaKQHEL....MTLDGFMMYLLSP--.......................
ENSBTAP00000035936  KK.ACSVE-...........------.....-----....VEAEQQGKLLTPEEV.......................
ENSBTAP00000013699  LS.PQFTQL...........LVSRYCpr...SANPA....MQLDRFIQVCTQLQV.......................
ENSBTAP00000002564  LE.EE----...........------.....-----....---------------.......................
ENSBTAP00000011496  TP.EKRVD-...........------.....-----....---------------.......................
ENSBTAP00000019111  MS.DEELR-...........------.....-----....---------------.......................
ENSBTAP00000017036  --.------...........------.....CSDST....MTAEEFTD-------.......................
ENSBTAP00000003213  VT.LESCRD...........IIEQFEpcpenKSKGA....MGIDGFTNYT-----.......................
ENSBTAP00000055444  VT.LESCRD...........IIEQFEpcpenKSKGA....MGIDGFTNYT-----.......................
ENSBTAP00000024550  LS.PQTVTT...........IVKRYS.....K-NGR....IFFDDYVACCVKLRA.......................
ENSBTAP00000015248  FT.DEEVD-...........------.....-----....---------------.......................
ENSBTAP00000021328  FT.DEEVD-...........------.....-----....---------------.......................
ENSBTAP00000037091  FT.DEEVD-...........------.....-----....---------------.......................
ENSBTAP00000029967  LS.QREVD-...........------.....-----....---------------.......................
ENSBTAP00000021449  LT.SQEIS-...........------.....-----....---------------.......................
ENSBTAP00000053176  --.------...........------.....-----....---------------.......................
ENSBTAP00000042361  VG.HRDIE-...........------.....-----....---------------.......................
ENSBTAP00000016509  TP.EEVVD-...........------.....-----....---------------.......................
ENSBTAP00000026714  VG.HRDIE-...........------.....-----....---------------.......................
ENSBTAP00000004690  LN.NKVTQV...........LVARYA.....NDSLI....MEFDSFISCFLRLKA.......................
ENSBTAP00000010858  --.------...........------.....-----....---------------.......................
ENSBTAP00000013117  IN.EEISLE...........IIHKYEpskegQEKGW....LSIDGFTNYLMSPDC.......................
ENSBTAP00000017574  FN.KSIASE...........IIQKYEpieevKQAHQ....MSFEGFRRYMDS---.......................
ENSBTAP00000004885  IS.EQQAE-...........------.....-----....---------------.......................
ENSBTAP00000008961  --.------...........------.....-----....---------------.......................
ENSBTAP00000028063  LN.KRLPS-...........------.....--THQ....ISVEQSISLLLN---.......................
ENSBTAP00000012740  --.------...........------.....-----....---------------.......................
ENSBTAP00000006283  LV.GPELE-...........------.....-----....---------------.......................
ENSBTAP00000014306  MT.EEEVEM...........LVAGHE.....DSNGC....INYEELVRMV-----.......................
ENSBTAP00000053252  IT.EDMCLD...........IIRRYElseegRQKGF....LAIDGFTQYLLSS--.......................
ENSBTAP00000014304  MT.EEEVEM...........LVAGHE.....DSNGC....INYEAFVRHI-----.......................
ENSBTAP00000045669  --.------...........------.....-----....---------------.......................
ENSBTAP00000041264  --.------...........------.....-----....---------------.......................
ENSBTAP00000006711  --.------...........------.....-----....---------------.......................
ENSBTAP00000017358  --.------...........------.....-----....---------------.......................
ENSBTAP00000053274  --.------...........------.....-----....---------------.......................
ENSBTAP00000055296  --.------...........------.....-----....---------------.......................
ENSBTAP00000016852  TE.EQVFR-...........------.....-----....---------------.......................
ENSBTAP00000036380  LT.HKEVE-...........------.....-----....---------------.......................
ENSBTAP00000041719  MT.EEEVES...........VLAGHE.....DSSGC....INYEAFLKHI-----.......................
ENSBTAP00000049636  MK.EEEVEA...........LMAGQE.....DSNGC....INYEAFVKHIM----.......................
ENSBTAP00000024444  FS.KEEID-...........------.....-----....---------------.......................
ENSBTAP00000004556  --.------...........------.....-----....---------------.......................
ENSBTAP00000038767  IS.DEQLGS...........IAD---.....-----....---------------.......................
ENSBTAP00000031285  --.------...........------.....-----....---------------.......................
ENSBTAP00000011457  DP.DEGIKD...........LVE---.....-----....---------------.......................
ENSBTAP00000011047  LT.EDEVEK...........LMAGQE.....DSNGC....INYEAFVKHIM----.......................
ENSBTAP00000002564  --.------...........------.....-----....---------------.......................
ENSBTAP00000037104  FS.EEEVK-...........------.....-----....---------------.......................
ENSBTAP00000002672  FS.PAEVE-...........------.....-----....---------------.......................
ENSBTAP00000028269  FS.QEEIK-...........------.....-----....---------------.......................
ENSBTAP00000016647  VT.EEQLES...........IAD---.....-----....---------------.......................
ENSBTAP00000004536  IS.LEQAE-...........------.....-----....---------------.......................
ENSBTAP00000042177  --.------...........------.....-----....---------------.......................
ENSBTAP00000028063  --.------...........------.....-----....---------------.......................
ENSBTAP00000050283  MS.EAEVEQ...........LLAGQE.....DANGC....INYEAFVKHIM----.......................
ENSBTAP00000048539  VP.DLDVST...........LFREIAg....PNSDR....ISYRTFKKFALKHPA.......................
ENSBTAP00000045669  --.------...........------.....-----....---------------.......................
ENSBTAP00000007972  TE.EQVLRH...........FLDNFDss...EKDGQ....VTLAEFQDYYSGV--.......................
ENSBTAP00000040815  --.------...........------.....-----....---------------.......................
ENSBTAP00000025661  VP.DLDVSG...........LFKEIA.....Q-GDS....VSYEEFKSFALKHPE.......................
ENSBTAP00000028350  LS.ASEMKQ...........LID---.....-----....---------------.......................
ENSBTAP00000053274  --.------...........------.....-----....---------------.......................
ENSBTAP00000021537  LS.TEEVSL...........ICE---.....-----....---------------.......................
ENSBTAP00000055481  --.------...........------.....-----....---------------.......................
ENSBTAP00000039155  LN.NQEVE-...........------.....-----....---------------.......................
ENSBTAP00000029333  --.------...........------.....-----....---------------.......................
ENSBTAP00000016315  --.------...........------.....-----....---------------.......................
ENSBTAP00000021091  LS.DDVCQL...........MLIRYG.....GPDLQ....MNFVRFVRLMLRVEN.......................
ENSBTAP00000021618  LT.KTQLAE...........VVE---.....-----....---------------.......................
ENSBTAP00000055520  --.------...........------.....-----....---------------.......................
ENSBTAP00000055624  --.------...........------.....-----....---------------.......................
ENSBTAP00000016319  --.------...........------.....-----....---------------.......................
ENSBTAP00000034078  FS.QEEMEE...........MLSAAId....PESNS....IHYKDYITMM-----.......................
ENSBTAP00000006645  MS.EDLLTD...........LTS---.....-----....---------------.......................
ENSBTAP00000021909  HA.EAEAR-...........------.....-----....---------------.......................
ENSBTAP00000001426  YD.EPKLQE...........YTQ---.....-----....---------------.......................
ENSBTAP00000015802  IS.EQQAE-...........------.....-----....---------------.......................
ENSBTAP00000032680  IS.EQQAE-...........------.....-----....---------------.......................
ENSBTAP00000055007  --.------...........------.....-----....---------------.......................
ENSBTAP00000020148  --.------...........------.....-----....---------------.......................
ENSBTAP00000052345  --.------...........------.....-----....---------------.......................
ENSBTAP00000029334  --.------...........------.....-----....---------------.......................
ENSBTAP00000052345  --.------...........------.....-----....---------------.......................
ENSBTAP00000056127  HA.QAEAR-...........------.....-----....---------------.......................
ENSBTAP00000012557  ID.DSQFD-...........------.....-----....---------------.......................
ENSBTAP00000011888  LP.KEKLDQ...........LTL---.....-----....---------------.......................
ENSBTAP00000017060  --.------...........------.....-----....---------------.......................
ENSBTAP00000031854  ME.AMGIE-...........------.....-----....--------PLPFHDL.......................
ENSBTAP00000031823  QP.LVEAN-...........------.....-----....---------------.......................
ENSBTAP00000021603  LT.KTQLAE...........V-----.....-----....---------------.......................
ENSBTAP00000010838  --.------...........------.....-----....---------------.......................
ENSBTAP00000014575  LD.EDEVVL...........VCD---.....-----....---------------.......................
ENSBTAP00000011215  ME.AMGIE-...........------.....-----....--------PLPFHDL.......................
ENSBTAP00000053698  LT.MKDIE-...........------.....-----....---------------.......................
ENSBTAP00000006806  --.------...........------.....-----....---------------.......................
ENSBTAP00000029334  --.------...........------.....-----....---------------.......................
ENSBTAP00000044105  --.------...........------.....-----....---------------.......................
ENSBTAP00000026904  --.------...........------.....-----....---------------.......................
ENSBTAP00000017060  --.------...........------.....-----....---------------.......................
ENSBTAP00000055520  --.------...........------.....-----....---------------.......................
ENSBTAP00000044226  --.------...........------.....-----....---------------.......................
ENSBTAP00000055624  --.------...........------.....-----....---------------.......................
ENSBTAP00000042182  LN.NQLTQA...........LTSRYR.....DSRLR....VDFERFVSCMAQLIC.......................
ENSBTAP00000010796  LS.EEEFF-...........------.....-----....---------------.......................
ENSBTAP00000021174  AN.KTVDDT...........KLAEYT.....D----....---------------.......................
ENSBTAP00000006275  --.------...........------.....-----....---------------.......................
ENSBTAP00000020950  IA.QEEAR-...........------.....-----....---------------.......................
ENSBTAP00000053738  LS.EEEFF-...........------.....-----....---------------.......................
ENSBTAP00000004963  --.------...........------.....-----....---------------.......................
ENSBTAP00000023774  LS.MKDIEN...........------.....-----....---------------.......................
ENSBTAP00000020395  --.REQAD-...........------.....-----....---------------.......................
ENSBTAP00000020150  --.------...........------.....-----....---------------.......................
ENSBTAP00000025561  --.------...........------.....-----....---------------.......................
ENSBTAP00000053738  LT.PREFE-...........------.....-----....---------------.......................
ENSBTAP00000034009  --.------...........------.....-----....---------------.......................
ENSBTAP00000020539  MN.IDITDD...........CIC---.....-----....---------------.......................
ENSBTAP00000020778  SA.LNEAK-...........------.....-----....---------------.......................
ENSBTAP00000017461  LS.ERIIL-...........------.....-----....---------------.......................
ENSBTAP00000044096  --.------...........------.....-----....---------------.......................
ENSBTAP00000008523  --.------...........------.....-----....---------------.......................
ENSBTAP00000035196  VN.NTVGT-...........------.....NEKGW....ITYQGFL--------.......................
ENSBTAP00000041997  --.------...........------.....-----....---------------.......................
ENSBTAP00000025499  LS.VKETK-...........------.....-----....---------------.......................
ENSBTAP00000055481  --.------...........------.....-----....---------------.......................
ENSBTAP00000002174  --.------...........------.....-----....---------------.......................
ENSBTAP00000000589  --.------...........------.....-----....---------------.......................
ENSBTAP00000028239  --.------...........------.....-----....---------------.......................
ENSBTAP00000014894  --.------...........------.....-----....---------------.......................
ENSBTAP00000026544  VQ.PSIRG-...........------.....-----....VDLDKFRE-------.......................
ENSBTAP00000029333  --.------...........------.....-----....---------------.......................
ENSBTAP00000041966  IT.SELLDL...........MKLRYS.....DSTGR....VSFPSLVCLLMRLEA.......................
ENSBTAP00000008933  --.------...........------.....-----....---------------.......................
ENSBTAP00000056088  --.------...........------.....-----....---------------.......................
ENSBTAP00000033794  --.------...........------.....-----....---------------.......................
ENSBTAP00000012786  --.------...........------.....-----....---------------.......................
ENSBTAP00000030018  --.------...........------.....-----....---------------.......................
ENSBTAP00000040233  MK.DEEYKK...........FAQHYNi....DKDAA....VDYNVFLK-------.......................
ENSBTAP00000003365  MT.REEVN-...........------.....-----....---------------.......................
ENSBTAP00000053176  WD.VTELNP...........I-----.....-----....---------------.......................
ENSBTAP00000024301  --.------...........------.....-----....---------------.......................
ENSBTAP00000022292  IPfNWDCEF...........IRLHFGh....NRKKH....LNYTEFTQFL-----.......................
ENSBTAP00000015611  --.------...........------.....-----....---------------.......................
ENSBTAP00000012770  MK.IH----...........------.....-----....---------------.......................
ENSBTAP00000000847  --.------...........------.....-----....---------------.......................
ENSBTAP00000053738  MK.DEEYKK...........FAQHYNi....DKDAA....VDYNVFLK-------.......................
ENSBTAP00000054975  --.------...........------.....-----....---------------.......................
ENSBTAP00000046639  ST.EEEIKS...........SFLETLkdac.SKSDE....VSYGEFE--------.......................
ENSBTAP00000052345  --.------...........------.....-----....---------------.......................
ENSBTAP00000053164  LD.EKLLD-...........------.....-----....---------------.......................
ENSBTAP00000016774  --.------...........------.....-----....---------------.......................
ENSBTAP00000022630  --.------...........------.....-----....---------------.......................
ENSBTAP00000010796  LT.DEQFD-...........------.....-----....---------------.......................
ENSBTAP00000021909  --.------...........------.....-----....---------------.......................
ENSBTAP00000033974  LN.E-----...........------.....-----....---------------.......................
ENSBTAP00000006711  WD.PTELRP...........ILK---.....-----....---------------.......................
ENSBTAP00000010796  LK.EEELID...........LLNRTSwgia.WHNNS....INYLDFLR-------.......................
ENSBTAP00000004912  IP.FNWDSE...........FVQLHFgk...ERKRH....LTYAEFTQFL-----.......................
ENSBTAP00000005979  --.------...........------.....-----....---------------.......................
ENSBTAP00000053738  LT.DEQFD-...........------.....-----....---------------.......................
ENSBTAP00000053746  IE.KESARS...........------.....-----....---------------.......................
ENSBTAP00000023221  VY.DPKNE-...........------.....-EDDM....VEMEE-----ERLRM.......................
ENSBTAP00000019429  --.------...........------.....-----....---------------.......................
ENSBTAP00000052019  --.------...........------.....-----....---------------.......................
ENSBTAP00000042244  --.------...........------.....-----....---------------.......................
ENSBTAP00000053738  LT.TEHLVK...........LCSKFQd....IASGR....ILYKKLLACL-----.......................
ENSBTAP00000018877  --.------...........------.....-----....---------------.......................
ENSBTAP00000053019  --.------...........------.....-----....---------------.......................
ENSBTAP00000003073  NE.DDDMRE...........MEE---.....-----....----------ERLRM.......................
ENSBTAP00000012886  --.------...........------.....-----....---------------.......................
ENSBTAP00000044222  --.------...........------.....-----....---------------.......................
ENSBTAP00000028499  --.------...........------.....-----....---------------.......................
ENSBTAP00000047378  LA.KEELE-...........------.....-----....---------------.......................
ENSBTAP00000009308  --.------...........------.....-----....---------------.......................
ENSBTAP00000017060  --.------...........------.....-----....---------------.......................
ENSBTAP00000050406  --.------...........------.....-----....---------------.......................
ENSBTAP00000031879  --.------...........------.....-----....---------------.......................
ENSBTAP00000031854  --.------...........------.....-----....---------------.......................
ENSBTAP00000001250  --.------...........------.....-----....----------VAELT.......................
ENSBTAP00000026035  --.------...........------.....-----....---------------.......................
ENSBTAP00000011215  --.------...........------.....-----....---------------.......................
ENSBTAP00000002128  LS.KPEFQK...........I-----.....-----....---------------.......................
ENSBTAP00000053194  --.------...........------.....-----....---------------.......................
ENSBTAP00000056127  --.------...........------.....-----....---------------.......................
ENSBTAP00000033188  --.------...........------.....-----....---------------.......................
ENSBTAP00000053548  --.------...........------.....-----....---------------.......................
ENSBTAP00000011687  IK.KQQLR-...........------.....-----....---------------.......................
ENSBTAP00000007636  LK.SGLCSA...........LTTYFFga...DLKGK....LTIKNFLEFQRKLQHdvlkleferhdpvdgriterqfg
ENSBTAP00000020950  --.------...........------.....-----....---------------.......................
ENSBTAP00000009115  --.------...........------.....-----....---------------.......................
ENSBTAP00000023873  --.------...........------.....-----....---------------.......................
ENSBTAP00000054471  LS.LEDLE-...........------.....-----....---------------.......................
ENSBTAP00000039694  LS.PHLVN-...........------.....-----....---------------.......................
ENSBTAP00000025205  LS.LEDLE-...........------.....-----....---------------.......................
ENSBTAP00000047882  MN.EDELIN...........LID---.....-----....---------------.......................
ENSBTAP00000001368  --.------...........------.....-----....---------------.......................
ENSBTAP00000029786  --.------...........------.....-----....---------------.......................
ENSBTAP00000028993  --.------...........------.....-----....---------------.......................
ENSBTAP00000023678  VD.DSLIKE...........LIRMCS.....HGEDK....IDYYNFVRA------.......................
ENSBTAP00000034710  --.------...........------.....-----....---------------.......................
ENSBTAP00000031823  --.------...........------.....-----....---------------.......................
ENSBTAP00000038002  LD.WDVSE-...........------.....-----....-----------LRPI.......................
ENSBTAP00000021074  --.------...........------.....-----....---------------.......................
ENSBTAP00000026544  --.------...........------.....-----....---------------.......................
ENSBTAP00000007217  MT.PETIQ-...........------.....-----....---------------.......................
ENSBTAP00000029792  --.------...........------.....-----....---------------.......................
ENSBTAP00000044088  --.-----EqtvqepeinttLQIRFFgk...RGERK....LHYKEFRRFMENLQAevqemeflqfskglsfmrkedfa
ENSBTAP00000017319  --.------...........------.....-----....---------------.......................
ENSBTAP00000044100  --.------...........------.....-----....---------------.......................
ENSBTAP00000033594  --.------...........------.....-----....---------------.......................
ENSBTAP00000026766  --.------...........------.....-----....---------------.......................
ENSBTAP00000055894  --.------...........------.....-----....---------------.......................
ENSBTAP00000015220  --.------...........------.....-----....---------------.......................
ENSBTAP00000033613  AP.GFDAEM...........IVK---.....-----....---------------.......................
ENSBTAP00000056320  LD.SMAIE-...........------.....-----....--------ALPFEDC.......................
ENSBTAP00000025249  YT.YDEILS...........IIQKFEpsvsmCHQGL....MSFEGFARFL-----.......................
ENSBTAP00000029159  --.------...........------.....-----....---------------.......................
ENSBTAP00000044088  LS.NNILD-...........------.....-----....---------------.......................
ENSBTAP00000016319  --.------...........------.....-----....---------------.......................
ENSBTAP00000017662  --.------...........------.....-----....---------------.......................
ENSBTAP00000012479  LT.LSLLET...........LLNHQDl....GYQNE....IKWENFVEW------.......................
ENSBTAP00000029886  --.------...........------.....-----....---------------.......................
ENSBTAP00000027388  --.------...........------.....-----....---------------.......................
ENSBTAP00000039694  NE.KRETK-...........------.....-----....--GDEEKRAMLRLQLygyhsptnsvlktdaeelvsrsy
ENSBTAP00000023673  LT.PEQLE-...........------.....-----....---------------.......................
ENSBTAP00000041488  LT.PEQLE-...........------.....-----....---------------.......................
ENSBTAP00000001452  --.------...........------.....-----....---------------.......................
ENSBTAP00000028498  --.------...........------.....-----....---------------.......................
ENSBTAP00000001426  --.------...........------.....-----....---------------.......................
ENSBTAP00000020240  --.------...........------.....-----....---------------.......................
ENSBTAP00000053650  --.------...........------.....-----....---------------.......................
ENSBTAP00000041651  PT.TNPVIL...........VVD---.....-----....---------------.......................
ENSBTAP00000005154  AD.NLETEK...........LCDYF-.....-----....---------------.......................
ENSBTAP00000021174  NK.QDL---...........------.....-----....---------------.......................
ENSBTAP00000022068  --.------...........------.....-----....---------------.......................
ENSBTAP00000026682  --.------...........------.....-----....---------------.......................
ENSBTAP00000007636  LS.DHVCD-...........------.....-----....---------------.......................
ENSBTAP00000027954  --.------...........------.....-----....---------------.......................
ENSBTAP00000020778  --.------...........------.....-----....---------------.......................
ENSBTAP00000013601  --.------...........------.....-----....---------------.......................
ENSBTAP00000005477  MT.EEEMTD...........C-----.....-----....---------------.......................
ENSBTAP00000055305  --.------...........------.....-----....---------------.......................
ENSBTAP00000036054  --.------...........------.....-----....---------------.......................
ENSBTAP00000004912  LT.PFVEEC...........LVAAAGg....TTSHQ....VSFSYFNGFNSLLNN.......................
ENSBTAP00000022292  LT.PFVEEN...........LVSAAGg....SISHQ....VSFSYFNAFNSLLNN.......................
ENSBTAP00000002717  --.------...........------.....-----....---------------.......................
ENSBTAP00000036015  --.------...........------.....-----....---------------.......................
ENSBTAP00000051638  --.------...........------.....-----....---------------.......................
ENSBTAP00000026766  VP.DTLRK-...........----CF.....SEGEK....VNYEKFRNWLLLNKD.......................
ENSBTAP00000053738  LK.EEELID...........LLNRTSwgia.WHNNS....INYLDFLRA------.......................
ENSBTAP00000016306  VD.------...........------.....-----....---------------.......................
ENSBTAP00000013714  --.------...........------.....-----....---------------.......................
ENSBTAP00000036550  --.------...........------.....-----....---------------.......................
ENSBTAP00000053738  MD.DDQYAL...........LTTKLG.....YKKEG....MSYLDF---------.......................
ENSBTAP00000023383  --.------...........------.....-----....---------------.......................
ENSBTAP00000027030  --.------...........------.....-----....---------------.......................
ENSBTAP00000053270  --.------...........------.....-----....---------------.......................
ENSBTAP00000054640  --.------...........------.....-----....---------------.......................
ENSBTAP00000012770  LP.QLDG--...........------.....-----....--LEKSFYSFYVCTA.......................
ENSBTAP00000009967  --.------...........------.....-----....---------------.......................
ENSBTAP00000015183  --.------...........------.....-----....---------------.......................
ENSBTAP00000014222  --.------...........------.....-----....---------------.......................
ENSBTAP00000026288  --.------...........------.....-----....---------------.......................
ENSBTAP00000002128  VV.PETLQ-...........------.....-----....---------------.......................
ENSBTAP00000003365  CD.EDAWAV...........CRENFD.....TKKNE....LTRQGFMDL------.......................
ENSBTAP00000053738  LP.RRIFIQ...........LMKRFGl....KTTTK....VNWKQFL--------.......................
ENSBTAP00000009228  --.------...........------.....-----....---------------.......................
ENSBTAP00000026785  --.------...........------.....-----....---------------.......................
ENSBTAP00000002578  --.------...........------.....-----....---------------.......................
ENSBTAP00000000106  --.------...........------.....-----....---------------.......................
ENSBTAP00000028840  --.------...........------.....-----....---------------.......................
ENSBTAP00000053594  LQ.GELSH-...........------.....-----....---------------.......................
ENSBTAP00000055414  ME.KESMK-...........------.....-----....---------------.......................
ENSBTAP00000026698  RS.LEELT-...........------.....-----....---------------.......................
ENSBTAP00000017015  --.------...........------.....-----....---------------.......................
ENSBTAP00000049908  LS.RAQVKK...........LL----.....-----....---------------.......................
ENSBTAP00000021395  --.------...........------.....-----....---------------.......................
ENSBTAP00000007194  LS.AEQAKQ...........LVS---.....-----....---------------.......................
ENSBTAP00000025455  ME.KESMK-...........------.....-----....---------------.......................


                                                                                                    
                                                                                                    
d1df0a1               ..............................................................................
ENSBTAP00000019411  ..............................................................................
ENSBTAP00000036057  ..............................................................................
ENSBTAP00000038404  ..............................................................................
ENSBTAP00000010971  ..............................................................................
ENSBTAP00000019803  ..............................................................................
ENSBTAP00000014038  ..............................................................................
ENSBTAP00000002055  ..............................................................................
ENSBTAP00000049731  ..............................................................................
ENSBTAP00000005577  ..............................................................................
ENSBTAP00000034949  ..............................................................................
ENSBTAP00000017447  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000046644  ..............................................................................
ENSBTAP00000022814  ..............................................................................
ENSBTAP00000019758  ..............................................................................
ENSBTAP00000019321  ..............................................................................
ENSBTAP00000011677  ..............................................................................
ENSBTAP00000011680  ..............................................................................
ENSBTAP00000021742  ..............................................................................
ENSBTAP00000005348  ..............................................................................
ENSBTAP00000016609  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000018403  ..............................................................................
ENSBTAP00000026407  ..............................................................................
ENSBTAP00000052557  ..............................................................................
ENSBTAP00000054167  ..............................................................................
ENSBTAP00000010319  ..............................................................................
ENSBTAP00000041545  ..............................................................................
ENSBTAP00000055204  ..............................................................................
ENSBTAP00000003718  ..............................................................................
ENSBTAP00000011676  ..............................................................................
ENSBTAP00000049395  ..............................................................................
ENSBTAP00000054983  ..............................................................................
ENSBTAP00000052219  ..............................................................................
ENSBTAP00000025402  ..............................................................................
ENSBTAP00000011678  ..............................................................................
ENSBTAP00000000433  ..............................................................................
ENSBTAP00000021491  ..............................................................................
ENSBTAP00000044733  ..............................................................................
ENSBTAP00000010937  ..............................................................................
ENSBTAP00000056439  ..............................................................................
ENSBTAP00000055780  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000034705  ..............................................................................
ENSBTAP00000035936  ..............................................................................
ENSBTAP00000013699  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000011496  ..............................................................................
ENSBTAP00000019111  ..............................................................................
ENSBTAP00000017036  ..............................................................................
ENSBTAP00000003213  ..............................................................................
ENSBTAP00000055444  ..............................................................................
ENSBTAP00000024550  ..............................................................................
ENSBTAP00000015248  ..............................................................................
ENSBTAP00000021328  ..............................................................................
ENSBTAP00000037091  ..............................................................................
ENSBTAP00000029967  ..............................................................................
ENSBTAP00000021449  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000042361  ..............................................................................
ENSBTAP00000016509  ..............................................................................
ENSBTAP00000026714  ..............................................................................
ENSBTAP00000004690  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000013117  ..............................................................................
ENSBTAP00000017574  ..............................................................................
ENSBTAP00000004885  ..............................................................................
ENSBTAP00000008961  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000006283  ..............................................................................
ENSBTAP00000014306  ..............................................................................
ENSBTAP00000053252  ..............................................................................
ENSBTAP00000014304  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000041264  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000017358  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000055296  ..............................................................................
ENSBTAP00000016852  ..............................................................................
ENSBTAP00000036380  ..............................................................................
ENSBTAP00000041719  ..............................................................................
ENSBTAP00000049636  ..............................................................................
ENSBTAP00000024444  ..............................................................................
ENSBTAP00000004556  ..............................................................................
ENSBTAP00000038767  ..............................................................................
ENSBTAP00000031285  ..............................................................................
ENSBTAP00000011457  ..............................................................................
ENSBTAP00000011047  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000037104  ..............................................................................
ENSBTAP00000002672  ..............................................................................
ENSBTAP00000028269  ..............................................................................
ENSBTAP00000016647  ..............................................................................
ENSBTAP00000004536  ..............................................................................
ENSBTAP00000042177  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000050283  ..............................................................................
ENSBTAP00000048539  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000007972  ..............................................................................
ENSBTAP00000040815  ..............................................................................
ENSBTAP00000025661  ..............................................................................
ENSBTAP00000028350  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000021537  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000039155  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000016315  ..............................................................................
ENSBTAP00000021091  ..............................................................................
ENSBTAP00000021618  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000034078  ..............................................................................
ENSBTAP00000006645  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000015802  ..............................................................................
ENSBTAP00000032680  ..............................................................................
ENSBTAP00000055007  ..............................................................................
ENSBTAP00000020148  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000012557  ..............................................................................
ENSBTAP00000011888  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000021603  ..............................................................................
ENSBTAP00000010838  ..............................................................................
ENSBTAP00000014575  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000053698  ..............................................................................
ENSBTAP00000006806  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000044105  ..............................................................................
ENSBTAP00000026904  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000044226  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000042182  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000006275  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000004963  ..............................................................................
ENSBTAP00000023774  ..............................................................................
ENSBTAP00000020395  ..............................................................................
ENSBTAP00000020150  ..............................................................................
ENSBTAP00000025561  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000034009  ..............................................................................
ENSBTAP00000020539  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000017461  ..............................................................................
ENSBTAP00000044096  ..............................................................................
ENSBTAP00000008523  ..............................................................................
ENSBTAP00000035196  ..............................................................................
ENSBTAP00000041997  ..............................................................................
ENSBTAP00000025499  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000002174  ..............................................................................
ENSBTAP00000000589  ..............................................................................
ENSBTAP00000028239  ..............................................................................
ENSBTAP00000014894  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000041966  ..............................................................................
ENSBTAP00000008933  ..............................................................................
ENSBTAP00000056088  ..............................................................................
ENSBTAP00000033794  ..............................................................................
ENSBTAP00000012786  ..............................................................................
ENSBTAP00000030018  ..............................................................................
ENSBTAP00000040233  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000024301  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000015611  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000000847  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000054975  ..............................................................................
ENSBTAP00000046639  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000053164  ..............................................................................
ENSBTAP00000016774  ..............................................................................
ENSBTAP00000022630  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000033974  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000005979  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000053746  ..............................................................................
ENSBTAP00000023221  ..............................................................................
ENSBTAP00000019429  ..............................................................................
ENSBTAP00000052019  ..............................................................................
ENSBTAP00000042244  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000018877  ..............................................................................
ENSBTAP00000053019  ..............................................................................
ENSBTAP00000003073  ..............................................................................
ENSBTAP00000012886  ..............................................................................
ENSBTAP00000044222  ..............................................................................
ENSBTAP00000028499  ..............................................................................
ENSBTAP00000047378  ..............................................................................
ENSBTAP00000009308  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000050406  ..............................................................................
ENSBTAP00000031879  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000001250  ..............................................................................
ENSBTAP00000026035  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000053194  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000033188  ..............................................................................
ENSBTAP00000053548  ..............................................................................
ENSBTAP00000011687  ..............................................................................
ENSBTAP00000007636  gmllaysgvqskkltamqkqlkkhfkegkgltfqevenfftflknindvdtalsfyhmagasldkvtmqqvartvakv
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000009115  ..............................................................................
ENSBTAP00000023873  ..............................................................................
ENSBTAP00000054471  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000025205  ..............................................................................
ENSBTAP00000047882  ..............................................................................
ENSBTAP00000001368  ..............................................................................
ENSBTAP00000029786  ..............................................................................
ENSBTAP00000028993  ..............................................................................
ENSBTAP00000023678  ..............................................................................
ENSBTAP00000034710  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000021074  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000007217  ..............................................................................
ENSBTAP00000029792  ..............................................................................
ENSBTAP00000044088  ewllfftdtenkdvywknvreklsagenisleefksfchfathledfaiamqmfslahrpvrlaefkravkvatgqel
ENSBTAP00000017319  ..............................................................................
ENSBTAP00000044100  ..............................................................................
ENSBTAP00000033594  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000055894  ..............................................................................
ENSBTAP00000015220  ..............................................................................
ENSBTAP00000033613  ..............................................................................
ENSBTAP00000056320  ..............................................................................
ENSBTAP00000025249  ..............................................................................
ENSBTAP00000029159  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000017662  ..............................................................................
ENSBTAP00000012479  ..............................................................................
ENSBTAP00000029886  ..............................................................................
ENSBTAP00000027388  ..............................................................................
ENSBTAP00000039694  wdtlrrntsqalfsdfaeradditnlvtd.................................................
ENSBTAP00000023673  ..............................................................................
ENSBTAP00000041488  ..............................................................................
ENSBTAP00000001452  ..............................................................................
ENSBTAP00000028498  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000020240  ..............................................................................
ENSBTAP00000053650  ..............................................................................
ENSBTAP00000041651  ..............................................................................
ENSBTAP00000005154  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000022068  ..............................................................................
ENSBTAP00000026682  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000027954  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000013601  ..............................................................................
ENSBTAP00000005477  ..............................................................................
ENSBTAP00000055305  ..............................................................................
ENSBTAP00000036054  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000002717  ..............................................................................
ENSBTAP00000036015  ..............................................................................
ENSBTAP00000051638  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000016306  ..............................................................................
ENSBTAP00000013714  ..............................................................................
ENSBTAP00000036550  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000023383  ..............................................................................
ENSBTAP00000027030  ..............................................................................
ENSBTAP00000053270  ..............................................................................
ENSBTAP00000054640  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000009967  ..............................................................................
ENSBTAP00000015183  ..............................................................................
ENSBTAP00000014222  ..............................................................................
ENSBTAP00000026288  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000009228  ..............................................................................
ENSBTAP00000026785  ..............................................................................
ENSBTAP00000002578  ..............................................................................
ENSBTAP00000000106  ..............................................................................
ENSBTAP00000028840  ..............................................................................
ENSBTAP00000053594  ..............................................................................
ENSBTAP00000055414  ..............................................................................
ENSBTAP00000026698  ..............................................................................
ENSBTAP00000017015  ..............................................................................
ENSBTAP00000049908  ..............................................................................
ENSBTAP00000021395  ..............................................................................
ENSBTAP00000007194  ..............................................................................
ENSBTAP00000025455  ..............................................................................


                            160                 170       180                                       
                              |                   |         |                                       
d1df0a1               ......LFKI..FKQL....DP....ENTGTIQLDLISWL-----sfsvl............................
ENSBTAP00000019411  ......--EM..IREA....DI....DGDGQV--NYEEFVQMM--.................................
ENSBTAP00000036057  ......--EM..IREA....DI....DGDGQV--NYEEFVQMM--.................................
ENSBTAP00000038404  ......TEKI..FRQM....DT....NRDGKL--SLEEFIR----g................................
ENSBTAP00000010971  ......TEKI..FRQM....DT....NNDGKL--SLEEFIR----g................................
ENSBTAP00000019803  ......MFRA..FKSL....DK....DGTGQIQVNIQEWLQLT--m................................
ENSBTAP00000014038  ......--KT..IINA....DK....DGDGRI--SFEEFCA----v................................
ENSBTAP00000002055  ......--EM..IREA....DI....DGDGQV--NYEEFVQMM--t................................
ENSBTAP00000049731  ......--EM..IREA....DI....DGDGQV--NYEEFVHMM--t................................
ENSBTAP00000005577  ......TDKI..FRQM....DT....NNDGKL--SLEEFIK----gaksdpsivrllqc...................
ENSBTAP00000034949  ......AEKI..WGFF....GK....KDDDKL--TEKEFIE----g................................
ENSBTAP00000017447  ......----..----....--....-------------------sdenapvfldrlely..................
ENSBTAP00000010858  ......----..----....--....-------------------tgiislck.........................
ENSBTAP00000046644  ......----..----....--....-------------------geengvvspekldl...................
ENSBTAP00000022814  ......VDKI..FSKM....DK....NKDDQI--TLDEFKE----aaksdpsivlllq....................
ENSBTAP00000019758  ......----..----....--....-------------------ikekdidkdl.......................
ENSBTAP00000019321  ......VDKI..FKKM....DQ....DKDDQI--TLEEFKE----aaksdpsivlllqc...................
ENSBTAP00000011677  ......MFRA..FNAF....DK....DGDGIIKLNVLEWLQLTM-y................................
ENSBTAP00000011680  ......MFRA..FNAF....DK....DGDGIIKLNVLEWLQLT--m................................
ENSBTAP00000021742  ......VESF..FQKM....DR....NKDGVV--TIEEFIE----scqkdenimrsmqlfdn................
ENSBTAP00000005348  ......----..----....--....-------------------eedidenll........................
ENSBTAP00000016609  ......----..----....--....-------------------qkqrdprlnevlypplrpsqarlliekyepnkq
ENSBTAP00000012740  ......----..----....--....-------------------ialskg...........................
ENSBTAP00000018403  ......--AM..IREA....DV....DQDGRV--NYEEFVRIL--tq...............................
ENSBTAP00000026407  ......----..----....--....-------------------gkskeeafdaicqlvagkepanvgvtkaktgga
ENSBTAP00000052557  ......--EM..IDEA....DR....DGDGEV--NEDEFLRIM--kk...............................
ENSBTAP00000054167  ......--TF..FQKM....DK....NKDGVV--TIDEFIE----scqkdenimrsmqlf..................
ENSBTAP00000010319  ......--EM..IDEA....DR....DGDGEV--NEQEFLRIM--kkt..............................
ENSBTAP00000041545  ......----..----....--....-------------------cskdgdifnptchply.................
ENSBTAP00000055204  ......LTDI..FRRY....DT....DQDGWIQVSYEQYLSMV--.................................
ENSBTAP00000003718  ......--IF..FQKM....DK....NKDGIV--TLDEFLE----scqeddnimrslqlfq.................
ENSBTAP00000011676  ......LFKL..FRLL....DK....DQNGIVQLSLAEWLCC---v................................
ENSBTAP00000049395  ......----..----....--....-------------------sadgsafdlahrrvy..................
ENSBTAP00000054983  ......----..----....--....-------------------elakkrfkdksaeeavrevhkliegkapiisgv
ENSBTAP00000052219  ......LTDS..FRRR....DT....AQQGVVNFPYDDFIQCVM-s................................
ENSBTAP00000025402  ......----..----....--....-------------------qrdsrlnsllfpparpdqvqglidkyepsginv
ENSBTAP00000011678  ......MFRF..FKTL....DT....DLDGVVTFDLFKWLQL---tm...............................
ENSBTAP00000000433  ......----..----....--....-------------------pattgvtkattvggvsrltdtskytgthker..
ENSBTAP00000021491  ......--EM..LDEA....DH....DGDGEI--NKEEFLKMM--qkt..............................
ENSBTAP00000044733  ......LFRI..FKQL....DP....ENTGMIQLDLISWL-----sf...............................
ENSBTAP00000010937  ......----..----....--....-------------------rspacdifnplhhevy.................
ENSBTAP00000056439  ......----..----....--....-------------------rspacdifnplhhevy.................
ENSBTAP00000055780  ......--EL..MKDG....DK....NNDGRI--DYDEFLEFM--kg...............................
ENSBTAP00000038002  ......----..----....--....-------------------sfqtgyyiedtvredvvclsdvscyfslleggr
ENSBTAP00000034705  ......----..----....--....-------------------egaaldlahtrvf....................
ENSBTAP00000035936  ......VDRI..FLLV....DE....NGDGQL--SLNEFVE----garrdkwvmkmlqmdln................
ENSBTAP00000013699  ......LTEA..FREK....DT....AVQGSVRLSFEDFVTM---t................................
ENSBTAP00000002564  ......----..----....--....-------------------rgilvnvplcvdmslnwllnvfdrpsgrsgkmr
ENSBTAP00000011496  ......--RI..FAMM....DK....NADGKL--TLQEFQE----gskadpsivqalslydg................
ENSBTAP00000019111  ......--AM..IEEF....DK....DGDGEI--NQEEFIAIM--t................................
ENSBTAP00000017036  ......--TV..FSKI....DV....NGDGEL--SLEEFMEG---vqkdqmlldtlt.....................
ENSBTAP00000003213  ......----..----....--....-------------------rspagdifnpehrlv..................
ENSBTAP00000055444  ......----..----....--....-------------------rspagdifnpehrlv..................
ENSBTAP00000024550  ......LTDF..FRRR....DH....LQQGVVSFVYDDFLQGT--m................................
ENSBTAP00000015248  ......--EM..YREA....PI....DKKGNF--NYVEFTRIL--kh...............................
ENSBTAP00000021328  ......--EL..YREA....PI....DKKGNF--NYIEFTRIL--kh...............................
ENSBTAP00000037091  ......--EL..YREA....PI....DKKGNF--NYIEFTRIL--kh...............................
ENSBTAP00000029967  ......--EI..LRDI....DL....NGDGLV--DFEEFVRMM--.................................
ENSBTAP00000021449  ......--EV..VQEA....DI....NGDGTV--DFEEFVKMM--s................................
ENSBTAP00000053176  ......----..----....--....-------------------ddftthlfmsfsnkfphsspmvkskpallssgl
ENSBTAP00000042361  ......--EI..IRDV....DL....NGDGRV--DFEEFVRMM--.................................
ENSBTAP00000016509  ......--RI..FLLV....DE....NGDGQL--SLNEFVE----garrdkwvmkmlqmdln................
ENSBTAP00000026714  ......--EI..IRDV....DL....NGDGRV--DFEEFVRMM--.................................
ENSBTAP00000004690  ......MFKTayFLTM....DP....ENTGQISLDLNQWLQIT--m................................
ENSBTAP00000010858  ......----..----....--....-------------------prqlgevasfggsniepsvrscfqfannkpeie
ENSBTAP00000013117  ......----..----....--....-------------------yifdpehkkvc......................
ENSBTAP00000017574  ......----..----....--....-------------------secllfdnkcdhvy...................
ENSBTAP00000004885  ......--LI..LQSI....DA....DGTMTV--DWNEWRDYF--lfnpvtdieeiirfwkhstgidigdsltipdef
ENSBTAP00000008961  ......----..----....--....-------------------lfqpwssllrnwnslav................
ENSBTAP00000028063  ......--FM..IAAY....DS....EGRGKL-------------tvfsvkamlatmcgg..................
ENSBTAP00000012740  ......----..----....--....-------------------pqsmvwlpvlhrvaaaet...............
ENSBTAP00000006283  ......--EM..LQEV....DL....NGDGTV--DFNEFVMML--sr...............................
ENSBTAP00000014306  ......----..----....--....-------------------l................................
ENSBTAP00000053252  ......----..----....--....-------------------ecnifdpeqskv.....................
ENSBTAP00000014304  ......----..----....--....-------------------l................................
ENSBTAP00000045669  ......----..----....--....-------------------avkmalatlcgg.....................
ENSBTAP00000041264  ......----..----....--....-------------------wptllknwqllav....................
ENSBTAP00000006711  ......----..----....--....-------------------vdlpqplsthlflafsqkprqktpehpkegasn
ENSBTAP00000017358  ......----..----....--....-------------------lfqpwgsilrnwnflav................
ENSBTAP00000053274  ......----..----....--....-------------------avkmalatlcgg.....................
ENSBTAP00000055296  ......----..----....--....-------------------lfqpwgsilrnwnflav................
ENSBTAP00000016852  ......--KF..LDNF....DSpy..DKDGVV--TPEEFMNY---yagvsasidtdvyfivmmrtaw...........
ENSBTAP00000036380  ......--DL..FREA....GI....EPNGKV--KYDEFIQ----kl...............................
ENSBTAP00000041719  ......----..----....--....-------------------l................................
ENSBTAP00000049636  ......----..----....--....-------------------.................................
ENSBTAP00000024444  ......--QM..FAAF....PP....DVTGNL--DYKNLVHII--thg..............................
ENSBTAP00000004556  ......----..----....--....-------------------kpgglpcqne.......................
ENSBTAP00000038767  ......--RT..IQEA....DQ....DGDSAI--SFTEFVKVL--ekvdveq..........................
ENSBTAP00000031285  ......----..----....--....-------------------rekppclae........................
ENSBTAP00000011457  ......--IT..LKKM....DH....DHDGKL--SFADYEQA---vreetllleafgpclpdpks.............
ENSBTAP00000011047  ......----..----....--....-------------------.................................
ENSBTAP00000002564  ......----..----....--....-------------------rqlgevaafggsnvepsvrscfrfstgkpviea
ENSBTAP00000037104  ......--QM..FAAF....PP....DVCGNL--DYRNLCYVI--thg..............................
ENSBTAP00000002672  ......--QM..FALT....PM....DLAGNI--DYKSLCYII--thg..............................
ENSBTAP00000028269  ......--NM..WAAF....PP....DVGGNV--DYKNICYVI--thg..............................
ENSBTAP00000016647  ......--RT..VQEA....DE....DGDGAV--SFLEFAK----slekmnieqkm......................
ENSBTAP00000004536  ......--KI..LHSM....DR....DGTMTI--DWQEWRDHF--llhslenvedvlyfwkhs...............
ENSBTAP00000042177  ......----..----....--....-------------------atreevkad........................
ENSBTAP00000028063  ......----..----....--....-------------------vfegpsfgytehsvrtcfpqqkkimlnmfldtm
ENSBTAP00000050283  ......----..----....--....-------------------.................................
ENSBTAP00000048539  ......YAKL..FSS-....--....-------------------yldl.............................
ENSBTAP00000045669  ......----..----....--....-------------------avfegpsfgyteqsarscfsqqkkvtlngfldt
ENSBTAP00000007972  ......----..SASM....D-....--------TDEEFVAMM--tsa..............................
ENSBTAP00000040815  ......----..----....--....-------------------gvskeg...........................
ENSBTAP00000025661  ......YAKI..FT--....--....-------------------tyldlqt..........................
ENSBTAP00000028350  ......--NI..LEES....DI....DRDGTI--NLSEFQHVI--srspdfassfki.....................
ENSBTAP00000053274  ......----..----....--....-------------------avfegpsfgyteqsarscfsqqkkvtlngfldt
ENSBTAP00000021537  ......--KV..LDEA....DG....DHDGRL--SLEDFQNMI--lrapdflstfhi.....................
ENSBTAP00000055481  ......----..----....--....-------------------idvamsgqplppvlppeyippsfr.........
ENSBTAP00000039155  ......--EM..IRAA....HM....DADGQV--NCEEFMHLL--v................................
ENSBTAP00000029333  ......----..----....--....-------------------idvamsgqplppvlppeyippsfr.........
ENSBTAP00000016315  ......----..----....--....-------------------livarkngyplpeglpptlqpey..........
ENSBTAP00000021091  ......MEDV..FQNL....TQ....DGKGI--------------y................................
ENSBTAP00000021618  ......--SM..FRES....GF....QDKQEL--TWEDFHFML--rdhdselrftqlcv...................
ENSBTAP00000055520  ......----..----....--....-------------------klapaaaalitlsg...................
ENSBTAP00000055624  ......----..----....--....-------------------klapaaaalitlsg...................
ENSBTAP00000016319  ......----..----....--....-------------------lvvarkngydlpeklpeslmpkl..........
ENSBTAP00000034078  ......----..----....--....-------------------.................................
ENSBTAP00000006645  ......--HV..LNES....DL....DNDNML--SFSEFEHAM--akspdfmnsfrihfw..................
ENSBTAP00000021909  ......--HL..VYES....DQ....NKDGKL--TKEEIV-----dkydlfvgsqatdfgeal...............
ENSBTAP00000001426  ......--TI..LRMF....DL....NGDGKL--GLSEMSR----ll...............................
ENSBTAP00000015802  ......--KI..LKSM....DK....NGTMTI--DWNEWRDY---hllhpvenipeiilywkhs..............
ENSBTAP00000032680  ......--KI..LKSM....DK....NGTMTI--DWNEWRDY---hllhpvenipeiilywkhs..............
ENSBTAP00000055007  ......----..----....--....-------------------.................................
ENSBTAP00000020148  ......----..----....--....-------------------glaiachesfiksa...................
ENSBTAP00000052345  ......----..----....--....-------------------linqklikgidpphiltpemipp..........
ENSBTAP00000029334  ......----..----....--....-------------------ltdmakagqplplalppelvppsfr........
ENSBTAP00000052345  ......----..----....--....-------------------lvycalekepvpmslppalvppskr........
ENSBTAP00000056127  ......--HL..VYES....DK....NKDEKL--TKEEIL-----dnwnmfvgsqatnygedl...............
ENSBTAP00000012557  ......--EL..AERM....DL....NKDGSI--DFNEFLKAF--yv...............................
ENSBTAP00000011888  ......--AL..FESA....DK....DCSGTI--TFEELRD----elqrfpgvlenl.....................
ENSBTAP00000017060  ......----..----....--....-------------------lvyralekepvpsvlppslippskr........
ENSBTAP00000031854  ......LCQM..LDLV....KP....ASDGKI--TLRDLKR----crmah............................
ENSBTAP00000031823  ......--HL..LHES....DT....DKDGRL--SKAEI------lgnwnmfvgsqatnygedl..............
ENSBTAP00000021603  ......VESM..FRES....GF....QDKQEL--TWEDFHFML--rdhdselrrtqlc....................
ENSBTAP00000010838  ......----..----....--....-------------------diatdyhnhshgaqlc.................
ENSBTAP00000014575  ......--KV..IEEA....DL....DGDGKL--GFADFEDMI--akapdflr.........................
ENSBTAP00000011215  ......LCQM..LDLV....KP....ASDGKI--TLRDLKR----crmah............................
ENSBTAP00000053698  ......----..----....--....-------------------nii..............................
ENSBTAP00000006806  ......----..----....--....-------------------altvacnnffw......................
ENSBTAP00000029334  ......----..----....--....-------------------liklklqgqqlpvvlppimkqpp..........
ENSBTAP00000044105  ......----..----....--....-------------------diatdyhnhshgaqlc.................
ENSBTAP00000026904  ......----..----....--....-------------------altvacndyfveql...................
ENSBTAP00000017060  ......----..----....--....-------------------qkvskgidppqvlspdmvppser..........
ENSBTAP00000055520  ......----..----....--....-------------------lgarmtrrvlrnlltdlqqiptvvgesralcsv
ENSBTAP00000044226  ......----..----....--....-------------------altvacnnffw......................
ENSBTAP00000055624  ......----..----....--....-------------------lgarmtrrvlrnlltdlqqiptvvgesralcsv
ENSBTAP00000042182  ......VFRY..CSQH....LD....GGEGVVCLTHRQWM-----q................................
ENSBTAP00000010796  ......--HI..LEYY....DK....TLSSKI--SYNDFLRA---f................................
ENSBTAP00000021174  ......--LM..LKLF....DS....NNDGKL--ELTEMARL---lp...............................
ENSBTAP00000006275  ......----..----....--....-------------------mittacheff.......................
ENSBTAP00000020950  ......--HL..IDEM....DL....NSDRKL--SEEEIL-----enqdlfltseatdygrqlhd.............
ENSBTAP00000053738  ......--HI..LEYY....DK....TLSSKI--SYNDFLRA---f................................
ENSBTAP00000004963  ......----..----....--....-------------------hqqsp............................
ENSBTAP00000023774  ......----..----....--....-------------------iim..............................
ENSBTAP00000020395  ......----..----....--....-------------------ycvshmkpyvdgkgrelptafdyvef.......
ENSBTAP00000020150  ......----..----....--....-------------------gltiacndyfvv.....................
ENSBTAP00000025561  ......----..----....--....-------------------effeg............................
ENSBTAP00000053738  ......--KL..WMRY....DS....EGRGHI--TYQEFLQ----k................................
ENSBTAP00000034009  ......----..----....--....-------------------rvlktahidihk.....................
ENSBTAP00000020539  ......--DL..ARSI....DF....NKDGHI--DINEFLEA---frl..............................
ENSBTAP00000020778  ......--QM..IAIA....DE....NQNHYL--EPEEVL-----kysefftgsklvdyar.................
ENSBTAP00000017461  ......----..----....--....-------------------evfsd............................
ENSBTAP00000044096  ......----..----....--....-------------------rltvasheemhntap..................
ENSBTAP00000008523  ......----..----....--....-------------------rltvasheemhntap..................
ENSBTAP00000035196  ......----..----....--....-------------------sqwtl............................
ENSBTAP00000041997  ......----..----....--....-------------------likvkleghelpnelpahlvppskr........
ENSBTAP00000025499  ......--TL..LAAG....DK....DGDGKI--GADEFSTL---v................................
ENSBTAP00000055481  ......----..----....--....-------------------lklqgyqlpsalppvmkqq..............
ENSBTAP00000002174  ......----..----....--....-------------------likvkleghelpadlpphlvppskr........
ENSBTAP00000000589  ......----..----....--....-------------------litimcndffq......................
ENSBTAP00000028239  ......----..----....--....-------------------lieakleghglptnlprrlvppskr........
ENSBTAP00000014894  ......----..----....--....-------------------ppdqaeyciarm.....................
ENSBTAP00000026544  ......--IL..LRHC....DV....NKDGKI--QKSELAL----cl...............................
ENSBTAP00000029333  ......----..----....--....-------------------lklqgyqlpsalppvmkqq..............
ENSBTAP00000041966  ......MAKA..FQNL....SK....DGKGLY-LTEMEWMNLV--m................................
ENSBTAP00000008933  ......----..----....--....-------------------hlikiklsgyelpsslpphlvppshr.......
ENSBTAP00000056088  ......----..----....--....-------------------rvlktah..........................
ENSBTAP00000033794  ......----..----....--....-------------------dyhlqyhrqlcahyc..................
ENSBTAP00000012786  ......----..----....--....-------------------lppdqaqycikrmp...................
ENSBTAP00000030018  ......----..----....--....-------------------paeqaeycirrm.....................
ENSBTAP00000040233  ......----..----....--....-------------------nl...............................
ENSBTAP00000003365  ......--AI..INLA....DV....NADGKF--DYIKFCKL---yma..............................
ENSBTAP00000053176  ......LHEM..MEEI....DY....DHDGTV--SLEEWIQ----g................................
ENSBTAP00000024301  ......----..----....--....-------------------lppdqa...........................
ENSBTAP00000022292  ......----..----....--....-------------------qe...............................
ENSBTAP00000015611  ......----..----....--....-------------------klamacnkv........................
ENSBTAP00000012770  ......----..----....--....-------------------gqdpvsfqdvkdeifdmvkpkdplkislqdlin
ENSBTAP00000000847  ......----..----....--....-------------------cmayndffle.......................
ENSBTAP00000053738  ......----..----....--....-------------------nl...............................
ENSBTAP00000054975  ......----..----....--....-------------------v................................
ENSBTAP00000046639  ......----..----....--....-------------------dyy..............................
ENSBTAP00000052345  ......----..----....--....-------------------lvacaqnglevslsslnlavppprfhd......
ENSBTAP00000053164  ......--QL..FEYC....DV....DKDGLI--NYLEFANFL--twkdktplkeyeekvlikgrkadcanpaeanve
ENSBTAP00000016774  ......----..----....--....-------------------kvgleaheeihk.....................
ENSBTAP00000022630  ......----..----....--....-------------------k................................
ENSBTAP00000010796  ......--RL..WEEM....PV....NSKGRL--RYLDFL-----ssf..............................
ENSBTAP00000021909  ......----..----....--....-------------------.................................
ENSBTAP00000033974  ......--QM..MKEA....DE....NGDGTL--NYE--------a................................
ENSBTAP00000006711  ......--EM..LQGM....DY....DRDGFV--SLEEWVH----ggmttipllvllgmddsg...............
ENSBTAP00000010796  ......----..----....--....-------------------ave..............................
ENSBTAP00000004912  ......----..----....--....-------------------le...............................
ENSBTAP00000005979  ......----..----....--....-------------------paapwgphlpstvrtkagrlplhgylcqwtl..
ENSBTAP00000053738  ......--RL..WEEM....PV....NSKGRL--RYLDFL-----ssf..............................
ENSBTAP00000053746  ......----..----....--....-------------------iadgammeaasvcvgqmepdqvyegitfddflk
ENSBTAP00000023221  ......REHV..MNEV....DT....NKDRLV--TLDEFLKA---t................................
ENSBTAP00000019429  ......----..----....--....-------------------kaa..............................
ENSBTAP00000052019  ......----..----....--....-------------------qlaqacyh.........................
ENSBTAP00000042244  ......----..----....--....-------------------kaaagelqe........................
ENSBTAP00000053738  ......----..----....--....-------------------gi...............................
ENSBTAP00000018877  ......----..----....--....-------------------gitspianli.......................
ENSBTAP00000053019  ......----..----....--....-------------------i................................
ENSBTAP00000003073  ......REHV..MKNV....DT....NQDRLV--TLEEFLA----st...............................
ENSBTAP00000012886  ......----..----....--....-------------------iqk..............................
ENSBTAP00000044222  ......----..----....--....-------------------clciycheyfk......................
ENSBTAP00000028499  ......----..----....--....-------------------elakeirk.........................
ENSBTAP00000047378  ......--DL..FNKL....DQ....DGDGRV--SLEELQL----glf..............................
ENSBTAP00000009308  ......----..----....--....-------------------k................................
ENSBTAP00000017060  ......----..----....--....-------------------lvacaqsghevtlsnlnlnmpppkfhd......
ENSBTAP00000050406  ......----..----....--....-------------------inrkegicalggtselssegtqhsyseeekyaf
ENSBTAP00000031879  ......----..----....--....-------------------inrkegicalggtselssegtqhsyseeekyaf
ENSBTAP00000031854  ......----..----....--....-------------------k................................
ENSBTAP00000001250  ......VTDL..FRAI....DQ....ERKGRI--AFADFKRF---aeanpdfaeeylyp...................
ENSBTAP00000026035  ......----..----....--....-------------------kvaqacfet........................
ENSBTAP00000011215  ......----..----....--....-------------------k................................
ENSBTAP00000002128  ......----..----....--....-------------------teltev...........................
ENSBTAP00000053194  ......----..----....--....-------------------peq..............................
ENSBTAP00000056127  ......----..----....--....-------------------h................................
ENSBTAP00000033188  ......----..----....--....-------------------pnkd.............................
ENSBTAP00000053548  ......----..----....--....-------------------pnkd.............................
ENSBTAP00000011687  ......--DL..YYNF....DI....TGDRKL-LNYKEFKL----f................................
ENSBTAP00000007636  elsdhvCDVV..FALF....DC....DGNGEL--SNKEFVSIM--k................................
ENSBTAP00000020950  ......--KR..FEKA....NQ....DSGPGL--NLEEFI-----af...............................
ENSBTAP00000009115  ......----..----....--....-------------------td...............................
ENSBTAP00000023873  ......----..----....--....-------------------.................................
ENSBTAP00000054471  ......--DV..FDTL....DA....DGNGFL--TPEEFTT----gfshfffsqnn......................
ENSBTAP00000039694  ......--TV..FKIF....DV....DKDDQL--SYKEFIGIM--k................................
ENSBTAP00000025205  ......--DV..FDTL....DA....DGNGFL--TPEEFTT----gfshfffsqnn......................
ENSBTAP00000047882  ......--GV..LRDD....DK....NNDGYI--DYAEFA-----ks...............................
ENSBTAP00000001368  ......----..----....--....-------------------lrss.............................
ENSBTAP00000029786  ......----..----....--....-------------------h................................
ENSBTAP00000028993  ......----..----....--....-------------------f................................
ENSBTAP00000023678  ......----..----....--....-------------------fs...............................
ENSBTAP00000034710  ......----..----....--....-------------------lgkvrnswaydpqglqtlflemlfklmsl....
ENSBTAP00000031823  ......----..----....--....-------------------h................................
ENSBTAP00000038002  ......LQEM..MKEI....DY....DGSGSV--SLAEWLR----a................................
ENSBTAP00000021074  ......----..----....--....-------------------sflnvcyldtqsl....................
ENSBTAP00000026544  ......----..----....--....-------------------flh..............................
ENSBTAP00000007217  ......--EM..YSAIka..DP....DGDGVL--SLQEFSNM---dlrdfhkymrshraessqlvrnshhtwly....
ENSBTAP00000029792  ......----..----....--....-------------------lh...............................
ENSBTAP00000044088  ..snniLDTV..FKIF....DL....DGDECL--SHEEFLGV---lk...............................
ENSBTAP00000017319  ......----..----....--....-------------------svtim............................
ENSBTAP00000044100  ......----..----....--....-------------------ksqlhckmgpgfvhnf.................
ENSBTAP00000033594  ......----..----....--....-------------------t................................
ENSBTAP00000026766  ......----..----....--....-------------------aerqkycfllvqvnk..................
ENSBTAP00000055894  ......----..----....--....-------------------l................................
ENSBTAP00000015220  ......----..----....--....-------------------.................................
ENSBTAP00000033613  ......--NM..FTNQ....DR....NGDGKV--TAEEF------k................................
ENSBTAP00000056320  ......MCQM..LDLV....KP....QTEGRI--TLQDLKR----cklanvffdtffn....................
ENSBTAP00000025249  ......----..----....--....-------------------mdkdnfa..........................
ENSBTAP00000029159  ......----..----....--....-------------------ra...............................
ENSBTAP00000044088  ......--TV..FKIF....DL....DGDECL--SHEEFLGV---lkn..............................
ENSBTAP00000016319  ......----..----....--....-------------------sgfplrvesintvkdlp................
ENSBTAP00000017662  ......----..----....--....-------------------dtrrf............................
ENSBTAP00000012479  ......----..----....--....-------------------l................................
ENSBTAP00000029886  ......----..----....--....-------------------l................................
ENSBTAP00000027388  ......----..----....--....-------------------l................................
ENSBTAP00000039694  ......TTLL..VHFF....GK....KGKAEL--NFEDFYRFM--dn...............................
ENSBTAP00000023673  ......--AV..FESL....DQ....AHTGFL--TAREFCL----gl...............................
ENSBTAP00000041488  ......--AV..FESL....DQ....AHTGFL--TAREFCL----gl...............................
ENSBTAP00000001452  ......----..----....--....-------------------vy...............................
ENSBTAP00000028498  ......----..----....--....-------------------ge...............................
ENSBTAP00000001426  ......----..----....--....-------------------y................................
ENSBTAP00000020240  ......----..----....--....-------------------rf...............................
ENSBTAP00000053650  ......----..----....--....-------------------rf...............................
ENSBTAP00000041651  ......--KV..LETQ....DL....NGDGLM--TPAEL------vnf..............................
ENSBTAP00000005154  ......----..----....--....-------------------sehlg............................
ENSBTAP00000021174  ......----..----....--....-------------------dinniptykksi.....................
ENSBTAP00000022068  ......----..----....--....-------------------eairngdpds.......................
ENSBTAP00000026682  ......----..----....--....-------------------qm...............................
ENSBTAP00000007636  ......--VV..FALF....DC....DGNGEL--SNKEFVSIM--k................................
ENSBTAP00000027954  ......----..----....--....-------------------.................................
ENSBTAP00000020778  ......----..----....--....-------------------v................................
ENSBTAP00000013601  ......----..----....--....-------------------miaatqrgv........................
ENSBTAP00000005477  ......----..----....--....-------------------fatlfglnpe.......................
ENSBTAP00000055305  ......----..----....--....-------------------rf...............................
ENSBTAP00000036054  ......----..----....--....-------------------rf...............................
ENSBTAP00000004912  ......MELI..RKIY....STlagnRKDVEV--TKEEFV-----laaqkfgqvtpmevdilfqladl..........
ENSBTAP00000022292  ......MELV..RKIYstlaGT....RKDVEV--TKEEF------a................................
ENSBTAP00000002717  ......----..----....--....-------------------qdlnkvrermtkfiddtmretaepflfvdeflt
ENSBTAP00000036015  ......----..----....--....-------------------veegafvkehfdelcwtltakknyqvdsngnsm
ENSBTAP00000051638  ......----..----....--....-------------------lyfsqlh..........................
ENSBTAP00000026766  ......AF--..----....--....-------------------tfsrwlls.........................
ENSBTAP00000053738  ......----..----....--....-------------------vennk............................
ENSBTAP00000016306  ......----..----....--....-------------------ssvnhs...........................
ENSBTAP00000013714  ......----..----....--....-------------------llgpflqe.........................
ENSBTAP00000036550  ......----..----....--....-------------------lh...............................
ENSBTAP00000053738  ......----..----....--....-------------------a................................
ENSBTAP00000023383  ......----..----....--....-------------------mdlpfleasalragerpelcrvslpefqqflle
ENSBTAP00000027030  ......----..----....--....-------------------enellv...........................
ENSBTAP00000053270  ......----..----....--....-------------------enellv...........................
ENSBTAP00000054640  ......----..----....--....-------------------enellv...........................
ENSBTAP00000012770  ......VRKF..FFFL....DP....LRTGKI--KI---------qdilacsfld.......................
ENSBTAP00000009967  ......----..----....--....-------------------glwftgd..........................
ENSBTAP00000015183  ......----..----....--....-------------------tlyekd...........................
ENSBTAP00000014222  ......----..----....--....-------------------etqqkl...........................
ENSBTAP00000026288  ......----..----....--....-------------------rylsk............................
ENSBTAP00000002128  ......--EV..IKYA....DI....NSNQMV--DIGD-------iift.............................
ENSBTAP00000003365  ......----..----....--....-------------------nl...............................
ENSBTAP00000053738  ......----..----....--....-------------------ts...............................
ENSBTAP00000009228  ......----..----....--....-------------------rf...............................
ENSBTAP00000026785  ......----..----....--....-------------------lvdkedvhistsqvaeiva..............
ENSBTAP00000002578  ......----..----....--....-------------------nrmcwtlcvkknltknplfiteedafkiwvifn
ENSBTAP00000000106  ......----..----....--....-------------------l................................
ENSBTAP00000028840  ......----..----....--....-------------------slgkhnsitmdnlastykqwsla..........
ENSBTAP00000053594  ......----..----....--....-------------------iirql............................
ENSBTAP00000055414  ......----..----....--....-------------------k................................
ENSBTAP00000026698  ......----..----....--....-------------------rlafelf..........................
ENSBTAP00000017015  ......----..----....--....-------------------heslll...........................
ENSBTAP00000049908  ......----..----....--....-------------------nkv..............................
ENSBTAP00000021395  ......----..----....--....-------------------rnl..............................
ENSBTAP00000007194  ......----..----....--....-------------------ra...............................
ENSBTAP00000025455  ......----..----....--....-------------------k................................


                                                                                                    
                                                                                                    
d1df0a1               ..............................................................................
ENSBTAP00000019411  ..............................................................................
ENSBTAP00000036057  ..............................................................................
ENSBTAP00000038404  ..............................................................................
ENSBTAP00000010971  ..............................................................................
ENSBTAP00000019803  ..............................................................................
ENSBTAP00000014038  ..............................................................................
ENSBTAP00000002055  ..............................................................................
ENSBTAP00000049731  ..............................................................................
ENSBTAP00000005577  ..............................................................................
ENSBTAP00000034949  ..............................................................................
ENSBTAP00000017447  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000046644  ..............................................................................
ENSBTAP00000022814  ..............................................................................
ENSBTAP00000019758  ..............................................................................
ENSBTAP00000019321  ..............................................................................
ENSBTAP00000011677  ..............................................................................
ENSBTAP00000011680  ..............................................................................
ENSBTAP00000021742  ..............................................................................
ENSBTAP00000005348  ..............................................................................
ENSBTAP00000016609  flerdqmsmegfsrylggeengilpleald................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000018403  ..............................................................................
ENSBTAP00000026407  verltdtskytgshker.............................................................
ENSBTAP00000052557  ..............................................................................
ENSBTAP00000054167  ..............................................................................
ENSBTAP00000010319  ..............................................................................
ENSBTAP00000041545  ..............................................................................
ENSBTAP00000055204  ..............................................................................
ENSBTAP00000003718  ..............................................................................
ENSBTAP00000011676  ..............................................................................
ENSBTAP00000049395  ..............................................................................
ENSBTAP00000054983  tkaissptvsrltdtskftgshker.....................................................
ENSBTAP00000052219  ..............................................................................
ENSBTAP00000025402  qrgqlspegmvwflcgpensvlaqdkl...................................................
ENSBTAP00000011678  ..............................................................................
ENSBTAP00000000433  ..............................................................................
ENSBTAP00000021491  ..............................................................................
ENSBTAP00000044733  ..............................................................................
ENSBTAP00000010937  ..............................................................................
ENSBTAP00000056439  ..............................................................................
ENSBTAP00000055780  ..............................................................................
ENSBTAP00000038002  pedkleft......................................................................
ENSBTAP00000034705  ..............................................................................
ENSBTAP00000035936  ..............................................................................
ENSBTAP00000013699  ..............................................................................
ENSBTAP00000002564  alsfktgiaclcg.................................................................
ENSBTAP00000011496  ..............................................................................
ENSBTAP00000019111  ..............................................................................
ENSBTAP00000017036  ..............................................................................
ENSBTAP00000003213  ..............................................................................
ENSBTAP00000055444  ..............................................................................
ENSBTAP00000024550  ..............................................................................
ENSBTAP00000015248  ..............................................................................
ENSBTAP00000021328  ..............................................................................
ENSBTAP00000037091  ..............................................................................
ENSBTAP00000029967  ..............................................................................
ENSBTAP00000021449  ..............................................................................
ENSBTAP00000053176  kmnkgaitpprtspantcspevihlkdivcylsllergrpedklefm...............................
ENSBTAP00000042361  ..............................................................................
ENSBTAP00000016509  ..............................................................................
ENSBTAP00000026714  ..............................................................................
ENSBTAP00000004690  ..............................................................................
ENSBTAP00000010858  aalfldwmrlepqsmvwlpvlhrvaaaet.................................................
ENSBTAP00000013117  ..............................................................................
ENSBTAP00000017574  ..............................................................................
ENSBTAP00000004885  te............................................................................
ENSBTAP00000008961  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000006283  ..............................................................................
ENSBTAP00000014306  ..............................................................................
ENSBTAP00000053252  ..............................................................................
ENSBTAP00000014304  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000041264  ..............................................................................
ENSBTAP00000006711  seasgadsdiqnadnaakadeacapdmetkitekqvpaknqaaatpvgnlvapssgsespivylkdvvcylsllesgr
ENSBTAP00000017358  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000055296  ..............................................................................
ENSBTAP00000016852  ..............................................................................
ENSBTAP00000036380  ..............................................................................
ENSBTAP00000041719  ..............................................................................
ENSBTAP00000049636  ..............................................................................
ENSBTAP00000024444  ..............................................................................
ENSBTAP00000004556  ..............................................................................
ENSBTAP00000038767  ..............................................................................
ENSBTAP00000031285  ..............................................................................
ENSBTAP00000011457  ..............................................................................
ENSBTAP00000011047  ..............................................................................
ENSBTAP00000002564  sqflewvnlepqsmvwlavlhrvtiae...................................................
ENSBTAP00000037104  ..............................................................................
ENSBTAP00000002672  ..............................................................................
ENSBTAP00000028269  ..............................................................................
ENSBTAP00000016647  ..............................................................................
ENSBTAP00000004536  ..............................................................................
ENSBTAP00000042177  ..............................................................................
ENSBTAP00000028063  madpppqclvwlplmhrlahven.......................................................
ENSBTAP00000050283  ..............................................................................
ENSBTAP00000048539  ..............................................................................
ENSBTAP00000045669  lmsdpppqclvwlpllhrlanven......................................................
ENSBTAP00000007972  ..............................................................................
ENSBTAP00000040815  ..............................................................................
ENSBTAP00000025661  ..............................................................................
ENSBTAP00000028350  ..............................................................................
ENSBTAP00000053274  lmsdpppqclvwlpllhrlanven......................................................
ENSBTAP00000021537  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000039155  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000016315  ..............................................................................
ENSBTAP00000021091  ..............................................................................
ENSBTAP00000021618  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000034078  ..............................................................................
ENSBTAP00000006645  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000015802  ..............................................................................
ENSBTAP00000032680  ..............................................................................
ENSBTAP00000055007  ..............................................................................
ENSBTAP00000020148  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000012557  ..............................................................................
ENSBTAP00000011888  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000021603  ..............................................................................
ENSBTAP00000010838  ..............................................................................
ENSBTAP00000014575  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000053698  ..............................................................................
ENSBTAP00000006806  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000044105  ..............................................................................
ENSBTAP00000026904  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000055520  esatrscfqgvlspvikeekflswlqseppillwiptcyrlsatem................................
ENSBTAP00000044226  ..............................................................................
ENSBTAP00000055624  esatrscfqgvlspvikeekflswlqseppillwiptcyrlsatem................................
ENSBTAP00000042182  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000006275  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000004963  ..............................................................................
ENSBTAP00000023774  ..............................................................................
ENSBTAP00000020395  ..............................................................................
ENSBTAP00000020150  ..............................................................................
ENSBTAP00000025561  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000034009  ..............................................................................
ENSBTAP00000020539  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000017461  ..............................................................................
ENSBTAP00000044096  ..............................................................................
ENSBTAP00000008523  ..............................................................................
ENSBTAP00000035196  ..............................................................................
ENSBTAP00000041997  ..............................................................................
ENSBTAP00000025499  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000002174  ..............................................................................
ENSBTAP00000000589  ..............................................................................
ENSBTAP00000028239  ..............................................................................
ENSBTAP00000014894  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000041966  ..............................................................................
ENSBTAP00000008933  ..............................................................................
ENSBTAP00000056088  ..............................................................................
ENSBTAP00000033794  ..............................................................................
ENSBTAP00000012786  ..............................................................................
ENSBTAP00000030018  ..............................................................................
ENSBTAP00000040233  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000024301  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000015611  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000000847  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000054975  ..............................................................................
ENSBTAP00000046639  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000053164  esepalllkpedivlkepgssektlrtllrpsdkvsnhykttsseisavvgavpstcyptygvptirsdipaplirrv
ENSBTAP00000016774  ..............................................................................
ENSBTAP00000022630  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000033974  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000005979  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000053746  iwqgidietkmhvrf...............................................................
ENSBTAP00000023221  ..............................................................................
ENSBTAP00000019429  ..............................................................................
ENSBTAP00000052019  ..............................................................................
ENSBTAP00000042244  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000018877  ..............................................................................
ENSBTAP00000053019  ..............................................................................
ENSBTAP00000003073  ..............................................................................
ENSBTAP00000012886  ..............................................................................
ENSBTAP00000044222  ..............................................................................
ENSBTAP00000028499  ..............................................................................
ENSBTAP00000047378  ..............................................................................
ENSBTAP00000009308  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000050406  vnwinkalendpd.................................................................
ENSBTAP00000031879  vnwinkalendpd.................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000001250  ..............................................................................
ENSBTAP00000026035  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000053194  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000033188  ..............................................................................
ENSBTAP00000053548  ..............................................................................
ENSBTAP00000011687  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000009115  ..............................................................................
ENSBTAP00000023873  ..............................................................................
ENSBTAP00000054471  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000025205  ..............................................................................
ENSBTAP00000047882  ..............................................................................
ENSBTAP00000001368  ..............................................................................
ENSBTAP00000029786  ..............................................................................
ENSBTAP00000028993  ..............................................................................
ENSBTAP00000023678  ..............................................................................
ENSBTAP00000034710  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000021074  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000007217  ..............................................................................
ENSBTAP00000029792  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000017319  ..............................................................................
ENSBTAP00000044100  ..............................................................................
ENSBTAP00000033594  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000055894  ..............................................................................
ENSBTAP00000015220  ..............................................................................
ENSBTAP00000033613  ..............................................................................
ENSBTAP00000056320  ..............................................................................
ENSBTAP00000025249  ..............................................................................
ENSBTAP00000029159  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000017662  ..............................................................................
ENSBTAP00000012479  ..............................................................................
ENSBTAP00000029886  ..............................................................................
ENSBTAP00000027388  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000023673  ..............................................................................
ENSBTAP00000041488  ..............................................................................
ENSBTAP00000001452  ..............................................................................
ENSBTAP00000028498  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000020240  ..............................................................................
ENSBTAP00000053650  ..............................................................................
ENSBTAP00000041651  ..............................................................................
ENSBTAP00000005154  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000022068  ..............................................................................
ENSBTAP00000026682  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000027954  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000013601  ..............................................................................
ENSBTAP00000005477  ..............................................................................
ENSBTAP00000055305  ..............................................................................
ENSBTAP00000036054  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000002717  ylfsrensiwdekydvv.............................................................
ENSBTAP00000036015  lsnqdafrlwclfn................................................................
ENSBTAP00000051638  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000016306  ..............................................................................
ENSBTAP00000013714  ..............................................................................
ENSBTAP00000036550  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000023383  yqgelwavdrlqvqefmlsflrdplreieepyffldefvtflfskensiwnsqldevc....................
ENSBTAP00000027030  ..............................................................................
ENSBTAP00000053270  ..............................................................................
ENSBTAP00000054640  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000009967  ..............................................................................
ENSBTAP00000015183  ..............................................................................
ENSBTAP00000014222  ..............................................................................
ENSBTAP00000026288  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000009228  ..............................................................................
ENSBTAP00000026785  ..............................................................................
ENSBTAP00000002578  flsedkypliivpeeieyllkklteamgvswqqeqfenykinfddskdg.............................
ENSBTAP00000000106  ..............................................................................
ENSBTAP00000028840  ..............................................................................
ENSBTAP00000053594  ..............................................................................
ENSBTAP00000055414  ..............................................................................
ENSBTAP00000026698  ..............................................................................
ENSBTAP00000017015  ..............................................................................
ENSBTAP00000049908  ..............................................................................
ENSBTAP00000021395  ..............................................................................
ENSBTAP00000007194  ..............................................................................
ENSBTAP00000025455  ..............................................................................


                                                                                                    
                                                                                                    
d1df0a1               ..............................................................................
ENSBTAP00000019411  ..............................................................................
ENSBTAP00000036057  ..............................................................................
ENSBTAP00000038404  ..............................................................................
ENSBTAP00000010971  ..............................................................................
ENSBTAP00000019803  ..............................................................................
ENSBTAP00000014038  ..............................................................................
ENSBTAP00000002055  ..............................................................................
ENSBTAP00000049731  ..............................................................................
ENSBTAP00000005577  ..............................................................................
ENSBTAP00000034949  ..............................................................................
ENSBTAP00000017447  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000046644  ..............................................................................
ENSBTAP00000022814  ..............................................................................
ENSBTAP00000019758  ..............................................................................
ENSBTAP00000019321  ..............................................................................
ENSBTAP00000011677  ..............................................................................
ENSBTAP00000011680  ..............................................................................
ENSBTAP00000021742  ..............................................................................
ENSBTAP00000005348  ..............................................................................
ENSBTAP00000016609  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000018403  ..............................................................................
ENSBTAP00000026407  ..............................................................................
ENSBTAP00000052557  ..............................................................................
ENSBTAP00000054167  ..............................................................................
ENSBTAP00000010319  ..............................................................................
ENSBTAP00000041545  ..............................................................................
ENSBTAP00000055204  ..............................................................................
ENSBTAP00000003718  ..............................................................................
ENSBTAP00000011676  ..............................................................................
ENSBTAP00000049395  ..............................................................................
ENSBTAP00000054983  ..............................................................................
ENSBTAP00000052219  ..............................................................................
ENSBTAP00000025402  ..............................................................................
ENSBTAP00000011678  ..............................................................................
ENSBTAP00000000433  ..............................................................................
ENSBTAP00000021491  ..............................................................................
ENSBTAP00000044733  ..............................................................................
ENSBTAP00000010937  ..............................................................................
ENSBTAP00000056439  ..............................................................................
ENSBTAP00000055780  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000034705  ..............................................................................
ENSBTAP00000035936  ..............................................................................
ENSBTAP00000013699  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000011496  ..............................................................................
ENSBTAP00000019111  ..............................................................................
ENSBTAP00000017036  ..............................................................................
ENSBTAP00000003213  ..............................................................................
ENSBTAP00000055444  ..............................................................................
ENSBTAP00000024550  ..............................................................................
ENSBTAP00000015248  ..............................................................................
ENSBTAP00000021328  ..............................................................................
ENSBTAP00000037091  ..............................................................................
ENSBTAP00000029967  ..............................................................................
ENSBTAP00000021449  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000042361  ..............................................................................
ENSBTAP00000016509  ..............................................................................
ENSBTAP00000026714  ..............................................................................
ENSBTAP00000004690  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000013117  ..............................................................................
ENSBTAP00000017574  ..............................................................................
ENSBTAP00000004885  ..............................................................................
ENSBTAP00000008961  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000006283  ..............................................................................
ENSBTAP00000014306  ..............................................................................
ENSBTAP00000053252  ..............................................................................
ENSBTAP00000014304  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000041264  ..............................................................................
ENSBTAP00000006711  pqdklefm......................................................................
ENSBTAP00000017358  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000055296  ..............................................................................
ENSBTAP00000016852  ..............................................................................
ENSBTAP00000036380  ..............................................................................
ENSBTAP00000041719  ..............................................................................
ENSBTAP00000049636  ..............................................................................
ENSBTAP00000024444  ..............................................................................
ENSBTAP00000004556  ..............................................................................
ENSBTAP00000038767  ..............................................................................
ENSBTAP00000031285  ..............................................................................
ENSBTAP00000011457  ..............................................................................
ENSBTAP00000011047  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000037104  ..............................................................................
ENSBTAP00000002672  ..............................................................................
ENSBTAP00000028269  ..............................................................................
ENSBTAP00000016647  ..............................................................................
ENSBTAP00000004536  ..............................................................................
ENSBTAP00000042177  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000050283  ..............................................................................