SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

EF-hand alignments in Bos taurus 76_3.1

These alignments are sequences aligned to the 0036425 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1dgua_               s.............................................................................
ENSBTAP00000019411  ma............................................................................
ENSBTAP00000036057  ma............................................................................
ENSBTAP00000038404  lr............................................................................
ENSBTAP00000010971  lr............................................................................
ENSBTAP00000019803  ggggggggtamrilggvisaiseaaaqynpepvpprthysniea..................................
ENSBTAP00000014038  le............................................................................
ENSBTAP00000002055  a.............................................................................
ENSBTAP00000049731  a.............................................................................
ENSBTAP00000005577  mgkqnsklr.....................................................................
ENSBTAP00000034949  ls............................................................................
ENSBTAP00000017447  vspmtclkkhwmklafmtntngkipvrsitrtfasgktekvifqalkelglpsgkndeiepaa...............
ENSBTAP00000010858  hpkmtelyqsladlnnvrfsayrtamklrrlqkalcldllslsaacdaldqhnlkqndqpmdilqiinclttiydrle
ENSBTAP00000046644  srdaflekaytklkl...............................................................
ENSBTAP00000022814  mgkqnskla.....................................................................
ENSBTAP00000019758  ppcldseltefplrmrdwlknvlvtlyerdednnlltekqklrvkkihenekrleagdhpvellardfeknynmyifp
ENSBTAP00000019321  mgktnskla.....................................................................
ENSBTAP00000011677  pqlepgn.......................................................................
ENSBTAP00000011680  ntdq..........................................................................
ENSBTAP00000021742  r.............................................................................
ENSBTAP00000005348  pactdfevtqfplrmrdwlknilvqlyepnpehsgylnekqrnkvkkiyldekrllagdhsidlllrdfkknyhmyvy
ENSBTAP00000016609  srntflrkaytk..................................................................
ENSBTAP00000012740  hpkmtelfqsladlnnvrfsayrtaikirrlqkalcldllelntt.................................
ENSBTAP00000018403  ae............................................................................
ENSBTAP00000026407  astdv.........................................................................
ENSBTAP00000052557  p.............................................................................
ENSBTAP00000054167  r.............................................................................
ENSBTAP00000010319  anmasttqrk....................................................................
ENSBTAP00000041545  erld..........................................................................
ENSBTAP00000055204  sf............................................................................
ENSBTAP00000003718  le............................................................................
ENSBTAP00000011676  qedg..........................................................................
ENSBTAP00000049395  qklrh.........................................................................
ENSBTAP00000054983  ls............................................................................
ENSBTAP00000052219  dplyg.........................................................................
ENSBTAP00000025402  srstfldkilvklkmqlnpegkipvknfqmfpadrkrveaalsach................................
ENSBTAP00000011678  an............................................................................
ENSBTAP00000000433  ertfqrfavfgessssgt............................................................
ENSBTAP00000021491  srpssdqwk.....................................................................
ENSBTAP00000044733  seddid........................................................................
ENSBTAP00000010937  rth...........................................................................
ENSBTAP00000056439  rth...........................................................................
ENSBTAP00000055780  ave...........................................................................
ENSBTAP00000038002  makerglispsdfaqlqkymeystkkvsdvlklfedgemaeylqg.................................
ENSBTAP00000034705  erldhw........................................................................
ENSBTAP00000035936  qqfswe........................................................................
ENSBTAP00000013699  gvppnvdp......................................................................
ENSBTAP00000002564  hpkmtelyqtlaadlnnikfsayrtamklrrvqkalrldlv.....................................
ENSBTAP00000011496  y.............................................................................
ENSBTAP00000019111  ..............................................................................
ENSBTAP00000017036  e.............................................................................
ENSBTAP00000003213  rtrd..........................................................................
ENSBTAP00000055444  rtrd..........................................................................
ENSBTAP00000024550  pm............................................................................
ENSBTAP00000015248  ..............................................................................
ENSBTAP00000021328  ..............................................................................
ENSBTAP00000037091  ..............................................................................
ENSBTAP00000029967  e.............................................................................
ENSBTAP00000021449  gia...........................................................................
ENSBTAP00000053176  ekwahlspsefsqlqkyaeys.........................................................
ENSBTAP00000042361  s.............................................................................
ENSBTAP00000016509  qqfswe........................................................................
ENSBTAP00000026714  l.............................................................................
ENSBTAP00000004690  etdid.........................................................................
ENSBTAP00000010858  hledkyrylfkqvasstgfcdqrrlglllhd...............................................
ENSBTAP00000013117  nmrtsw........................................................................
ENSBTAP00000017574  kwfllmvr......................................................................
ENSBTAP00000004885  ptaacqdveppt..................................................................
ENSBTAP00000008961  tfritkadaaefwrkafgekti........................................................
ENSBTAP00000028063  emraqnfdvirlstyrtacklrfvqkrcnlhlvdiwnmieafrdnglntl............................
ENSBTAP00000012740  leekyrylfkevagptemcdqrqlglllhdaiqiprqlgevaafggsniepsvrscfqqn..................
ENSBTAP00000006283  r.............................................................................
ENSBTAP00000014306  ..............................................................................
ENSBTAP00000053252  tprf..........................................................................
ENSBTAP00000014304  ..............................................................................
ENSBTAP00000045669  qlfaemraqdldrirlstyrtacklrfvqkkcnlhlvdiwnviealrenalnnvdpnmelnvarleavlstifyqlnk
ENSBTAP00000041264  tyqltkvsahtfwrercgarcv........................................................
ENSBTAP00000006711  drwvs.........................................................................
ENSBTAP00000017358  fritkadaaefwrkffgdkt..........................................................
ENSBTAP00000053274  qlfaemraqdldrirlstyrtacklrfvqkkcnlhlvdiwnviealrenalnnvdpnmelnvarleavlstifyqlnk
ENSBTAP00000055296  fritkadaaefwrkffgdkt..........................................................
ENSBTAP00000016852  ..............................................................................
ENSBTAP00000036380  ..............................................................................
ENSBTAP00000041719  ..............................................................................
ENSBTAP00000049636  ..............................................................................
ENSBTAP00000024444  ..............................................................................
ENSBTAP00000004556  ctdkelrnlasrlkdwfgalhedanrvinptssetaqgrfdtsilpickd............................
ENSBTAP00000038767  mgsrastllr....................................................................
ENSBTAP00000031285  tctgqdladlgdrlrdwfqllhenskqngsansgaspasgldkslgas..............................
ENSBTAP00000011457  kn............................................................................
ENSBTAP00000011047  ..............................................................................
ENSBTAP00000002564  vkeklqylfsqvansgsqcdqrhlgvllheaiqvprqlgevaafggsnvepsvrsc......................
ENSBTAP00000037104  ..............................................................................
ENSBTAP00000002672  ..............................................................................
ENSBTAP00000028269  ..............................................................................
ENSBTAP00000016647  shaaripd......................................................................
ENSBTAP00000004536  a.............................................................................
ENSBTAP00000042177  qgcpgakkrefltsvldalstdmvhavsdpsspgrlsepdpshtle................................
ENSBTAP00000028063  mldklryvfsqmsdsngl............................................................
ENSBTAP00000050283  tyv...........................................................................
ENSBTAP00000048539  ef............................................................................
ENSBTAP00000045669  ki............................................................................
ENSBTAP00000007972  i.............................................................................
ENSBTAP00000040815  pgcpegkklefitslldalttdmvqainsaaptgggrfsepdpshtlee.............................
ENSBTAP00000025661  eftkisrklkldwdg...............................................................
ENSBTAP00000028350  k.............................................................................
ENSBTAP00000053274  ki............................................................................
ENSBTAP00000021537  mgnkqtvft.....................................................................
ENSBTAP00000055481  pptaewavpq....................................................................
ENSBTAP00000039155  ..............................................................................
ENSBTAP00000029333  pptaewavpq....................................................................
ENSBTAP00000016315  stsy..........................................................................
ENSBTAP00000021091  efftklfekype..................................................................
ENSBTAP00000021618  lsra..........................................................................
ENSBTAP00000055520  alnsienstyrtafklrsvqtlcqldligssliqhvlrhqslweages..............................
ENSBTAP00000055624  alnsienstyrtafklrsvqtlcqldligssliqhvlrhqslweages..............................
ENSBTAP00000016319  dd............................................................................
ENSBTAP00000034078  h.............................................................................
ENSBTAP00000006645  mgqclryqmh....................................................................
ENSBTAP00000021909  vrd...........................................................................
ENSBTAP00000001426  qqppylhlaelta.................................................................
ENSBTAP00000015802  e.............................................................................
ENSBTAP00000032680  e.............................................................................
ENSBTAP00000055007  ar............................................................................
ENSBTAP00000020148  pte...........................................................................
ENSBTAP00000052345  wi............................................................................
ENSBTAP00000029334  spktgtsewavpqp................................................................
ENSBTAP00000052345  isgtsaae......................................................................
ENSBTAP00000056127  e.............................................................................
ENSBTAP00000012557  kt............................................................................
ENSBTAP00000011888  k.............................................................................
ENSBTAP00000017060  eah...........................................................................
ENSBTAP00000031854  ee............................................................................
ENSBTAP00000031823  ard...........................................................................
ENSBTAP00000021603  lsra..........................................................................
ENSBTAP00000010838  sqle..........................................................................
ENSBTAP00000014575  liiqmpe.......................................................................
ENSBTAP00000011215  ee............................................................................
ENSBTAP00000053698  la............................................................................
ENSBTAP00000006806  sel...........................................................................
ENSBTAP00000029334  gp............................................................................
ENSBTAP00000044105  hle...........................................................................
ENSBTAP00000026904  mptqleiamnimirtfhryscregdrf...................................................
ENSBTAP00000017060  ptvswv........................................................................
ENSBTAP00000055520  pltkyt........................................................................
ENSBTAP00000044226  sel...........................................................................
ENSBTAP00000055624  pltkyt........................................................................
ENSBTAP00000042182  elqqlfqelageeeelgapqlqillsialeparahaqtpreigl..................................
ENSBTAP00000010796  lrkkvqgc......................................................................
ENSBTAP00000021174  s.............................................................................
ENSBTAP00000006275  mselekavv.....................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000053738  rkkvqgc.......................................................................
ENSBTAP00000004963  vn............................................................................
ENSBTAP00000023774  ..............................................................................
ENSBTAP00000020395  leqq..........................................................................
ENSBTAP00000020150  mpsqm.........................................................................
ENSBTAP00000025561  plekal........................................................................
ENSBTAP00000053738  prrlkeff......................................................................
ENSBTAP00000034009  mtkl..........................................................................
ENSBTAP00000020539  dilv..........................................................................
ENSBTAP00000020778  t.............................................................................
ENSBTAP00000017461  r.............................................................................
ENSBTAP00000044096  msqmess.......................................................................
ENSBTAP00000008523  msqmess.......................................................................
ENSBTAP00000035196  ..............................................................................
ENSBTAP00000041997  rdkpm.........................................................................
ENSBTAP00000025499  mtdl..........................................................................
ENSBTAP00000055481  pfggsl........................................................................
ENSBTAP00000002174  kdkpt.........................................................................
ENSBTAP00000000589  spleqalavmv...................................................................
ENSBTAP00000028239  tk............................................................................
ENSBTAP00000014894  enqilt........................................................................
ENSBTAP00000026544  v.............................................................................
ENSBTAP00000029333  pfggsl........................................................................
ENSBTAP00000041966  sqqsifykyaqqgl................................................................
ENSBTAP00000008933  akdkpvydelfytlspi.............................................................
ENSBTAP00000056088  mtkl..........................................................................
ENSBTAP00000033794  tpveeslfqiihcyh...............................................................
ENSBTAP00000012786  etqilt........................................................................
ENSBTAP00000030018  enqvlt........................................................................
ENSBTAP00000040233  d.............................................................................
ENSBTAP00000003365  prskkfllteeeifymncraayltvf....................................................
ENSBTAP00000053176  v.............................................................................
ENSBTAP00000024301  rd............................................................................
ENSBTAP00000022292  dp............................................................................
ENSBTAP00000015611  mtnllrsvvtvidtfykytkqdg.......................................................
ENSBTAP00000012770  eels..........................................................................
ENSBTAP00000000847  etplekalttm...................................................................
ENSBTAP00000053738  d.............................................................................
ENSBTAP00000054975  pdtfepqkffqts.................................................................
ENSBTAP00000046639  khl...........................................................................
ENSBTAP00000052345  npl...........................................................................
ENSBTAP00000053164  hhlkkv........................................................................
ENSBTAP00000016774  mltdlecainslidvyhkyslkkgnyh...................................................
ENSBTAP00000022630  ks............................................................................
ENSBTAP00000010796  a.............................................................................
ENSBTAP00000021909  sfdydhdaflga..................................................................
ENSBTAP00000033974  m.............................................................................
ENSBTAP00000006711  vy............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000004912  llf...........................................................................
ENSBTAP00000005979  ..............................................................................
ENSBTAP00000053738  a.............................................................................
ENSBTAP00000053746  pirskivraffdnrnlrkgtsgla......................................................
ENSBTAP00000023221  k.............................................................................
ENSBTAP00000019429  hp............................................................................
ENSBTAP00000052019  mtellnsil.....................................................................
ENSBTAP00000042244  qspsrr........................................................................
ENSBTAP00000053738  lk............................................................................
ENSBTAP00000018877  ytelekavvvlvenfykyvskhslvk....................................................
ENSBTAP00000053019  t.............................................................................
ENSBTAP00000003073  kev...........................................................................
ENSBTAP00000012886  sll...........................................................................
ENSBTAP00000044222  slleqala......................................................................
ENSBTAP00000028499  aeplteleaaietvvttfftfagre.....................................................
ENSBTAP00000047378  yv............................................................................
ENSBTAP00000009308  s.............................................................................
ENSBTAP00000017060  ply...........................................................................
ENSBTAP00000050406  a.............................................................................
ENSBTAP00000031879  a.............................................................................
ENSBTAP00000031854  qtlsrieaafmdie................................................................
ENSBTAP00000001250  rllrglglkpekleqdldrhaesarmtqgrrvt.............................................
ENSBTAP00000026035  mpqllrni......................................................................
ENSBTAP00000011215  tlsrieaafmdie.................................................................
ENSBTAP00000002128  algnvcetikklq.................................................................
ENSBTAP00000053194  ..............................................................................
ENSBTAP00000056127  iv............................................................................
ENSBTAP00000033188  wrkkymrwmnhkk.................................................................
ENSBTAP00000053548  wrkkymrwmnhkk.................................................................
ENSBTAP00000011687  l.............................................................................
ENSBTAP00000007636  c.............................................................................
ENSBTAP00000020950  p.............................................................................
ENSBTAP00000009115  rk............................................................................
ENSBTAP00000023873  q.............................................................................
ENSBTAP00000054471  mlrr..........................................................................
ENSBTAP00000039694  gkaelnfedfyrfmdnlqtevleieflsy.................................................
ENSBTAP00000025205  mlrr..........................................................................
ENSBTAP00000047882  eaems.........................................................................
ENSBTAP00000001368  eewtsaakpkldqai...............................................................
ENSBTAP00000029786  tkrnvv........................................................................
ENSBTAP00000028993  eela..........................................................................
ENSBTAP00000023678  dpgvr.........................................................................
ENSBTAP00000034710  plt...........................................................................
ENSBTAP00000031823  tp............................................................................
ENSBTAP00000038002  sc............................................................................
ENSBTAP00000021074  qllr..........................................................................
ENSBTAP00000026544  g.............................................................................
ENSBTAP00000007217  qlv...........................................................................
ENSBTAP00000029792  akrsvvraipgdigfsieeledlymvfkakhlasqywgssrpaavrrdpslpyleqy.....................
ENSBTAP00000044088  dlgdkglisyteylflltiltkphs.....................................................
ENSBTAP00000017319  sdlekaiataalvfrns.............................................................
ENSBTAP00000044100  nkhi..........................................................................
ENSBTAP00000033594  gk............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000055894  lcdqkysdeenl..................................................................
ENSBTAP00000015220  ah............................................................................
ENSBTAP00000033613  evsa..........................................................................
ENSBTAP00000056320  k.............................................................................
ENSBTAP00000025249  sdssmsfvefvelfksfsvrsrkdlkdlfdiyavpcdragseaaplytnltidenisglqpdldlltrnvsdlglfik
ENSBTAP00000029159  vspkpdpktis...................................................................
ENSBTAP00000044088  fgkrgerkl.....................................................................
ENSBTAP00000016319  lt............................................................................
ENSBTAP00000017662  eraee.........................................................................
ENSBTAP00000012479  plss..........................................................................
ENSBTAP00000029886  kgsny.........................................................................
ENSBTAP00000027388  flddpkyssdedlps...............................................................
ENSBTAP00000039694  s.............................................................................
ENSBTAP00000023673  le............................................................................
ENSBTAP00000041488  le............................................................................
ENSBTAP00000001452  v.............................................................................
ENSBTAP00000028498  sdvera........................................................................
ENSBTAP00000001426  r.............................................................................
ENSBTAP00000020240  nvemilk.......................................................................
ENSBTAP00000053650  nvemilk.......................................................................
ENSBTAP00000041651  epeh..........................................................................
ENSBTAP00000005154  alf...........................................................................
ENSBTAP00000021174  nf............................................................................
ENSBTAP00000022068  edsp..........................................................................
ENSBTAP00000026682  gdinfaeieeanrvlgpiyfttfvffmffillnmflaiindtysevksdlaqqkaemelsdlirkgyhkaliklklkk
ENSBTAP00000007636  hdv...........................................................................
ENSBTAP00000027954  q.............................................................................
ENSBTAP00000020778  v.............................................................................
ENSBTAP00000013601  i.............................................................................
ENSBTAP00000005477  eh............................................................................
ENSBTAP00000055305  nvemilk.......................................................................
ENSBTAP00000036054  nvemilk.......................................................................
ENSBTAP00000004912  q.............................................................................
ENSBTAP00000022292  nwd...........................................................................
ENSBTAP00000002717  s.............................................................................
ENSBTAP00000036015  el............................................................................
ENSBTAP00000051638  t.............................................................................
ENSBTAP00000026766  kg............................................................................
ENSBTAP00000053738  eyfnfmghftkpqqvqeelkelqqsteka.................................................
ENSBTAP00000016306  kq............................................................................
ENSBTAP00000013714  malvapeaps....................................................................
ENSBTAP00000036550  kqnvlrvvipevsvlpedleelydlfkrehmmscyweqprpmaprhdpsrpyaeqy......................
ENSBTAP00000053738  mtkdevieklksci................................................................
ENSBTAP00000023383  er............................................................................
ENSBTAP00000027030  wieeklqevcedlgit..............................................................
ENSBTAP00000053270  wieeklqevcedlgit..............................................................
ENSBTAP00000054640  wieeklqevcedlgit..............................................................
ENSBTAP00000012770  eelqnlwflldkhqtppmigeea.......................................................
ENSBTAP00000009967  ng............................................................................
ENSBTAP00000015183  le............................................................................
ENSBTAP00000014222  hlrkeqvsdvqkvlq...............................................................
ENSBTAP00000026288  phlflrlh......................................................................
ENSBTAP00000002128  ssvirydvfinrlwdlrffd..........................................................
ENSBTAP00000003365  st............................................................................
ENSBTAP00000053738  sldeietafclelsk...............................................................
ENSBTAP00000009228  nvemilkffdmflklkdivg..........................................................
ENSBTAP00000026785  get...........................................................................
ENSBTAP00000002578  s.............................................................................
ENSBTAP00000000106  pvslpgis......................................................................
ENSBTAP00000028840  lhcrki........................................................................
ENSBTAP00000053594  ge............................................................................
ENSBTAP00000055414  dpkgmipmvviqnvlyeffqnpdlqletcclpvdiadsmkprlnktefiqlislhiagfksetfekllkhlchcaaef
ENSBTAP00000026698  qs............................................................................
ENSBTAP00000017015  ..............................................................................
ENSBTAP00000049908  d.............................................................................
ENSBTAP00000021395  islnpsv.......................................................................
ENSBTAP00000007194  seme..........................................................................
ENSBTAP00000025455  srirr.........................................................................


                                                                          10          20           3
                                                                           |           |            
d1dgua_               ............................................-KELLAEYQDLTFLTKQE.I.LLAHRRFCEL...
ENSBTAP00000019411  ............................................-----------DQLTEEQ.I.AEFKEAFSLF...
ENSBTAP00000036057  ............................................-----------DQLTEEQ.I.AEFKEAFSLF...
ENSBTAP00000038404  ............................................-PEVMQDLLESTDFTEHE.I.QEWYKGFLRD...
ENSBTAP00000010971  ............................................-PEMLQDLRENTEFSELE.L.QEWYKGFLKD...
ENSBTAP00000019803  ............................................-------------NESEE.V.RQFRRLFAQL...
ENSBTAP00000014038  ............................................---------MCSHFDADE.I.KRLGKRFKKL...
ENSBTAP00000002055  ............................................-----------DQLTEEQ.I.AEFKEAFSLF...
ENSBTAP00000049731  ............................................-----------DQLTEEQ.I.AEFQEAFSLF...
ENSBTAP00000005577  ............................................-PEVLQDLRENTEFTDHE.L.QEWYKGFLKD...
ENSBTAP00000034949  ............................................-KEILEELQLNTKFTEEE.L.SSWYQSFLKE...
ENSBTAP00000017447  ............................................------------------.-.----------...
ENSBTAP00000010858  .................................qehnnlvnvpl------------------.-.----------...
ENSBTAP00000046644  ............................................------------QVTPEG.R.IPLKNIYRLF...
ENSBTAP00000022814  ............................................-PEVMEDLVKSTEFNEHE.L.KQWYKGFLKD...
ENSBTAP00000019758  ...............................vhwqfgqldqhpi------------------.-.----------...
ENSBTAP00000019321  ............................................-PEVLEDLVQNTEFSEQE.L.KQWYKGFLKD...
ENSBTAP00000011677  ............................................-----------TDQESEE.Q.RQFRNIFRQI...
ENSBTAP00000011680  ............................................--------------ESEE.Q.RQFRNIFRQI...
ENSBTAP00000021742  ............................................-PEGLEQLQEQTKFTRKE.L.QVLYRGFKNE...
ENSBTAP00000005348  ........................................pvhw------------------.-.-----QFSEL...
ENSBTAP00000016609  ............................................------------------.-.---------Lkl.
ENSBTAP00000012740  ............................................------------------.-.----------...
ENSBTAP00000018403  ............................................------------KLSEEQ.V.AEFKEAFDRF...
ENSBTAP00000026407  ............................................------------------.-.AGLEESFRKF...
ENSBTAP00000052557  ............................................------------ELTEEQ.K.QEVREAFDLF...
ENSBTAP00000054167  ............................................-PEALELLEAQSKFTKKE.L.QILYRGFKNE...
ENSBTAP00000010319  ............................................------RMSPKPELTEEQ.K.QEIREAFDLF...
ENSBTAP00000041545  ............................................------------------.-.QWLSDWFQRG...
ENSBTAP00000055204  ............................................------------------.-.--LWNVFQRV...
ENSBTAP00000003718  ............................................------QLEAQTNFTKRE.L.QVLYRGFKNE...
ENSBTAP00000011676  ............................................------------------.-.-QLRSLFEKF...
ENSBTAP00000049395  ............................................------------------.-.-WIHSCLRKA...
ENSBTAP00000054983  ............................................------------------.-.-ALEEAFRKF...
ENSBTAP00000052219  ............................................------------------.-.-----YFAAV...
ENSBTAP00000025402  ............................................------------------.-.----------...
ENSBTAP00000011678  ............................................-------LPDEQVLSEEE.IdENFKSLFRQL...
ENSBTAP00000000433  ............................................------------------.-.----------...
ENSBTAP00000021491  ............................................------KNAAKIELNETQ.K.QEIKEAFDLF...
ENSBTAP00000044733  ............................................------------------.-.DGFRRLFAQL...
ENSBTAP00000010937  ............................................------------------.D.QWVKQTFEEA...
ENSBTAP00000056439  ............................................------------------.D.QWVKQTFEEA...
ENSBTAP00000055780  ............................................------------QLTEEQ.K.NEFKAAFDIFv..
ENSBTAP00000038002  ............................................------------------.-.----------...
ENSBTAP00000034705  ............................................------------------.-.--IHSYLHRA...
ENSBTAP00000035936  ............................................---EVEENGAVGAADAAQ.L.QEWYKKFLEE...
ENSBTAP00000013699  ............................................------------------.-.-EAYSWFQSV...
ENSBTAP00000002564  ............................................------------------.-.----------...
ENSBTAP00000011496  ............................................------------------.-.----KGFIKD...
ENSBTAP00000019111  ............................................-------------LSEEQ.K.QEIKDAFELF...
ENSBTAP00000017036  ............................................-------------LSSTE.C.HQWYKKFMTE...
ENSBTAP00000003213  ............................................------------------.-.QWLKQTFDEA...
ENSBTAP00000055444  ............................................------------------.-.QWLKQTFDEA...
ENSBTAP00000024550  ............................................------------------.-.---WKCFLAI...
ENSBTAP00000015248  ............................................-------------FDQSQ.I.QEFKEAFNMI...
ENSBTAP00000021328  ............................................-------------FDQSQ.I.QEFKEAFNMI...
ENSBTAP00000037091  ............................................-------------FDQSQ.I.QEFKEAFNMI...
ENSBTAP00000029967  ............................................-------------LRPEE.I.EELQAAFQEF...
ENSBTAP00000021449  ............................................------EKQRERPLGPDE.I.EELREAFLEF...
ENSBTAP00000053176  ............................................------------------.-.----------...
ENSBTAP00000042361  ............................................-------------LRPEE.I.EELREAFREF...
ENSBTAP00000016509  ............................................---EVEENGAVGAADAAQ.L.QEWYKKFLEE...
ENSBTAP00000026714  ............................................--------------RPEE.I.EELREAFREF...
ENSBTAP00000004690  ............................................------------------.-.QDFVRLFHIV...
ENSBTAP00000010858  ............................................------------------.-.----------...
ENSBTAP00000013117  ............................................------------------.-.--VSQMFSEI...
ENSBTAP00000017574  ............................................------------------.-.----------...
ENSBTAP00000004885  ............................................------------------.-.-RYETLFQKL...
ENSBTAP00000008961  ............................................------------------.-.----------...
ENSBTAP00000028063  ............................................------------------.-.----------...
ENSBTAP00000012740  ............................................------------------.-.----------...
ENSBTAP00000006283  ............................................------------ELGPEE.L.DELQAAFEEF...
ENSBTAP00000014306  ............................................-------------FTEDQ.T.AEFKEAFQLF...
ENSBTAP00000053252  ............................................------------------.-.MWLKTVFEAA...
ENSBTAP00000014304  ............................................-------------FTEDQ.T.AEFKEAFQLF...
ENSBTAP00000045669  ............................rmptthqiqveqsisl------------------.-.----------...
ENSBTAP00000041264  ............................................------------------.-.----------...
ENSBTAP00000006711  ............................................------------------.-.----------...
ENSBTAP00000017358  ............................................------------------.-.----------...
ENSBTAP00000053274  ............................rmptthqiqveqsisl------------------.-.----------...
ENSBTAP00000055296  ............................................------------------.-.----------...
ENSBTAP00000016852  ............................................------------------.I.KGLGRVFRIM...
ENSBTAP00000036380  ............................................-------------LSQDQ.I.NEYKECFSLY...
ENSBTAP00000041719  ............................................-------------FNKDQ.L.EEFKEAFELY...
ENSBTAP00000049636  ............................................-------------FSKQQ.Q.DEFKEAFLLF...
ENSBTAP00000024444  ............................................-------------FEQTQ.I.QEFKEAFTIM...
ENSBTAP00000004556  ............................................------------------.-.-SLGWMFNKL...
ENSBTAP00000038767  ............................................-DEELEEIKKETGFSHSQ.I.TRLYSRFTSL...
ENSBTAP00000031285  ............................................------------------.-.----------...
ENSBTAP00000011457  ............................................----------CKHFSKFE.V.KCLINLFYNLvge
ENSBTAP00000011047  ............................................-------------FTPEQ.I.EEFKEAFTLF...
ENSBTAP00000002564  ............................................------------------.-.----------...
ENSBTAP00000037104  ............................................-------------FDQSQ.I.QEFKEAFTIM...
ENSBTAP00000002672  ............................................-------------FEQAQ.I.QEFKEAFSCI...
ENSBTAP00000028269  ............................................-------------FDQTQ.I.QEFKEAFTVI...
ENSBTAP00000016647  ............................................----VDSLRQETGFSQAS.L.RRLYDRFNAL...
ENSBTAP00000004536  ............................................----------------ER.R.QRWGRLFEEL...
ENSBTAP00000042177  ............................................------------------.-.----------...
ENSBTAP00000028063  ............................................------------------.-.----------...
ENSBTAP00000050283  ............................................------------------.-.TEFKEAFSLF...
ENSBTAP00000048539  ............................................-----------TKISQNL.K.LDWDNIHQCL...
ENSBTAP00000045669  ............................................------------------.-.----------...
ENSBTAP00000007972  ............................................------------------.-.QGVARFFRRL...
ENSBTAP00000040815  ............................................------------------.-.----------...
ENSBTAP00000025661  ............................................------------------.I.RKHLDEYAAIa..
ENSBTAP00000028350  ............................................--ELLAEYQDLTFLTKQE.I.LLAHRRFCEL...
ENSBTAP00000053274  ............................................------------------.-.----------...
ENSBTAP00000021537  ............................................-HEQLEAYQDCTFFTRKE.I.MRLFYRYQDL...
ENSBTAP00000055481  ............................................------------------.-.----------...
ENSBTAP00000039155  ............................................------------------.-.----EAFSLF...
ENSBTAP00000029333  ............................................------------------.-.----------...
ENSBTAP00000016315  ............................................-------PDEPWRITEEQ.R.EYYVNQFRSL...
ENSBTAP00000021091  ............................................------------------.-.----------...
ENSBTAP00000021618  ............................................------------------.-.----------...
ENSBTAP00000055520  ............................................------------------.-.----------...
ENSBTAP00000055624  ............................................------------------.-.----------...
ENSBTAP00000016319  ............................................----------PWKITDEQ.R.QYYVNQFKTI...
ENSBTAP00000034078  ............................................------------------.-.KKIKEAFEVF...
ENSBTAP00000006645  ............................................-WEDLEEYQALTFLTRNE.I.LCIHDSFLKL...
ENSBTAP00000021909  ............................................------------------.-.---ERRFKMA...
ENSBTAP00000001426  ............................................------------------.-.TQFLEIWKHF...
ENSBTAP00000015802  ............................................------------------.-.----------...
ENSBTAP00000032680  ............................................------------------.-.----------...
ENSBTAP00000055007  ............................................-----------SYLSEEM.I.AEFKAAFDMF...
ENSBTAP00000020148  ............................................--------------TERC.I.ESLIAVFQKH...
ENSBTAP00000052345  ............................................-------------VSPAE.K.AKYDEIFLKT...
ENSBTAP00000029334  ............................................------------------.-.----------...
ENSBTAP00000052345  ............................................---------LPWAVKPED.K.AKYDAIFDSL...
ENSBTAP00000056127  ............................................------------------.-.----RRFKAA...
ENSBTAP00000012557  ............................................------------------.-.-DLIRAFQLQ...
ENSBTAP00000011888  ............................................-----------------W.L.QWVTHQFKTI...
ENSBTAP00000017060  ............................................-----------WAVRVEE.K.AKFDGIFESL...
ENSBTAP00000031854  ............................................----EDINQITDYFSYEH.F.YVIYCKFWEL...
ENSBTAP00000031823  ............................................------------------.-.---ERRFRVA...
ENSBTAP00000021603  ............................................------------------.-.----------...
ENSBTAP00000010838  ............................................----------------QA.I.TDLINLFHKY...
ENSBTAP00000014575  ............................................------------------.-.----------...
ENSBTAP00000011215  ............................................----EDINQITDYFSYEH.F.YVIYCKFWEL...
ENSBTAP00000053698  ............................................------------NISVEE.L.DEIREAFRVL...
ENSBTAP00000006806  ............................................------------------.-.----------...
ENSBTAP00000029334  ............................................---------NMWAITSEE.R.TKHDKQFDNL...
ENSBTAP00000044105  ............................................----------------QA.I.TDLINLFHKY...
ENSBTAP00000026904  ............................................------------------.-.----------...
ENSBTAP00000017060  ............................................-------------VPVAD.K.MRFDEIFLKT...
ENSBTAP00000055520  ............................................------------------.-.----ALFQLY...
ENSBTAP00000044226  ............................................------------------.-.----------...
ENSBTAP00000055624  ............................................------------------.-.----ALFQLY...
ENSBTAP00000042182  ............................................------------------.-.----------...
ENSBTAP00000010796  ............................................------------------.W.RELLRECKER...
ENSBTAP00000021174  ............................................------------------.-.-QFFEIWLHF...
ENSBTAP00000006275  ............................................------------------.-.----------...
ENSBTAP00000020950  ............................................------------------.-.---KKRFEKA...
ENSBTAP00000053738  ............................................------------------.W.RELLRECKER...
ENSBTAP00000004963  ............................................------------SFKKSE.I.ECLIRIFHNV...
ENSBTAP00000023774  ............................................------------------.-.-EIREAFKVF...
ENSBTAP00000020395  ............................................-----IQARNTTGVTEEA.L.KEFSMMFKHF...
ENSBTAP00000020150  ............................................------------------.-.----------...
ENSBTAP00000025561  ............................................------------------.-.----------...
ENSBTAP00000053738  ............................................------------------.-.RDPYAAFFKM...
ENSBTAP00000034009  ............................................------------------.-.----------...
ENSBTAP00000020539  ............................................------------------.-.-----EFKKH...
ENSBTAP00000020778  ............................................---------------QEV.L.ENLKDRWYQAd..
ENSBTAP00000017461  ............................................--------PRTWEASPPE.H.KKWVEVFKAC...
ENSBTAP00000044096  ............................................------------------.-.----------...
ENSBTAP00000008523  ............................................------------------.-.----------...
ENSBTAP00000035196  ............................................HPTGPLYCPEEKEMKPAC.I.KALTRIFKIS...
ENSBTAP00000041997  ............................................------------------.-.--YDEIFYTL...
ENSBTAP00000025499  ............................................-------------LHAED.I.KKAVGAFTAV...
ENSBTAP00000055481  ............................................---------DIWAITVEE.R.AKHDQQFHSL...
ENSBTAP00000002174  ............................................------------------.-.--YDEIFYTL...
ENSBTAP00000000589  ............................................------------------.-.----------...
ENSBTAP00000028239  ............................................-----------------D.K.SKYDEIFYNL...
ENSBTAP00000014894  ............................................--------RDAKGISQEQ.M.QEFRASFNHF...
ENSBTAP00000026544  ............................................------------------.-.-EFMRIWRKY...
ENSBTAP00000029333  ............................................---------DIWAITVEE.R.AKHDQQFHSL...
ENSBTAP00000041966  ............................................------------------.-.----------...
ENSBTAP00000008933  ............................................------------------.-.----------...
ENSBTAP00000056088  ............................................------------------.-.----------...
ENSBTAP00000033794  ............................................------------------.-.-------EYA...
ENSBTAP00000012786  ............................................--------RDAKGITQEQ.M.NEFRASFNHF...
ENSBTAP00000030018  ............................................--------RDAKGLSQEQ.L.NEFRASFNHF...
ENSBTAP00000040233  ............................................------------------.-.-ELKRAFHLL...
ENSBTAP00000003365  ............................................------------------.-.----------...
ENSBTAP00000053176  ............................................------------------.-.----------...
ENSBTAP00000024301  ............................................----------AKGISQEQ.M.NEFRASFNHF...
ENSBTAP00000022292  ............................................------------------.-.QELRNIFLQY...
ENSBTAP00000015611  ............................................------------------.-.----------...
ENSBTAP00000012770  ............................................-----KESQETNWFSAPS.A.LRVYGQYLNL...
ENSBTAP00000000847  ............................................------------------.-.----------...
ENSBTAP00000053738  ............................................------------------.-.-ELKRAFHLL...
ENSBTAP00000054975  ............................................------------------.-.----------...
ENSBTAP00000046639  ............................................------------------.-.-------QQL...
ENSBTAP00000052345  ............................................------------------.-.--YEKYYRQV...
ENSBTAP00000053164  ............................................------------------.-.----------...
ENSBTAP00000016774  ............................................------------------.-.----------...
ENSBTAP00000022630  ............................................------------------.-.----------...
ENSBTAP00000010796  ............................................------------------.-.--LSTAFSAL...
ENSBTAP00000021909  ............................................-----EEAKTFDQLTPEEsK.ERLGMIVDKI...
ENSBTAP00000033974  ............................................------------------.-.---------F...
ENSBTAP00000006711  ............................................------------------.-.----------...
ENSBTAP00000010796  ............................................------------------.-.------FIET...
ENSBTAP00000004912  ............................................------------------.-.----KQYASI...
ENSBTAP00000005979  ............................................HPTAPLYDPEAKQLRPAC.A.QALTRIFRLS...
ENSBTAP00000053738  ............................................------------------.-.--LSTAFSAL...
ENSBTAP00000053746  ............................................------------------.-.----------...
ENSBTAP00000023221  ............................................------------------.-.----------...
ENSBTAP00000019429  ............................................-------YSEFPEFSRRL.I.KDLESMFKLY...
ENSBTAP00000052019  ............................................------------------.-.-TVIRVFQKY...
ENSBTAP00000042244  ............................................---VFNPYTEFKEFSRKQ.I.KDMEKMFKEY...
ENSBTAP00000053738  ............................................------------------.-.----KALLLI...
ENSBTAP00000018877  ............................................------------------.-.----------...
ENSBTAP00000053019  ............................................-----------TTISREE.L.EELQEAFNKI...
ENSBTAP00000003073  ............................................------------------.-.----------...
ENSBTAP00000012886  ............................................---------------PSD.I.DRYKKRFHKF...
ENSBTAP00000044222  ............................................------------------.-.----------...
ENSBTAP00000028499  ............................................------------------.-.----------...
ENSBTAP00000047378  ............................................------------------.-.SQLRDVYSSC...
ENSBTAP00000009308  ............................................-------------VSDEE.M.LELREAFAKV...
ENSBTAP00000017060  ............................................------------------.-.---ESYYKQV...
ENSBTAP00000050406  ............................................----------TTQISKDE.L.DELKEAFAKV...
ENSBTAP00000031879  ............................................----------TTQISKDE.L.DELKEAFAKV...
ENSBTAP00000031854  ............................................------------------.-.----------...
ENSBTAP00000001250  ............................................------------------.-.----------...
ENSBTAP00000026035  ............................................------------------.-.NGIIEAFRRY...
ENSBTAP00000011215  ............................................------------------.-.----------...
ENSBTAP00000002128  ............................................------------------.-.----------...
ENSBTAP00000053194  ............................................-----------TGLSEET.R.QEFETTFRHF...
ENSBTAP00000056127  ............................................------------------.-.-------DRI...
ENSBTAP00000033188  ............................................------------------.-.SRVMDFFRRI...
ENSBTAP00000053548  ............................................------------------.-.SRVMDFFRRI...
ENSBTAP00000011687  ............................................--------------SVRN.V.KALVEYFHLL...
ENSBTAP00000007636  ............................................------------------.-.----------...
ENSBTAP00000020950  ............................................---------------EEQ.H.KRLKSIIKKI...
ENSBTAP00000009115  ............................................-------------LSPSQ.M.RAFQDAYNFF...
ENSBTAP00000023873  ............................................-PEGLDQLQAQTKFTKKE.L.QSLYRGFKNE...
ENSBTAP00000054471  ............................................------------------.-.----------...
ENSBTAP00000039694  ............................................------------------.-.----------...
ENSBTAP00000025205  ............................................------------------.-.----------...
ENSBTAP00000047882  ............................................------------------.-.----------...
ENSBTAP00000001368  ............................................------------------.-.----------...
ENSBTAP00000029786  ............................................-----RTIVTETSFTTDE.L.EELYALFKAE...
ENSBTAP00000028993  ............................................------------------.-.----------...
ENSBTAP00000023678  ............................................------------------.-.----------...
ENSBTAP00000034710  ............................................---------------ARQ.L.AAFQDVFKLF...
ENSBTAP00000031823  ............................................---------------EES.Q.ARLGRIVDRM...
ENSBTAP00000038002  ............................................------------------.-.----------...
ENSBTAP00000021074  ............................................-----------------D.I.LCVIETFHKY...
ENSBTAP00000026544  ............................................------------------.-.--FWQVWQRF...
ENSBTAP00000007217  ............................................------------------.-.----------...
ENSBTAP00000029792  ............................................------------------.-.----------...
ENSBTAP00000044088  ............................................------------------.-.-GFHVAFKML...
ENSBTAP00000017319  ............................................------------------.-.----------...
ENSBTAP00000044100  ............................................------------------.-.----------...
ENSBTAP00000033594  ............................................------------------.-.----------...
ENSBTAP00000026766  ............................................TPTFYQTLAGVTHLEESD.I.IDLEKRYWLLk..
ENSBTAP00000055894  ............................................---------------PEK.L.TAFKEKYMEF...
ENSBTAP00000015220  ............................................------------------.-.----------...
ENSBTAP00000033613  ............................................------------------.-.----------...
ENSBTAP00000056320  ............................................------------------.-.------FWEL...
ENSBTAP00000025249  skqqlsdnqrqisdaiaaasivtngtgvestslgvfgvgilqln------------------.-.----------...
ENSBTAP00000029159  ............................................------------------.-.----------...
ENSBTAP00000044088  ............................................------------------.-.--HYKEFRRF...
ENSBTAP00000016319  ............................................-------------LSDAE.Q.KYYSDLFSYC...
ENSBTAP00000017662  ............................................------------HLTMKQ.E.EAFRSYFEIF...
ENSBTAP00000012479  ............................................----------------GL.L.DKLQKELKVL...
ENSBTAP00000029886  ............................................------------------.-.----------...
ENSBTAP00000027388  ............................................-----------------K.L.EAFKKKYMEF...
ENSBTAP00000039694  ............................................------------------.-.----------...
ENSBTAP00000023673  ............................................------------------.-.----------...
ENSBTAP00000041488  ............................................------------------.-.----------...
ENSBTAP00000001452  ............................................------------------.-.----------...
ENSBTAP00000028498  ............................................------------------.-.----------...
ENSBTAP00000001426  ............................................------------------.-.----------...
ENSBTAP00000020240  ............................................------------------.-.----------...
ENSBTAP00000053650  ............................................------------------.-.----------...
ENSBTAP00000041651  ............................................------------------.-.----------...
ENSBTAP00000005154  ............................................------------------.-.----------...
ENSBTAP00000021174  ............................................------------------.-.----------...
ENSBTAP00000022068  ............................................------------------.-.-RLRAVFDAL...
ENSBTAP00000026682  ..........................................nt------------------.-.----------...
ENSBTAP00000007636  ............................................------------------.-.--LKLEFERH...
ENSBTAP00000027954  ............................................------------------.-.---------F...
ENSBTAP00000020778  ............................................------------------.-.----------...
ENSBTAP00000013601  ............................................------------------.-.----------...
ENSBTAP00000005477  ............................................------------------.-.----------...
ENSBTAP00000055305  ............................................------------------.-.----------...
ENSBTAP00000036054  ............................................------------------.-.----------...
ENSBTAP00000004912  ............................................------------------.L.EHAKQAFVQR...
ENSBTAP00000022292  ............................................------------------.-.----------...
ENSBTAP00000002717  ............................................------------------.-.----------...
ENSBTAP00000036015  ............................................------------------.L.KSIWYAFTAL...
ENSBTAP00000051638  ............................................------------------.-.----------...
ENSBTAP00000026766  ............................................------------------.-.----------...
ENSBTAP00000053738  ............................................------------------.-.----------...
ENSBTAP00000016306  ............................................------------------.-.----------...
ENSBTAP00000013714  ............................................------------------.-.----------...
ENSBTAP00000036550  ............................................------------------.-.----------...
ENSBTAP00000053738  ............................................------------------.-.----------...
ENSBTAP00000023383  ............................................------------------.-.-WLRKQFYSV...
ENSBTAP00000027030  ............................................------------------.-.----------...
ENSBTAP00000053270  ............................................------------------.-.----------...
ENSBTAP00000054640  ............................................------------------.-.----------...
ENSBTAP00000012770  ............................................------------------.-.----------...
ENSBTAP00000009967  ............................................------------TLTIEQ.L.DNLRDQFLDI...
ENSBTAP00000015183  ............................................-----------NQLTPGD.F.VQIQRAFEPS...
ENSBTAP00000014222  ............................................------------------.-.----------...
ENSBTAP00000026288  ............................................------------DWSVEH.E.TFLREAFSFV...
ENSBTAP00000002128  ............................................------------------.-.----------...
ENSBTAP00000003365  ............................................------------------.-.----------...
ENSBTAP00000053738  ............................................-----------------C.Y.EKVEKALSAG...
ENSBTAP00000009228  ............................................------------------.-.----------...
ENSBTAP00000026785  ............................................------------------.-.----------...
ENSBTAP00000002578  ............................................-------------LKDEL.L.KGIWHAFTAL...
ENSBTAP00000000106  ............................................-----------------S.I.EDLQGLFHKT...
ENSBTAP00000028840  ............................................------------------.-.-KILELFHKV...
ENSBTAP00000053594  ............................................------------------.-.----------...
ENSBTAP00000055414  .......................................revik------------------.-.----------...
ENSBTAP00000026698  ............................................------------------.-.----------...
ENSBTAP00000017015  ............................................-------------LTEEE.M.YSLTETFQQC...
ENSBTAP00000049908  ............................................------------------.-.----------...
ENSBTAP00000021395  ............................................------------------.-.----------...
ENSBTAP00000007194  ............................................------------------.-.----------...
ENSBTAP00000025455  ............................................------------------.-.----------...


                      0                              40                              50             
                      |                               |                               |             
d1dgua_               LP.......QEQR...............SVESSLR.....AQVPFE..Q...............I.LSLPE.......
ENSBTAP00000019411  DK.......DGDG...............TITTKEL.....GTVMRS..L...............G.QNPT-.......
ENSBTAP00000036057  DK.......DGDG...............TITTKEL.....GTVMRS..L...............G.QNPT-.......
ENSBTAP00000038404  CP.......--SG...............HLSMEEF.....KKIY--..-...............G.NFFPY.......
ENSBTAP00000010971  CP.......--TG...............ILNVDEF.....KKIYAN..F...............F.PYGD-.......
ENSBTAP00000019803  AG.......D-DM...............EVSATEL.....MNILNK..V...............V.TRHPDlktd...
ENSBTAP00000014038  DL.......DNSG...............SLSVEEF.....MSLPE-..-...............-.-----.......
ENSBTAP00000002055  DK.......DGDG...............TITTKEL.....GTVMRS..L...............G.QNPT-.......
ENSBTAP00000049731  DK.......DGDG...............TITTKEL.....GTVMRS..L...............G.QNPT-.......
ENSBTAP00000005577  CP.......--TG...............HLTVDEF.....KKIYAN..F...............F.PYGD-.......
ENSBTAP00000034949  CP.......--SG...............RITRQEF.....QTIYSK..F...............F.PEAD-.......
ENSBTAP00000017447  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000010858  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000046644  SA.......D---...............---RKRV.....ETALEA..C...............S.LPS--.......
ENSBTAP00000022814  CP.......--SG...............RLNLEEF.....QQLYVK..F...............F.PYGD-.......
ENSBTAP00000019758  --.......--DG...............YLSHTEL.....APLRAP..L...............I.PM---.......
ENSBTAP00000019321  CP.......--SG...............ILNLEEF.....QQLYIK..F...............F.PYGD-.......
ENSBTAP00000011677  AG.......D-DM...............EICADEL.....KNVLNR..V...............V.NKHKDlktq...
ENSBTAP00000011680  AG.......D-DM...............EICADEL.....KNVLNR..V...............V.NKHKDlktq...
ENSBTAP00000021742  CP.......--SG...............IVNEENF.....KQIYSQ..F...............F.PQGD-.......
ENSBTAP00000005348  DQh......PRDR...............VLTHSEL.....APLRAS..L...............V.PM---.......
ENSBTAP00000016609  QV.......NQDG...............RIPVKNI.....LKMFSA..D...............-.-----.......
ENSBTAP00000012740  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000018403  DK.......NKDG...............TISVQEL.....GTVMQE..V...............G.LKLS-.......
ENSBTAP00000026407  AI.......HGDP...............KASGHEMngknwAKLCKD..Ckvad...........G.KAVT-.......
ENSBTAP00000052557  DA.......DGSG...............TIDVKEL.....KVAMRA..L...............G.FEPR-.......
ENSBTAP00000054167  CP.......--SG...............VVNEDTF.....KEIYSQ..F...............F.PQGD-.......
ENSBTAP00000010319  DA.......DGTG...............TIDVKEL.....KVAMRA..L...............G.FEPK-.......
ENSBTAP00000041545  DK.......NQDG...............RMSFGEV.....QRLLHL..M...............N.VEMD-.......
ENSBTAP00000055204  DK.......DRSG...............VISDNEL.....QQAL--..-...............-.SNGTWt......
ENSBTAP00000003718  CP.......--SG...............VVNEETF.....KQIYAQ..F...............F.PHGD-.......
ENSBTAP00000011676  AG.......K-DS...............EIRANEL.....RTALNE..V...............F.SKRTDikfd...
ENSBTAP00000049395  DK.......NKDN...............KMSFKEL.....QNFLKE..L...............N.IQVD-.......
ENSBTAP00000054983  AV.......HGDA...............RASGREMhgknwSKLCRD..Cqvid...........G.RSVT-.......
ENSBTAP00000052219  AG.......Q-DG...............QIDADEL.....QRCLTQ..S...............G.IAGGYk......
ENSBTAP00000025402  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000011678  AG.......E-DM...............EISVKEL.....RTILNR..I...............I.SKHKDlrtt...
ENSBTAP00000000433  --.......----...............EMNNKNF.....SKLCKD..C...............G.IMDGK.......
ENSBTAP00000021491  DV.......DGSG...............TIDVKEL.....KIAMRA..L...............G.FEPK-.......
ENSBTAP00000044733  AG.......E-DA...............EISAFEL.....QTILRR..V...............L.AKRQDiksd...
ENSBTAP00000010937  DK.......NGDG...............LLNIEEI.....HQLMHK..L...............N.VNLP-.......
ENSBTAP00000056439  DK.......NGDG...............LLNIEEI.....HQLMHK..L...............N.VNLP-.......
ENSBTAP00000055780  LG.......AEDG...............CISTKEL.....GKVMRM..L...............G.QNPT-.......
ENSBTAP00000038002  --.......---D...............AIGYEGF.....QQFLKIylE...............V.DNVP-.......
ENSBTAP00000034705  DS.......NQDS...............KMSFKEI.....KNLLRM..V...............N.LDMN-.......
ENSBTAP00000035936  CP.......--SG...............TLFMHEF.....KRFFKV..P...............D.NEEA-.......
ENSBTAP00000013699  DS.......DHSG...............YISIKEL.....KQALVN..S...............N.WS---.......
ENSBTAP00000002564  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000011496  CP.......--SG...............QLDAAGF.....QKIYKQ..F...............F.PFGD-.......
ENSBTAP00000019111  DT.......DKDE...............AIDYHEL.....KVAMRA..L...............G.FDVK-.......
ENSBTAP00000017036  CP.......--SG...............QLTLYEF.....RQFF--..-...............G.LKNLS.......
ENSBTAP00000003213  DK.......NGDG...............SLSIGEV.....LQLLHK..L...............N.VNLP-.......
ENSBTAP00000055444  DK.......NGDG...............SLSIGEV.....LQLLHK..L...............N.VNLP-.......
ENSBTAP00000024550  AG.......Q-DG...............EVDAEEL.....QKCLTQ..S...............G.ISGTYs......
ENSBTAP00000015248  DQ.......NRDG...............FIDKEDL.....HDMLAS..M...............G.KNPT-.......
ENSBTAP00000021328  DQ.......NRDG...............FIDKEDL.....HDMLAS..L...............G.KNPT-.......
ENSBTAP00000037091  DQ.......NRDG...............FIDKEDL.....HDMLAS..L...............G.KNPT-.......
ENSBTAP00000029967  DR.......DRDG...............YIGYQEL.....GACMRT..L...............G.YMPT-.......
ENSBTAP00000021449  DK.......DRDG...............FISCKDL.....GNLMRT..M...............G.YMPT-.......
ENSBTAP00000053176  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000042361  DK.......DKDG...............YINCRDL.....GNCMRT..M...............G.YMPT-.......
ENSBTAP00000016509  CP.......--SG...............TLFMHEF.....KRFFKV..P...............D.NEEA-.......
ENSBTAP00000026714  DK.......DKDG...............YINCRDL.....GNCMRT..M...............G.YMPT-.......
ENSBTAP00000004690  AG.......GEGK...............EIGMYEL.....QKLLNK..V...............V.SRFKNfktk...
ENSBTAP00000010858  --.......----...............-------.....------..S...............-.-----.......
ENSBTAP00000013117  DV.......DDLG...............HITLCSA.....VQCIRN..L...............N.PGLKT.......
ENSBTAP00000017574  DD.......FKGG...............KITLEKA.....LKLLEK..L...............D.IQCN-.......
ENSBTAP00000004885  DR.......NGDG...............VVDISEL.....QEGLKS..L...............G.IPLG-.......
ENSBTAP00000008961  --.......----...............-VPWKSF.....RQALHE..V...............H.PISS-.......
ENSBTAP00000028063  --.......DHST...............EISVSRL.....ETVISS..I...............Y.YQLN-.......
ENSBTAP00000012740  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000006283  DT.......DHDG...............YIGYRDL.....GECMRT..L...............G.YMPT-.......
ENSBTAP00000014306  DR.......TGDG...............KILYSQC.....GDVMRA..L...............G.QNPT-.......
ENSBTAP00000053252  DI.......DGNG...............IMLEDTS.....VELIKQ..L...............N.PTLK-.......
ENSBTAP00000014304  DR.......TGDG...............KILYSQC.....GDVMRA..L...............G.QNPT-.......
ENSBTAP00000045669  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000041264  --.......----...............-LPWAEF.....EAVLCI..C...............H.PVEP-.......
ENSBTAP00000006711  --.......----...............-LTPEEF.....GQLQKY..A...............E.YS---.......
ENSBTAP00000017358  --.......----...............IVPWKVF.....RQCLHE..V...............H.QISS-.......
ENSBTAP00000053274  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000055296  --.......----...............IVPWKVF.....RQCLHE..V...............H.QISS-.......
ENSBTAP00000016852  DD.......NNNR...............TLDFKEF.....VKGLND..Y...............A.VVME-.......
ENSBTAP00000036380  DK.......QQRG...............KIKATDL.....LTVMRC..L...............G.ASPT-.......
ENSBTAP00000041719  DR.......VGDG...............KIQFSQC.....GDVMRA..L...............G.QNPT-.......
ENSBTAP00000049636  DR.......TGEC...............KITLSQV.....GDVLRA..L...............G.TNPT-.......
ENSBTAP00000024444  DQ.......NRDG...............FIDKNDL.....RDTFAA..L...............GrVNVK-.......
ENSBTAP00000004556  DM.......NYDL...............LLDHSEI.....NAIY--..-...............-.LDKY-.......
ENSBTAP00000038767  DK.......GENG...............TLSREDF.....QRIPEL..A...............I.NPLG-.......
ENSBTAP00000031285  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000011457  VT.......ERQGvii............GLDRNAF.....RNILHM..T...............F.GMTD-.......
ENSBTAP00000011047  DRtp.....KCEM...............KITYGQC.....GDVLRA..L...............G.QNPT-.......
ENSBTAP00000002564  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000037104  DQ.......NRDG...............FIDKEDL.....RDTFAApgC...............R.INVK-.......
ENSBTAP00000002672  DQ.......NRDG...............IICKSDL.....RETYSQ..L...............G.KVNV-.......
ENSBTAP00000028269  DQ.......NRDG...............IIDKEDL.....RDTFAA..M...............GrLNVK-.......
ENSBTAP00000016647  DR.......TGKG...............YLSRMDL.....QQIGAL..A...............V.NPLG-.......
ENSBTAP00000004536  DS.......NKDG...............RVDIREL.....RQGLAR..L...............G.GGDP-.......
ENSBTAP00000042177  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000028063  --.......----...............-MIF---.....------..-...............-.-----.......
ENSBTAP00000050283  DR.......TPTGel.............KIAYGQC.....GDVLRA..L...............G.QNPT-.......
ENSBTAP00000048539  DKyaeiavaSKGG...............KIGIEEF.....ANYLKL..P...............I.-----.......
ENSBTAP00000045669  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000007972  DQ.......DGSR...............SLDVREL.....QRGLAE..L...............G.LVLD-.......
ENSBTAP00000040815  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000025661  SS.......SKGG...............RIGIEEF.....AEYLK-..-...............-.-LPV-.......
ENSBTAP00000028350  LP.......QEHR...............SVEESLQ.....ARVSLE..Q...............I.LSLPE.......
ENSBTAP00000053274  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000021537  APqlvpl..D---...............YTSCPDV.....K-----..-...............-.----Vpyeligs
ENSBTAP00000055481  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000039155  HS.......DSNS...............TIPMQEL.....GTVLWP..L...............G.PNPT-.......
ENSBTAP00000029333  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000016315  QP.......DPSS...............FISGSVA.....KNFFTK..S...............K.LSIP-.......
ENSBTAP00000021091  --.......----...............-INAIQL.....QNILNH..M...............P.WSGLGskqp...
ENSBTAP00000021618  --.......----...............-----EF.....A---ES..L...............G.LKPQ-.......
ENSBTAP00000055520  --.......----...............TLSVQQL.....FQALQE..M...............F.QKVR-.......
ENSBTAP00000055624  --.......----...............TLSVQQL.....FQALQE..M...............F.QKVR-.......
ENSBTAP00000016319  QP.......DLNG...............FIPGSAA.....KEFFTK..S...............K.LPIL-.......
ENSBTAP00000034078  DH.......ESNN...............TVDVREV.....GTIIRS..L...............G.CCPS-.......
ENSBTAP00000006645  CP.......PGKYykea...........TLTVDQV.....SSLPAL..R...............V.NPFR-.......
ENSBTAP00000021909  DK.......DGDL...............IATKEEF.....TAFLHP..-...............-.-EEYD.......
ENSBTAP00000001426  DA.......DGNG...............YIEGKEL.....ENFFQE..Lekarkgs........G.MVSKS.......
ENSBTAP00000015802  --.......----...............------L.....KSIFKL..S...............V.FIPSQef.....
ENSBTAP00000032680  --.......----...............------L.....KSIFKL..S...............V.FIPSQef.....
ENSBTAP00000055007  DA.......DGGG...............DISVKEL.....GTVMRM..L...............G.QTPT-.......
ENSBTAP00000020148  AGrd.....GNNS...............KLSKAEF.....LIFMNTe.L...............G.AFTKN.......
ENSBTAP00000052345  DK.......DMDG...............FVSGLEV.....REIFLK..T...............G.LP---.......
ENSBTAP00000029334  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000052345  CP.......V-NG...............FLSGDKV.....KPVLLN..S...............K.LPVD-.......
ENSBTAP00000056127  DL.......DSDQ...............TATREEF.....TAFLHPe.E...............F.EHMK-.......
ENSBTAP00000012557  DR.......NKSG...............KLSMGQW.....AFSMENv.L...............G.LNLPW.......
ENSBTAP00000011888  AG.......E-DG...............EINLQDF.....KKALKV..-...............-.-----.......
ENSBTAP00000017060  LP.......V-NG...............LLSGDKV.....KPVLMN..S...............K.LPLD-.......
ENSBTAP00000031854  DS.......DHDL...............YISQADL.....SRYN--..-...............D.QASS-.......
ENSBTAP00000031823  DQ.......DGDS...............MATREEL.....TAFLHPe.E...............F.PHMR-.......
ENSBTAP00000021603  --.......----...............-----EF.....A---ES..L...............G.LKPQ-.......
ENSBTAP00000010838  SG.......S-DD...............TIEKEDL.....LRLMKD..N...............F.PNFLGace....
ENSBTAP00000014575  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000011215  DS.......DHDL...............YISQADL.....SRYN--..-...............D.QASS-.......
ENSBTAP00000053698  DR.......DGNG...............FISKQEL.....GMAMRS..L...............G.YMPS-.......
ENSBTAP00000006806  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000029334  KP.......S-GG...............YITGDQA.....RTFFLQ..S...............G.LPAP-.......
ENSBTAP00000044105  SG.......S-DD...............TIEKEDL.....LRLMKE..N...............F.PNFLSace....
ENSBTAP00000026904  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000017060  DL.......DLDG...............YVSGQEV.....KEIFMH..S...............G.LT---.......
ENSBTAP00000055520  AE.......NNRGghdlga.........RMTRRVL.....RNLLTD..L...............Q.Q----.......
ENSBTAP00000044226  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000055624  AE.......NNRGghdlga.........RMTRRVL.....RNLLTD..L...............Q.Q----.......
ENSBTAP00000042182  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000010796  DF.......NKQG...............EIPGPEF.....LALVEK..F...............N.LDIS-.......
ENSBTAP00000021174  DA.......DGSG...............YLEGKEL.....QNLIQE..L...............Q.QARKKag.....
ENSBTAP00000006275  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000020950  NQ.......DSGP...............GLNLEEF.....IAFEHPe.E...............V.DYMT-.......
ENSBTAP00000053738  DF.......NKQG...............EIPGPEF.....LALVEK..F...............N.LDIS-.......
ENSBTAP00000004963  VG.......RGDVklanv..........GLDRNTF.....RVILHS..I...............F.GMTD-.......
ENSBTAP00000023774  DR.......DGNG...............FISKQEL.....GTAMRS..L...............G.YMPN-.......
ENSBTAP00000020395  DK.......DKSG...............RLNHQEF.....KSCLRS..L...............G.YDLPMvee....
ENSBTAP00000020150  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000025561  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000053738  DT.......DRDG...............ILTMHDL.....HRLLQH..L...............L.FNLK-.......
ENSBTAP00000034009  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000020539  DK.......DETG...............LIALSDW.....AAAVESv.L...............H.LGLPW.......
ENSBTAP00000020778  NP.......PPDL...............LLTESEF.....LSFL--..-...............H.PEHSR.......
ENSBTAP00000017461  DE.......DNKG...............YLSREDF.....KVAVVMl.F...............G.YKPS-.......
ENSBTAP00000044096  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000008523  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000035196  DQ.......DNDG...............TLNDAEL.....NFFQRI..C...............F.NTPLA.......
ENSBTAP00000041997  SP.......V-DG...............KITGANA.....KKEMVR..S...............K.LP---.......
ENSBTAP00000025499  D-.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000055481  KP.......I-SG...............FITGNWI.....EKLFFQ..S...............G.LP---.......
ENSBTAP00000002174  SP.......V-NG...............KITGANA.....KKEMVK..S...............K.LP---.......
ENSBTAP00000000589  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000028239  AP.......A-DG...............KLSGTKA.....KTWMV-..-...............G.TKLP-.......
ENSBTAP00000014894  DK.......DHGG...............ALGPEEF.....KACLIS..L...............G.YDVENd......
ENSBTAP00000026544  DA.......DSSG...............FISAAEL.....CNFLRD..L...............F.LHHKKaise...
ENSBTAP00000029333  KP.......I-SG...............FITGNWI.....EKLFFQ..S...............G.LP---.......
ENSBTAP00000041966  --.......----...............DIDATQL.....QSLLNRefL...............R.GPPGD.......
ENSBTAP00000008933  --.......--NG...............KISGINA.....KKEMVT..S...............K.LP---.......
ENSBTAP00000056088  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000033794  AR.......EGDAe..............TLSLEEL.....KALLMD..N...............V.PRFMEtlg....
ENSBTAP00000012786  DR.......RKNG...............LMDHEDF.....RACLIS..M...............G.YDLG-.......
ENSBTAP00000030018  DR.......KRNG...............MMEPDDF.....RACLIS..M...............G.YDLG-.......
ENSBTAP00000040233  DT.......ANNM...............TVTKSEL.....RRVITT..F...............L.LPLT-.......
ENSBTAP00000003365  KS.......SLDN...............IISKDQL.....YLALQH..A...............G.RNPS-.......
ENSBTAP00000053176  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000024301  DR.......DHSG...............TLGPEEF.....KACLIS..L...............G.YDIGNd......
ENSBTAP00000022292  AStev....DGEH...............YMTPEDF.....VQRYLG..L...............Y.NDPN-.......
ENSBTAP00000015611  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000012770  DK.......DHNG...............MLSKEEL.....SRYG--..-...............T.ATMT-.......
ENSBTAP00000000847  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000053738  DT.......ANNM...............TVTKSEL.....RRVITT..F...............L.LPLT-.......
ENSBTAP00000054975  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000046639  DK.......EGNG...............LLDKADF.....KQALKL..F...............R.LEVS-.......
ENSBTAP00000052345  DT.......GNTG...............RVLASDA.....AVFLKK..S...............G.LP---.......
ENSBTAP00000053164  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000016774  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000022630  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000010796  DK.......EDTG...............FVKASDF.....GQVLKD..F...............C.YKLT-.......
ENSBTAP00000021909  DA.......DKDG...............FVTEGEL.....KSWIKH..A...............Q.KKYI-.......
ENSBTAP00000033974  SE.......EGKG...............QVKTDEL.....EWLVSL..L...............G.INST-.......
ENSBTAP00000006711  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000010796  DS.......EGNG...............ILRRRDM.....KNALYG..F...............D.IPLT-.......
ENSBTAP00000004912  EK.......NGEF...............FMSPNDF.....VTRYLNi.F...............G.ESQP-.......
ENSBTAP00000005979  DQ.......DMDQ...............ALSDQEL.....NAFQTS..C...............F.GHPLA.......
ENSBTAP00000053738  DK.......EDTG...............FVKASDF.....GQVLKD..F...............C.YKLT-.......
ENSBTAP00000053746  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000023221  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000019429  DA.......GRDG...............FIDLMEL.....KLMMEK..L...............G.APQT-.......
ENSBTAP00000052019  AK.......ENGDst.............SLCKEEL.....KQLLLAe.F...............G.DILRR.......
ENSBTAP00000042244  DA.......GRDG...............FIDLMEL.....KLMMEK..L...............G.APQT-.......
ENSBTAP00000053738  KS.......KPDG...............QITGQEL.....QRILNC..M...............V.VKIS-.......
ENSBTAP00000018877  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000053019  DI.......DNSG...............YVSDYEL.....QDLFKE..A...............S.LPLPG.......
ENSBTAP00000003073  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000012886  DA.......DQKG...............FITIVDV.....QRVLES..I...............G.VQMD-.......
ENSBTAP00000044222  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000028499  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000047378  DT.......TGTG...............FLDREEL.....TQLCLK..L...............H.LE---.......
ENSBTAP00000009308  DT.......DGNG...............YISCSEL.....NDLFKA..A...............C.LPLPG.......
ENSBTAP00000017060  DP.......AYTG...............RVGASEA.....ALFLKK..S...............G.LS---.......
ENSBTAP00000050406  DL.......NSNG...............FICDYEL.....HELFKE..A...............N.MPLPG.......
ENSBTAP00000031879  DL.......NSNG...............FICDYEL.....HELFKE..A...............N.MPLPG.......
ENSBTAP00000031854  --.......--DQ...............KADVYEM.....GKIAKA..C...............G.CPLYW.......
ENSBTAP00000001250  --.......----...............---LPEF.....AAQL--..-...............-.GVPE-.......
ENSBTAP00000026035  ARme.....GDCA...............VLERGEL.....KRLLEK..E...............F.ADVIVk......
ENSBTAP00000011215  --.......--DQ...............KADVYEM.....GKIAKA..C...............G.CPLYW.......
ENSBTAP00000002128  --.......--EN...............YIDAEEL.....QSILPS..I...............G.ITLS-.......
ENSBTAP00000053194  DE.......NLTG...............RLSHKDF.....RSCLRG..L...............N.YYLPMvee....
ENSBTAP00000056127  DS.......DGDG...............FVTTEEL.....KTWIKR..V...............Q.KRYI-.......
ENSBTAP00000033188  DK.......DQDG...............KITRQEF.....IDGILA..S...............K.FPTT-.......
ENSBTAP00000053548  DK.......DQDG...............KITRQEF.....IDGILS..S...............K.FPTS-.......
ENSBTAP00000011687  DV.......HHKK...............TLNDVLF.....YHFLHH..V...............-.TDLT-.......
ENSBTAP00000007636  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000020950  DL.......DSDG...............FLTESEL.....SSWIQM..S...............F.KHYA-.......
ENSBTAP00000009115  NK.......DKTG...............CIDLHGM.....MCTLAK..L...............G.MNLT-.......
ENSBTAP00000023873  CP.......--TG...............LVDEDTF.....KLIYSQ..F...............F.PQGD-.......
ENSBTAP00000054471  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000039694  -S.......NGMN...............TISEEDF.....AHILLRy.T...............N.VENT-.......
ENSBTAP00000025205  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000047882  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000001368  --.......----...............-------.....------..-...............-.---MV.......
ENSBTAP00000029786  HLtscywggN-SNaldrhdpslpyleqyRIDLEQF.....KGMFAL..L...............F.PWACG.......
ENSBTAP00000028993  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000023678  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000034710  SS.......SPTG...............SVDMRSM.....KAALSN..V...............G.VQLS-.......
ENSBTAP00000031823  DRag.....DGDG...............WVSLAEL.....RSWIAH..T...............Q.QRHI-.......
ENSBTAP00000038002  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000021074  AR.......EDAA...............TLTCTEL.....KQLIQS..E...............F.EDIFQ.......
ENSBTAP00000026544  DV.......EEKG...............YIEEKEL.....DAFFYH..M...............L.TKLGVdd.....
ENSBTAP00000007217  -A.......DRDH...............FIRTLSL.....KPLLFE..I...............P.GFLS-.......
ENSBTAP00000029792  --.......----...............RIDAHQF.....RELFAS..L...............T.PWACG.......
ENSBTAP00000044088  DA.......DGDE...............MVEKKEF.....FKLQKI..IskqddlktaitdeteC.QEQTV.......
ENSBTAP00000017319  -S.......DPDG...............KLRKATA.....KNLLQT..Q...............F.KNFAEg......
ENSBTAP00000044100  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000033594  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000026766  AQ.......SRTG...............RFDLETF.....GPLV--..-...............S.PPIR-.......
ENSBTAP00000055894  DL.......NNEG...............EIDLMSL.....KRMMEK..L...............G.VPKT-.......
ENSBTAP00000015220  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000033613  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000056320  DT.......DHDL...............LIDAQDL.....ARHN--..-...............D.HAIS-.......
ENSBTAP00000025249  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000029159  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000044088  ME.......NLQA...............EVQEMEF.....LQFSKG..L...............S.FMRK-.......
ENSBTAP00000016319  DI.......ESTK...............KVSANGR.....VLELFRa.A...............Q.LP---.......
ENSBTAP00000017662  NG.......--HG...............EVDAQSL.....ENILLL..V...............G.ISLT-.......
ENSBTAP00000012479  DP.......VSSG...............FLLQSQL.....SHLFLR..L...............E.VPLQ-.......
ENSBTAP00000029886  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000027388  DL.......NEDG...............GIDIMSL.....KRMMEK..L...............G.VPKT-.......
ENSBTAP00000039694  --.......----...............-LSKQEL.....NQMLSE..T...............P.PVWK-.......
ENSBTAP00000023673  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000041488  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000001452  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000028498  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000001426  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000020240  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000053650  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000041651  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000005154  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000021174  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000022068  DG.......DGDG...............FVRIEDF.....VQFATV..Y...............G.-----.......
ENSBTAP00000026682  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000007636  DP.......V-DG...............RITERQF.....GGMLLA..Y...............S.GVQS-.......
ENSBTAP00000027954  DP.......GNTG...............FISTGKF.....RSLLDS..H...............S.SKLD-.......
ENSBTAP00000020778  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000013601  --.......----...............--DTAKL.....YPILMS..S...............G.LP---.......
ENSBTAP00000005477  --.......----...............-ICLSEL.....PFVMRA..I...............G.FYPS-.......
ENSBTAP00000055305  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000036054  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000004912  DS.......ARTG...............KVTAIDF.....RDIMVT..I...............R.PHVL-.......
ENSBTAP00000022292  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000002717  --.......----...............-ISLREL.....KTILPL..V...............N.FKVS-.......
ENSBTAP00000036015  DV.......EKSG...............KVSKSQL.....KVLSHN..L...............Y.TVLHI.......
ENSBTAP00000051638  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000026766  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000053738  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000016306  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000013714  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000036550  --.......----...............RIDAQQF.....ARLFQL..V...............S.PWTCG.......
ENSBTAP00000053738  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000023383  DR.......NRED...............RISAKDL.....KNMLSQ..V...............N.YRVP-.......
ENSBTAP00000027030  --.......-RDG...............HLNRKKL.....VSICEQ..Y...............G.LQNV-.......
ENSBTAP00000053270  --.......-RDG...............HLNRKKL.....VSICEQ..Y...............G.LQNV-.......
ENSBTAP00000054640  --.......-RDG...............HLNRKKL.....VSICEQ..Y...............G.LQNV-.......
ENSBTAP00000012770  --.......----...............MINYENF.....LKVGEK..A...............G.PKCK-.......
ENSBTAP00000009967  AP.......--KG...............IIGNKAF.....ADLLLD..Lvtlnlgtnnfpss..W.MNLT-.......
ENSBTAP00000015183  EP.......SQTI...............CMSREEF.....VQRMTE..I...............V.GWGT-.......
ENSBTAP00000014222  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000026288  DR.......G-DG...............TVTKEDF.....VLTLEE..R...............Q.DFVN-.......
ENSBTAP00000002128  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000003365  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000053738  DP.......CTSG...............YVSLNYL.....KIVLDT..F...............V.YRLP-.......
ENSBTAP00000009228  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000026785  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000002578  DL.......DHSG...............KVSKSQL.....KVLSHN..L...............C.TVLKV.......
ENSBTAP00000000106  GQ.......DVDG...............KLTYQQI.....EDTLES..V...............G.PEPE-.......
ENSBTAP00000028840  DQ.......G-KH...............QISREEF.....IVALKA..I...............G.VPLK-.......
ENSBTAP00000053594  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000055414  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000026698  --.......---R...............RISQEEF.....AKQLQL..-...............-.--SD-.......
ENSBTAP00000017015  KV.......IPDC...............SLTLEDF.....LRYRHQ..T...............A.KRGNSdrals..
ENSBTAP00000049908  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000021395  --.......----...............RVKVEKL.....EMALNY..L...............G.IQPT-.......
ENSBTAP00000007194  --.......----...............-------.....------..-...............-.-----.......
ENSBTAP00000025455  --.......----...............-------.....------..-...............-.-----.......


                            60                 70                                        80         
                             |                  |                                         |         
d1dgua_               ...LKANPFKERIC..RVF.......STSP.....A..............K.............DSLSFED.......
ENSBTAP00000019411  ...---EAELQDMI..NEV.......DA-D.....G..............N.............GTIDFPE.......
ENSBTAP00000036057  ...---EAELQDMI..NEV.......DA-D.....G..............N.............GTIDFPE.......
ENSBTAP00000038404  ...GDASKFAEHVF..RTF.......DA-N.....G..............D.............GTIDFRE.......
ENSBTAP00000010971  ...--ASKFAEHVF..RTF.......DT-N.....S..............D.............GTIDFRE.......
ENSBTAP00000019803  ...GFGIDTCRSMV..AVM.......DS-D.....T..............T.............GKLGFEE.......
ENSBTAP00000014038  ...LQQNPLVQRVI..DIF.......DT-D.....G..............N.............GEVDFKE.......
ENSBTAP00000002055  ...---EAELQDMI..NEV.......DA-D.....G..............N.............GTIDFPE.......
ENSBTAP00000049731  ...---EAELQDMI..NEV.......DA-D.....G..............N.............GTIDFPE.......
ENSBTAP00000005577  ...--ASKFAEHVF..RTF.......DT-N.....G..............D.............GTIDFRE.......
ENSBTAP00000034949  ...--PKAYAQHVF..RSF.......DA-N.....S..............D.............GTLDFKE.......
ENSBTAP00000017447  ...-----------..---.......----.....-..............-.............--FTYEK.......
ENSBTAP00000010858  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000046644  ...-----------..---.......---S.....R..............N.............DSIPQED.......
ENSBTAP00000022814  ...--ASKFAQHAF..RTF.......DK-N.....G..............D.............GTIDFRE.......
ENSBTAP00000019758  ...---EHCTTRFF..ETC.......DL-D.....N..............D.............KYIALDE.......
ENSBTAP00000019321  ...--ASKFAQHAF..RTF.......DK-N.....G..............D.............GTIDFRE.......
ENSBTAP00000011677  ...GFTLESCRSMI..ALM.......DT-D.....G..............S.............GRLNLQE.......
ENSBTAP00000011680  ...GFTLESCRSMI..ALM.......DT-D.....G..............S.............GRLNLQE.......
ENSBTAP00000021742  ...--SSTYATFLF..NAF.......DT-N.....H..............D.............GSVSFED.......
ENSBTAP00000005348  ...---EHCITRFF..EEC.......DP-N.....K..............D.............KHITLQE.......
ENSBTAP00000016609  ...---KKRVETAL..ESCgl.....NF-N.....R..............S.............ESIRPDE.......
ENSBTAP00000012740  ...-------NEVF..EQH.......KLNQ.....N..............D.............QLLSVPD.......
ENSBTAP00000018403  ...---EAELKKLI..SQL.......DT-D.....K..............N.............GSISFQE.......
ENSBTAP00000026407  ...---GTDVDIVF..SKV.......KA-K.....S..............A.............RVINYEE.......
ENSBTAP00000052557  ...---KEEMKRMI..ADV.......DK-E.....G..............T.............GKISFND.......
ENSBTAP00000054167  ...--STTYAHFLF..NAF.......DT-D.....H..............N.............GAVSFED.......
ENSBTAP00000010319  ...---KEEIKKMI..SEI.......DK-E.....G..............T.............GKMNFSD.......
ENSBTAP00000041545  ...---QEYAFQLF..QTA.......DT-S.....Q..............S.............GTLEGEE.......
ENSBTAP00000055204  ...PFNPVTVRSII..SMF.......DR-E.....N..............K.............AGVNFSE.......
ENSBTAP00000003718  ...--ASMYAHYLF..HAF.......DT-T.....Q..............T.............GSVKFED.......
ENSBTAP00000011676  ...GFDINTCREMI..SLM.......DS-N.....G..............T.............GSLELVE.......
ENSBTAP00000049395  ...---DSYARKIF..KEC.......DH-S.....Q..............T.............DSLEDEE.......
ENSBTAP00000054983  ...---VTDVDIVF..SKI.......KG-K.....S..............C.............RTITFEQ.......
ENSBTAP00000052219  ...PFNLETCRLMV..SML.......DR-D.....M..............S.............GTMGFNE.......
ENSBTAP00000025402  ...-----------..--L.......PK-G.....K..............N.............DAINPED.......
ENSBTAP00000011678  ...GFSLESCRSMV..NLM.......DR-D.....G..............N.............GKLGLVE.......
ENSBTAP00000000433  ...TVTSTDVDIVF..SKV.......KA-K.....N..............A.............RTITFQQ.......
ENSBTAP00000021491  ...---KEEIKKMI..AET.......DK-E.....G..............I.............GTISFEK.......
ENSBTAP00000044733  ...GFSIETCKIMV..DML.......DS-D.....G..............S.............GKLGLKE.......
ENSBTAP00000010937  ...---RRKVRQMF..QEA.......DTDE.....N..............Q.............GTLTFEE.......
ENSBTAP00000056439  ...---RRKVRQMF..QEA.......DTDE.....N..............Q.............GTLTFEE.......
ENSBTAP00000055780  ...---PEELQEMI..DEV.......DE-D.....G..............S.............GTVDFDE.......
ENSBTAP00000038002  ...---DHLSQALF..QSFqtgyyieDT-V.....R..............E.............DVVCLSD.......
ENSBTAP00000034705  ...---DMYAYGLF..KEC.......DR-S.....K..............N.............ERLEGPE.......
ENSBTAP00000035936  ...---TQYVEAMF..RAF.......DT-N.....G..............D.............NTIDFLE.......
ENSBTAP00000013699  ...SFNDETCLMMI..NMF.......DK-T.....K..............S.............GRIDVYG.......
ENSBTAP00000002564  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000011496  ...--PTKFATFVF..NVF.......DE-N.....K..............D.............GRIEFSE.......
ENSBTAP00000019111  ...---KADVLKIL..KDY.......DR-E.....A..............T.............GKITFED.......
ENSBTAP00000017036  ...PWASQYVEQMF..ETF.......DF-N.....K..............D.............GYIDFME.......
ENSBTAP00000003213  ...---RQRVKQMF..KEA.......DTDD.....H..............Q.............GTLGFEE.......
ENSBTAP00000055444  ...---RQRVKQMF..KEA.......DTDD.....H..............Q.............GTLGFEE.......
ENSBTAP00000024550  ...PFSLETCRIMI..AML.......DR-D.....Y..............S.............GKMGFNE.......
ENSBTAP00000015248  ...---DEYLEGMM..SEA.......PG--.....-..............-.............-PINFTM.......
ENSBTAP00000021328  ...---DEYLDAMM..NEA.......PG--.....-..............-.............-PINFTM.......
ENSBTAP00000037091  ...---DAYLEAMM..NEA.......PG--.....-..............-.............-PINFTM.......
ENSBTAP00000029967  ...---EMELIEIS..QQI.......SG--.....-..............-.............GKVDFED.......
ENSBTAP00000021449  ...---EMELIELG..QQI.......RM-N.....L..............G.............GRVDFDD.......
ENSBTAP00000053176  ...---TKKLKDVL..EEF.......HG-N.....GvlakynpegkqdilN.............QTIDFEG.......
ENSBTAP00000042361  ...---EMELIELS..QQI.......NM-N.....L..............G.............GHVDFDD.......
ENSBTAP00000016509  ...---TQYVEAMF..RAF.......DT-N.....G..............D.............NTIDFLE.......
ENSBTAP00000026714  ...---EMELIELS..QQI.......NM-N.....L..............G.............GHVDFDD.......
ENSBTAP00000004690  ...GFSLDVCRCMV..NLL.......DK-D.....G..............S.............GKLGLRE.......
ENSBTAP00000010858  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000013117  ...SKIELKFKELH..KSR.......DK-T.....G..............T.............DVI-KEE.......
ENSBTAP00000017574  ...---TIHVKYIF..KDN.......DR-L.....K..............Q.............GRITIEE.......
ENSBTAP00000004885  ...---QDAEEKIF..TTG.......DV-N.....K..............D.............GKLDFEE.......
ENSBTAP00000008961  ...---GLEAMALK..STI.......DL-T.....C..............N.............DYISVFE.......
ENSBTAP00000028063  ...-------KRL-..---.......---P.....S..............T.............HQISVEQ.......
ENSBTAP00000012740  ...-----------..---.......---N.....N..............K.............PEISVKE.......
ENSBTAP00000006283  ...---EMELIEVS..QHV.......KM-R.....M..............G.............GRVDFEE.......
ENSBTAP00000014306  ...---NAEVLKVL..GNP.......KS-Dem...N..............V.............KVLDFEH.......
ENSBTAP00000053252  ...---ESKIRLKF..KEI.......QK-S.....K..............Eklt..........TRVTEEE.......
ENSBTAP00000014304  ...---NAEVLKVL..GNP.......KS-Dem...N..............V.............KVLDFEH.......
ENSBTAP00000045669  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000041264  ...---GSTALALR..STI.......DL-T.....C..............S.............GHVSIFE.......
ENSBTAP00000006711  ...---SKKIKYVL..AEF.......NE-G.....G..............Slkqygph......EPISYDV.......
ENSBTAP00000017358  ...---GLEAMALK..STI.......DL-T.....C..............N.............DYISVFE.......
ENSBTAP00000053274  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000055296  ...---GLEAMALK..STI.......DL-T.....C..............N.............DYISVFE.......
ENSBTAP00000016852  ...---KEEAEELF..RRF.......DK-D.....G..............N.............GTIDFNE.......
ENSBTAP00000036380  ...---PGEAQRHL..QTH.......RI-D.....R..............N.............GELDFST.......
ENSBTAP00000041719  ...---NAEVLRVL..GYP.......KS-Del...K..............S.............RRVDFET.......
ENSBTAP00000049636  ...---NAEVKKVL..GNP.......SN-Eem...N..............A.............KKIEFEQ.......
ENSBTAP00000024444  ...---NEEIDEML..KEA.......PG--.....-..............-.............-PINFTV.......
ENSBTAP00000004556  ...---EPCIKPLF..NSC.......DS-F.....K..............D.............GKLSNNE.......
ENSBTAP00000038767  ...-------DRII..NAF.......FP-E.....G..............E.............DQVNFRG.......
ENSBTAP00000031285  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000011457  ...---DMIMDRVF..RGF.......DK-D.....N..............D.............GCISVTE.......
ENSBTAP00000011047  ...---QAEVLRVL..GKP.......KQ-Eel...N..............S.............KMMDFDT.......
ENSBTAP00000002564  ...----------F..---.......----.....-..............-.............-------.......
ENSBTAP00000037104  ...---NEELEAMV..KEA.......PG--.....-..............-.............-PINFTV.......
ENSBTAP00000002672  ...--PEEELDAML..Q--.......---E.....G..............K.............GPINFTV.......
ENSBTAP00000028269  ...---NEELDAMM..K--.......---E.....A..............S.............GPINFTV.......
ENSBTAP00000016647  ...-------DRII..DSF.......FP-D.....G..............S.............LRLDFPG.......
ENSBTAP00000004536  ...--DRGAQQGIS..PEG.......DT-D.....P..............D.............GGLDLEE.......
ENSBTAP00000042177  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000028063  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000050283  ...---NAEVLRVL..GKP.......KP-Eem...N..............S.............KMLDFET.......
ENSBTAP00000048539  ...---SKPLQQLF..ALF.......DR-N.....N..............D.............GTIDFRE.......
ENSBTAP00000045669  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000007972  ...---TAEMEGVC..RRW.......DR-D.....G..............S.............GTLDLEE.......
ENSBTAP00000040815  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000025661  ...---SDVLRQLF..ALF.......DR-N.....H..............D.............GSIDFRE.......
ENSBTAP00000028350  ...LKANPFKERIC..KVF.......STSP.....S..............R.............DSLSFED.......
ENSBTAP00000053274  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000021537  mpeLKDNPFRQRIA..QVF.......SE-D.....G..............D.............GHMTLDN.......
ENSBTAP00000055481  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000039155  ...---KAELQKVV..GEL.......DC-D.....G..............R.............GPVGFPE.......
ENSBTAP00000029333  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000016315  ...-----ELSYIW..ELS.......DA-D.....C..............D.............GALTLPE.......
ENSBTAP00000021091  ...LFSLEACQGIL..ALL.......DL-N.....A..............S.............GTVSIQE.......
ENSBTAP00000021618  ...---DMFVQSMF..SLA.......DK-D.....G..............N.............GYLSFRE.......
ENSBTAP00000055520  ...-----------..---.......-V-E.....K..............P.............GQMH---.......
ENSBTAP00000055624  ...-----------..---.......-V-E.....K..............P.............GQMH---.......
ENSBTAP00000016319  ...-----ELSHIW..ELS.......DF-D.....K..............D.............GALTLDE.......
ENSBTAP00000034078  ...---EGELHDLI..AEV.......EEEE.....P..............T.............GYIRFEK.......
ENSBTAP00000006645  ...-------DRIC..RVF.......---S.....H..............N.............NVFSFED.......
ENSBTAP00000021909  ...YMKDIVVQETM..EDI.......DK-N.....A..............D.............GFIDLEE.......
ENSBTAP00000001426  ...DNLGEKMKEFM..QKY.......DK-N.....S..............D.............GKIEMAE.......
ENSBTAP00000015802  ...STYRQWKQKIV..QAG.......DK-D.....L..............D.............GQLDFEE.......
ENSBTAP00000032680  ...STYRQWKQKIV..QAG.......DK-D.....L..............D.............GQLDFEE.......
ENSBTAP00000055007  ...---KEELDAII..EEV.......DE-D.....G..............S.............GTIDFEE.......
ENSBTAP00000020148  ...QKDPGVLDRMM..KKL.......DL-N.....S..............D.............GQLDFQE.......
ENSBTAP00000052345  ...---SALLAHIW..ALC.......DT-K.....N..............C.............GKLSKDQ.......
ENSBTAP00000029334  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000052345  ...-----ILGRVW..ELS.......DI-D.....H..............D.............GMLDRDE.......
ENSBTAP00000056127  ...---EIVVLETL..EDI.......DK-N.....G..............D.............GFVDQDE.......
ENSBTAP00000012557  ...RSLSSHLVTT-..---.......---D.....K..............D.............GNIDYMSg......
ENSBTAP00000011888  ...-KESFFAERFF..VLF.......DS-D.....G..............S.............GTITLQE.......
ENSBTAP00000017060  ...-----VLGRVW..DLS.......DI-D.....K..............D.............GHLDRDE.......
ENSBTAP00000031854  ...---NRIIERIF..SGA.......VT-R.....G..............Ktvqke........GRMSYAD.......
ENSBTAP00000031823  ...---DIVIAETL..EDL.......DR-N.....K..............D.............GYVQVEE.......
ENSBTAP00000021603  ...---DMFVESMF..SLA.......DK-D.....G..............N.............GYLSFRE.......
ENSBTAP00000010838  ...KRGRDYLSNIF..EKQ.......DK-N.....K..............D.............RKIDFSE.......
ENSBTAP00000014575  ...LRENPFKERIV..EAF.......SE-D.....G..............E.............GNLTFND.......
ENSBTAP00000011215  ...---NRIIERIF..SGA.......VT-R.....G..............Ktvqke........GRMSYAD.......
ENSBTAP00000053698  ...---EVELAIIM..QRL.......DM-D.....G..............D.............GQVDFDE.......
ENSBTAP00000006806  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000029334  ...-----VLAEIW..ALS.......DL-N.....K..............D.............GKMDQQE.......
ENSBTAP00000044105  ...KRGRQYLSDIF..EKK.......DK-N.....K..............D.............KKIDFSE.......
ENSBTAP00000026904  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000017060  ...---QNLLAHIW..ALA.......DT-R.....Q..............T.............GKLSKDQ.......
ENSBTAP00000055520  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000044226  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000055624  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000042182  ...----RTCEQLL..QCF.......---G.....H..............G.............GSLDLYH.......
ENSBTAP00000010796  ...---RDECQQLL..IKY.......DL-K.....N..............N.............GKFAYCS.......
ENSBTAP00000021174  ...LELSPEMKTFV..DQY.......GQ-R.....D..............D.............GKIGIVE.......
ENSBTAP00000006275  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000020950  ...---EFVIQEAL..EEH.......DK-D.....G..............D.............GFVSLEE.......
ENSBTAP00000053738  ...---RDECQQLL..IKY.......DL-K.....N..............N.............GKFAYCS.......
ENSBTAP00000004963  ...---DVLMNRVF..FAF.......DK-D.....N..............D.............NYINVKE.......
ENSBTAP00000023774  ...---EVELEVII..QRL.......DM-D.....G..............D.............GQVDFEE.......
ENSBTAP00000020395  ...GEPDPEFEAIL..DTV.......DP-N.....R..............D.............GHVSLQE.......
ENSBTAP00000020150  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000025561  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000053738  ...---DEEFERLL..GLL.......GL-R.....L..............S.............ITLNFRE.......
ENSBTAP00000034009  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000020539  ...RMLRPQLVSS-..---.......---L.....T..............D.............NKLAYKS.......
ENSBTAP00000020778  ...GMLQFMVKEII..RDL.......DQ-D.....G..............D.............KKLSLSE.......
ENSBTAP00000017461  ...---KIEADSVM..SSV.......DP--.....N..............T.............SGIRLKE.......
ENSBTAP00000044096  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000008523  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000035196  ...PQALEDVKNVV..RKHis.....DG-V.....A..............D.............GGLTLKG.......
ENSBTAP00000041997  ...---NSVLGKIW..KLA.......DI-D.....K..............D.............GMLDDEE.......
ENSBTAP00000025499  ...---SFDHKKFF..QMV.......GL--.....-..............-.............-------.......
ENSBTAP00000055481  ...---QPVLAQIW..ALA.......DM-N.....N..............D.............GRMDQVE.......
ENSBTAP00000002174  ...---NTVLGKIW..KLA.......DV-D.....R..............D.............GLLDDEE.......
ENSBTAP00000000589  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000028239  ...---NSVLGRIW..KLS.......DV-D.....R..............D.............GMLDDEE.......
ENSBTAP00000014894  ...RQGDAEFNRIM..SVV.......DP-N.....H..............S.............GLVTFQA.......
ENSBTAP00000026544  ...AKLEEYTGTMM..KIF.......DK-N.....K..............D.............GRLDLND.......
ENSBTAP00000029333  ...---QPVLAQIW..ALA.......DM-N.....N..............D.............GRMDQVE.......
ENSBTAP00000041966  ...PFSLDECRSLV..ALM.......DL-K.....V..............N.............GRLDQEE.......
ENSBTAP00000008933  ...---NSVLGKIW..KLA.......DC-D.....G..............D.............GMLDEEE.......
ENSBTAP00000056088  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000033794  ...RKEPYYITQLF..RAA.......DK-N.....Q..............D.............NQICFEE.......
ENSBTAP00000012786  ...---EAEFARIM..TLV.......DP-N.....G..............Q.............GTVTFQS.......
ENSBTAP00000030018  ...---EVEFARIM..TMV.......DP-N.....A..............A.............GVVTFQA.......
ENSBTAP00000040233  ...---REQFQDVL..AQI.......PL-T.....S..............S.............GAVPYLV.......
ENSBTAP00000003365  ...-------QKTI..NKY.......WT-S.....Q..............T.............AKLNFDD.......
ENSBTAP00000053176  ...-----------..---.......----.....-..............-.............--IHLKD.......
ENSBTAP00000024301  ...PQGEAEFARIM..SIV.......DP-N.....R..............L.............GVVTFQA.......
ENSBTAP00000022292  ...-SNPKIVQLLA..GVA.......DQ-T.....K..............D.............GLISYQE.......
ENSBTAP00000015611  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000012770  ...---NVFLDRVF..QEC.......LT--.....Y..............D.............GEMDYKT.......
ENSBTAP00000000847  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000053738  ...---REQFQDVL..AQI.......PL-T.....S..............S.............GAVPYLV.......
ENSBTAP00000054975  ...-----------..---.......GL--.....-..............-.............-------.......
ENSBTAP00000046639  ...---ENDFESFW..LIL.......NS-S.....G..............N.............GRADYGE.......
ENSBTAP00000052345  ...---DLVLGKIW..DLA.......DT-D.....G..............K.............GILNKQE.......
ENSBTAP00000053164  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000016774  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000022630  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000010796  ...---DNQYHYFL..RKL.......RL-H.....L..............T.............PYINWKY.......
ENSBTAP00000021909  ...---YDNVENQW..QEF.......DL-N.....Q..............D.............GLISWDE.......
ENSBTAP00000033974  ...---KSELASTA..KDV.......DR-V.....K..............K.............GFFNCSN.......
ENSBTAP00000006711  ...-----------..---.......----.....-..............-.............----LKD.......
ENSBTAP00000010796  ...---PREFEKLW..MRY.......DS-E.....G..............R.............GHITYQE.......
ENSBTAP00000004912  ...--NPKTVELLS..GVV.......DQ-T.....K..............D.............GLISFQE.......
ENSBTAP00000005979  ...PQALEDVKMVVskNVV.......GG-V.....R..............D.............DQLTLDG.......
ENSBTAP00000053738  ...---DNQYHYFL..RKL.......RL-H.....L..............T.............PYINWKY.......
ENSBTAP00000053746  ...-----------..---.......----.....-..............-.............DEINFED.......
ENSBTAP00000023221  ...--------EVW..EEA.......DG--.....-..............-.............-------.......
ENSBTAP00000019429  ...---HLGLKSMI..KEV.......DE-D.....F..............D.............GKLSFRE.......
ENSBTAP00000052019  ...PNDPETVETIL..SLL.......DR-N.....R..............N.............EHVDFHE.......
ENSBTAP00000042244  ...---HLGLKNMI..KEV.......DE-D.....F..............D.............SKLSFRE.......
ENSBTAP00000053738  ...---DSEFRELM..RIL.......DP-G.....C..............T.............GCVNVSR.......
ENSBTAP00000018877  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000053019  ...YKVREIVEKIL..AVA.......DN-N.....K..............D.............SRISFEE.......
ENSBTAP00000003073  ...----------W..EEL.......DG--.....-..............-.............-------.......
ENSBTAP00000012886  ...---ENTLHEIL..NEV.......DL-N.....K..............N.............GQVELNE.......
ENSBTAP00000044222  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000028499  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000047378  ...---KQLPVLLH..TLL.......GN-N.....Q..............F.............ARVNFEE.......
ENSBTAP00000009308  ...YRVREITENLM..TTG.......DL-D.....Q..............D.............GKISFDE.......
ENSBTAP00000017060  ...---DIILGKIW..DLA.......DP-E.....G..............K.............GYLDKQG.......
ENSBTAP00000050406  ...YKVREIIQKLM..LDG.......DR-N.....K..............D.............GKISFDE.......
ENSBTAP00000031879  ...YKVREIIQKLM..LDG.......DR-N.....K..............D.............GKISFDE.......
ENSBTAP00000031854  ...KAP------MF..RAA.......GG-E.....R..............T.............GFVSAQS.......
ENSBTAP00000001250  ...---SESLEDLF..SLF.......DE-G.....G..............G.............GEVDLRE.......
ENSBTAP00000026035  ...PHDPATVDEVL..RLL.......DE-D.....D..............T.............GTVEFKE.......
ENSBTAP00000011215  ...KAP------MF..RAA.......GG-E.....R..............T.............GFVSAQS.......
ENSBTAP00000002128  ...---DKEFKKIV..TDT.......AR-N.....E..............N.............GMVKLDD.......
ENSBTAP00000053194  ...GEPEPKFEKFL..DAV.......DP-E.....R..............K.............GYISKDE.......
ENSBTAP00000056127  ...---YDNVAKVW..KDY.......DR-D.....K..............D.............DKISWEE.......
ENSBTAP00000033188  ...---KLEMTAVA..DIF.......DR-D.....G..............D.............GYIDYYE.......
ENSBTAP00000053548  ...---RLEMSAVA..DIF.......DR-D.....G..............D.............GYIDYYE.......
ENSBTAP00000011687  ...---RNQITVVF..NML.......DW-N.....A..............V.............GEIGFDQ.......
ENSBTAP00000007636  ...-----------..---.......----.....-..............-.............GLISFSD.......
ENSBTAP00000020950  ...---MQEAKQQF..IEY.......DK-N.....S..............D.............GSVSWDE.......
ENSBTAP00000009115  ...---KHDVHNEL..RCA.......DI-D.....Q..............D.............GKVNFSD.......
ENSBTAP00000023873  ...--ATTYAHFLF..NAF.......DA-D.....G..............N.............GAIRFE-.......
ENSBTAP00000054471  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000039694  ...---SVFLENVR..YSI.......PE--.....-..............E.............KGITFDE.......
ENSBTAP00000025205  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000047882  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000001368  ...EHIEKMVESVF..RNF.......DV-D.....G..............D.............GHISQEE.......
ENSBTAP00000029786  ...THSDVLASRLF..QLL.......DE-N.....G..............D.............SLINFRE.......
ENSBTAP00000028993  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000023678  ...-----------..---.......----.....-..............-.............---DLEA.......
ENSBTAP00000034710  ...---PQEMCEAL..RQA.......DL-D.....G..............D.............GTVSFKD.......
ENSBTAP00000031823  ...---RDSVSAAW..NTY.......DT-D.....R..............D.............GRVGWEE.......
ENSBTAP00000038002  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000021074  ...PCAIHAVERNL..NLL.......NI-D.....S..............N.............GAISFDE.......
ENSBTAP00000026544  ...AVKEENVQKMK..QQFmaph...NV-S.....K..............D.............GCIQMKElagmfls
ENSBTAP00000007217  ...---DEECRLVI..HLAqmk....GL-Q.....R..............S.............QILPTEE.......
ENSBTAP00000029792  ...AHTPVLAGRMF..RLL.......DE-N.....K..............D.............SLINFKE.......
ENSBTAP00000044088  ...QEPEINTTLQI..RFF.......GK-R.....G..............E.............RKLHYKE.......
ENSBTAP00000017319  ...QETKARYKDLL..SEL.......DE-H.....T..............E.............NKLDFED.......
ENSBTAP00000044100  ...---RKLVESVF..RNY.......DH-D.....H..............D.............GYISQED.......
ENSBTAP00000033594  ...-----------..---.......---E.....G..............K.............GKIPPES.......
ENSBTAP00000026766  ...---PSLSEGLF..NAF.......DE-N.....R..............D.............NHIDFKE.......
ENSBTAP00000055894  ...---HLEMKKMI..SEV.......TG-G.....V..............S.............DTISYRD.......
ENSBTAP00000015220  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000033613  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000056320  ...---TKMIDRIF..SGA.......VT-RgkkvqK..............E.............GKISYAD.......
ENSBTAP00000025249  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000029159  ...KHVQRMVDSVF..KNY.......DH-D.....Q..............D.............GYISQEE.......
ENSBTAP00000044088  ...---EDFAEWLL..FFT.......DTEN.....K..............DvywknvreklsagENISLEE.......
ENSBTAP00000016319  ...---NDVVLQIM..ELC.......GA-T.....R..............L.............GYFGRSQ.......
ENSBTAP00000017662  ...---TAQVEGAL..RSA.......DI-D.....G..............D.............GHVNFKD.......
ENSBTAP00000012479  ...---LPTVKILC..QRF.......SRGS.....S..............P.............EMVNYEK.......
ENSBTAP00000029886  ...---SEILDKYF..KNF.......D--N.....G..............D.............SRLDSSE.......
ENSBTAP00000027388  ...---HLELKKLI..MEV.......SS-G.....P..............G.............ETFSYSD.......
ENSBTAP00000039694  ...-----GSSKLF..RNL.......---K.....E..............K.............GVISYTE.......
ENSBTAP00000023673  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000041488  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000001452  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000028498  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000001426  ...-----------..-MF.......DL-N.....G..............D.............GKLGLSE.......
ENSBTAP00000020240  ...-----------..-FF.......DM--.....-..............-.............-------.......
ENSBTAP00000053650  ...-----------..-FF.......DM--.....-..............-.............-------.......
ENSBTAP00000041651  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000005154  ...-------QDVF..RRA.......DK-N.....D..............D.............GKLSFEE.......
ENSBTAP00000021174  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000022068  ...---AEQVTDLT..RYL.......DP-S.....G..............L.............GVISFED.......
ENSBTAP00000026682  ...------VDDIS..ESL.......RQ--.....G..............G.............GKLNFDE.......
ENSBTAP00000007636  ...KKLTAMQKQLK..KHF.......---K.....E..............G.............KGLTFQE.......
ENSBTAP00000027954  ...---PHKREVLL..ALA.......DS-H.....A..............N.............GQICYQD.......
ENSBTAP00000020778  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000013601  ...---RETLGQIW..ALA.......NR-T.....T..............P.............GKLTKEE.......
ENSBTAP00000005477  ...---EGEIEDMF..NEIrfseyv.DTGK.....L..............T.............DKINLPD.......
ENSBTAP00000055305  ...-----------..-FF.......DM--.....-..............-.............-------.......
ENSBTAP00000036054  ...-----------..-FF.......DM--.....-..............-.............-------.......
ENSBTAP00000004912  ...--TPFVEECLV..AAA.......GG-T.....T..............S.............HQVSFSY.......
ENSBTAP00000022292  ...------CEFIR..LHF.......GH-N.....R..............K.............KHLNYTE.......
ENSBTAP00000002717  ...--SAKFLKDKF..LEI.......GA--.....H..............K.............DELSFEQ.......
ENSBTAP00000036015  ...PHDPVALEEHF..RD-.......---D.....D..............D.............GPVSSQG.......
ENSBTAP00000051638  ...----------F..RLL.......DE-N.....S..............D.............CLINFKE.......
ENSBTAP00000026766  ...-----------..---.......----.....-..............-.............--LHFNN.......
ENSBTAP00000053738  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000016306  ...-----------..---.......----.....-..............-.............--LKFEE.......
ENSBTAP00000013714  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000036550  ...AHTEILAERTF..RLL.......DE-N.....M..............D.............HLIEFKA.......
ENSBTAP00000053738  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000023383  ...--NMRFLRERL..TDL.......EQ--.....R..............T.............SDITYGQ.......
ENSBTAP00000027030  ...--DGEMLEEVF..HNL.......DP--.....-..............D.............GMMSVED.......
ENSBTAP00000053270  ...--DGEMLEEVF..HNL.......DP--.....-..............D.............GMMSVED.......
ENSBTAP00000054640  ...--DGEMLEEVF..HNL.......DP--.....-..............D.............GMMSVED.......
ENSBTAP00000012770  ...---QFFTAKVF..AKLl......HT-D.....S..............Y.............GRISIMQ.......
ENSBTAP00000009967  ...---QPELQELA..SLL.......VT--.....N..............S.............ESVDWRK.......
ENSBTAP00000015183  ...---EEEYGELF..DKV.......DV-A.....Q..............E.............GFINWDK.......
ENSBTAP00000014222  ...-----------..---.......---A.....G..............E.............QEIQFED.......
ENSBTAP00000026288  ...---SEQLAAIA..QLH.......EK-V.....R..............G.............GGVNINE.......
ENSBTAP00000002128  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000003365  ...------LSDIF..EVI.......DL-D.....G..............N.............GLLSLEE.......
ENSBTAP00000053738  ...---RRIFIQLM..KRF.......GL-K.....T..............T.............TKVNWKQ.......
ENSBTAP00000009228  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000026785  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000002578  ...PHDPVALEEHF..RD-.......---D.....D..............E.............GPVSNQG.......
ENSBTAP00000000106  ...---------RL..REF.......DS-D.....G..............D.............GRYSFLE.......
ENSBTAP00000028840  ...---NQEVEDIV..VYL.......SSLG.....K..............H.............NSITMDN.......
ENSBTAP00000053594  ...-----------..---.......----.....-..............-.............ESVTLEQ.......
ENSBTAP00000055414  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000026698  ...---SQTVAGAF..SYF.......QQ-D.....A..............D.............GLVDFRD.......
ENSBTAP00000017015  ...EEQEEQAARQF..AAL.......DP-E.....H..............R.............GHVEWPD.......
ENSBTAP00000049908  ...-----------..---.......----.....-..............-.............-------.......
ENSBTAP00000021395  ...---KEQHQALR..QQV.......QV-D.....T..............K.............GTVSFGD.......
ENSBTAP00000007194  ...-----------..---.......----.....-..............-.............----FST.......
ENSBTAP00000025455  ...-----------..---.......----.....-..............-.............-------.......


                                                                                                    
                                                                                                    
d1dgua_               ....F.LDLLS.V.................................................................
ENSBTAP00000019411  ....F.LTMMA.R.................................................................
ENSBTAP00000036057  ....F.LTMMA.R.................................................................
ENSBTAP00000038404  ....F.IIALS.V.................................................................
ENSBTAP00000010971  ....F.IIALS.V.................................................................
ENSBTAP00000019803  ....F.KYLWN.N.................................................................
ENSBTAP00000014038  ....F.IEGVS.Q.................................................................
ENSBTAP00000002055  ....F.LTMMA.R.................................................................
ENSBTAP00000049731  ....F.LTMMA.R.................................................................
ENSBTAP00000005577  ....F.IIALS.V.................................................................
ENSBTAP00000034949  ....Y.VIALH.M.................................................................
ENSBTAP00000017447  ....F.YELTQ.K.................................................................
ENSBTAP00000010858  ....-.-----.-.................................................................
ENSBTAP00000046644  ....F.TPEVYrV.................................................................
ENSBTAP00000022814  ....F.ICALS.I.................................................................
ENSBTAP00000019758  ....W.AGCFG.I.................................................................
ENSBTAP00000019321  ....F.ICALS.V.................................................................
ENSBTAP00000011677  ....F.HHLWK.K.................................................................
ENSBTAP00000011680  ....F.HHLWK.K.................................................................
ENSBTAP00000021742  ....F.VAGLS.V.................................................................
ENSBTAP00000005348  ....W.GHCFE.I.................................................................
ENSBTAP00000016609  ....FsLEIFE.R.................................................................
ENSBTAP00000012740  ....V.INCLT.T.................................................................
ENSBTAP00000018403  ....F.LEAMA.A.................................................................
ENSBTAP00000026407  ....F.KKALE.E.................................................................
ENSBTAP00000052557  ....F.LAVMT.Q.................................................................
ENSBTAP00000054167  ....F.IKGLS.I.................................................................
ENSBTAP00000010319  ....F.LTVMT.Q.................................................................
ENSBTAP00000041545  ....F.VEFYK.S.................................................................
ENSBTAP00000055204  ....F.TGVWK.Y.................................................................
ENSBTAP00000003718  ....F.VTALS.I.................................................................
ENSBTAP00000011676  ....F.KTLWL.K.................................................................
ENSBTAP00000049395  ....I.ETFYK.I.................................................................
ENSBTAP00000054983  ....F.KEALE.E.................................................................
ENSBTAP00000052219  ....F.KELWA.V.................................................................
ENSBTAP00000025402  ....F.PESVY.K.................................................................
ENSBTAP00000011678  ....F.NILWN.R.................................................................
ENSBTAP00000000433  ....F.QEAMK.E.................................................................
ENSBTAP00000021491  ....F.FAIMS.V.................................................................
ENSBTAP00000044733  ....F.YILWT.K.................................................................
ENSBTAP00000010937  ....F.CVFYK.M.................................................................
ENSBTAP00000056439  ....F.CVFYK.M.................................................................
ENSBTAP00000055780  ....F.LVMMV.R.................................................................
ENSBTAP00000038002  ....V.SCYFS.L.................................................................
ENSBTAP00000034705  ....I.EEFLR.R.................................................................
ENSBTAP00000035936  ....Y.VAALN.L.................................................................
ENSBTAP00000013699  ....F.SALWK.F.................................................................
ENSBTAP00000002564  ....-.-----.-.................................................................
ENSBTAP00000011496  ....F.IQALS.V.................................................................
ENSBTAP00000019111  ....F.NEVVT.D.................................................................
ENSBTAP00000017036  ....Y.VAALS.L.................................................................
ENSBTAP00000003213  ....F.CAFYK.M.................................................................
ENSBTAP00000055444  ....F.CAFYK.M.................................................................
ENSBTAP00000024550  ....F.KELWA.A.................................................................
ENSBTAP00000015248  ....F.LTMFG.E.................................................................
ENSBTAP00000021328  ....F.LTMFG.E.................................................................
ENSBTAP00000037091  ....F.LTMFG.E.................................................................
ENSBTAP00000029967  ....F.VELMG.P.................................................................
ENSBTAP00000021449  ....F.VELMT.P.................................................................
ENSBTAP00000053176  ....F.KLFMK.T.................................................................
ENSBTAP00000042361  ....F.VELMG.P.................................................................
ENSBTAP00000016509  ....Y.VAALN.L.................................................................
ENSBTAP00000026714  ....F.VELMG.P.................................................................
ENSBTAP00000004690  ....F.QVLWR.K.................................................................
ENSBTAP00000010858  ....-.-----.-.................................................................
ENSBTAP00000013117  ....F.VEVFH.E.................................................................
ENSBTAP00000017574  ....F.RTIYR.I.................................................................
ENSBTAP00000004885  ....F.MKY--.-.................................................................
ENSBTAP00000008961  ....F.DIFTR.L.................................................................
ENSBTAP00000028063  ....S.ISLLL.-.................................................................
ENSBTAP00000012740  ....F.IDWMR.L.................................................................
ENSBTAP00000006283  ....F.VEMMG.P.................................................................
ENSBTAP00000014306  ....F.LPMLQ.T.................................................................
ENSBTAP00000053252  ....F.CEAFC.E.................................................................
ENSBTAP00000014304  ....F.LPMLQ.T.................................................................
ENSBTAP00000045669  ....-.-----.-.................................................................
ENSBTAP00000041264  ....F.DIFTR.L.................................................................
ENSBTAP00000006711  ....F.KLFMK.A.................................................................
ENSBTAP00000017358  ....F.DIFTR.L.................................................................
ENSBTAP00000053274  ....-.-----.-.................................................................
ENSBTAP00000055296  ....F.DIFTR.L.................................................................
ENSBTAP00000016852  ....F.LLTLR.P.................................................................
ENSBTAP00000036380  ....F.LTIMH.M.................................................................
ENSBTAP00000041719  ....F.LPMLQ.A.................................................................
ENSBTAP00000049636  ....F.LPMLQ.A.................................................................
ENSBTAP00000024444  ....F.LQMFG.E.................................................................
ENSBTAP00000004556  ....W.CYCFQ.K.................................................................
ENSBTAP00000038767  ....F.MRTLA.H.................................................................
ENSBTAP00000031285  ....-.-----.-.................................................................
ENSBTAP00000011457  ....W.VYGLS.V.................................................................
ENSBTAP00000011047  ....F.LPMLQ.H.................................................................
ENSBTAP00000002564  ....-.-----.-.................................................................
ENSBTAP00000037104  ....F.LTMFG.E.................................................................
ENSBTAP00000002672  ....F.LTLFG.E.................................................................
ENSBTAP00000028269  ....F.LNMFG.E.................................................................
ENSBTAP00000016647  ....F.VRVLA.H.................................................................
ENSBTAP00000004536  ....F.ILYL-.-.................................................................
ENSBTAP00000042177  ....-.-----.-.................................................................
ENSBTAP00000028063  ....-.-----.-.................................................................
ENSBTAP00000050283  ....F.LPILQ.H.................................................................
ENSBTAP00000048539  ....Y.VIGLT.V.................................................................
ENSBTAP00000045669  ....-.-----.-.................................................................
ENSBTAP00000007972  ....F.LRALR.P.................................................................
ENSBTAP00000040815  ....-.-----.-.................................................................
ENSBTAP00000025661  ....Y.VIGLA.V.................................................................
ENSBTAP00000028350  ....F.LDLLS.V.................................................................
ENSBTAP00000053274  ....-.-----.-.................................................................
ENSBTAP00000021537  ....F.LDMFS.V.................................................................
ENSBTAP00000055481  ....-.-----.-.................................................................
ENSBTAP00000039155  ....L.LGLMA.W.................................................................
ENSBTAP00000029333  ....-.-----.-.................................................................
ENSBTAP00000016315  ....F.CAAFH.L.................................................................
ENSBTAP00000021091  ....F.RDLWK.Q.................................................................
ENSBTAP00000021618  ....F.LDILV.V.................................................................
ENSBTAP00000055520  ....-.-----.-.................................................................
ENSBTAP00000055624  ....-.-----.-.................................................................
ENSBTAP00000016319  ....F.CAAFH.L.................................................................
ENSBTAP00000034078  ....F.LPVMT.E.................................................................
ENSBTAP00000006645  ....V.LGMAS.V.................................................................
ENSBTAP00000021909  ....Y.IGDMY.S.................................................................
ENSBTAP00000001426  ....L.AQILP.T.................................................................
ENSBTAP00000015802  ....F.VHY--.-.................................................................
ENSBTAP00000032680  ....F.VHY--.-.................................................................
ENSBTAP00000055007  ....F.LVMMV.R.................................................................
ENSBTAP00000020148  ....F.LNLIG.G.................................................................
ENSBTAP00000052345  ....F.ALAFH.L.................................................................
ENSBTAP00000029334  ....-.-----.-.................................................................
ENSBTAP00000052345  ....F.AVAMF.L.................................................................
ENSBTAP00000056127  ....Y.IADMF.S.................................................................
ENSBTAP00000012557  ....F.QDVHI.Q.................................................................
ENSBTAP00000011888  ....L.QKALT.L.................................................................
ENSBTAP00000017060  ....F.AVAMH.L.................................................................
ENSBTAP00000031854  ....F.VWFLI.S.................................................................
ENSBTAP00000031823  ....Y.IADLY.T.................................................................
ENSBTAP00000021603  ....F.LDVLV.V.................................................................
ENSBTAP00000010838  ....F.LSLLA.D.................................................................
ENSBTAP00000014575  ....F.VDMFS.V.................................................................
ENSBTAP00000011215  ....F.VWFLI.S.................................................................
ENSBTAP00000053698  ....F.MTILG.P.................................................................
ENSBTAP00000006806  ....-.-----.-.................................................................
ENSBTAP00000029334  ....F.SIAMK.L.................................................................
ENSBTAP00000044105  ....F.LSLLA.D.................................................................
ENSBTAP00000026904  ....-.-----.-.................................................................
ENSBTAP00000017060  ....F.ALAMY.F.................................................................
ENSBTAP00000055520  ....-.-----.-.................................................................
ENSBTAP00000044226  ....-.-----.-.................................................................
ENSBTAP00000055624  ....-.-----.-.................................................................
ENSBTAP00000042182  ....F.QQLWG.H.................................................................
ENSBTAP00000010796  ....F.IQSCV.L.................................................................
ENSBTAP00000021174  ....L.AHVLP.T.................................................................
ENSBTAP00000006275  ....-.-----.-.................................................................
ENSBTAP00000020950  ....F.LGDYR.R.................................................................
ENSBTAP00000053738  ....F.IQSCV.L.................................................................
ENSBTAP00000004963  ....W.VKGLS.V.................................................................
ENSBTAP00000023774  ....F.VTLLG.P.................................................................
ENSBTAP00000020395  ....Y.MAFMI.S.................................................................
ENSBTAP00000020150  ....-.-----.-.................................................................
ENSBTAP00000025561  ....-.-----.-.................................................................
ENSBTAP00000053738  ....F.RNLCE.Krsfsadddapqrlprpkqkvadselaceqahqyl...............................
ENSBTAP00000034009  ....-.-----.-.................................................................
ENSBTAP00000020539  ....W.LENLA.K.................................................................
ENSBTAP00000020778  ....F.ISLPV.G.................................................................
ENSBTAP00000017461  ....F.LDIVR.K.................................................................
ENSBTAP00000044096  ....-.-----.-.................................................................
ENSBTAP00000008523  ....-.-----.-.................................................................
ENSBTAP00000035196  ....F.LFLHT.L.................................................................
ENSBTAP00000041997  ....F.ALANH.L.................................................................
ENSBTAP00000025499  ....-.-----.-.................................................................
ENSBTAP00000055481  ....F.SIAMK.L.................................................................
ENSBTAP00000002174  ....F.ALANH.L.................................................................
ENSBTAP00000000589  ....-.-----.-.................................................................
ENSBTAP00000028239  ....F.ALASH.L.................................................................
ENSBTAP00000014894  ....F.IDFMS.R.................................................................
ENSBTAP00000026544  ....L.ARILA.L.................................................................
ENSBTAP00000029333  ....F.SIAMK.L.................................................................
ENSBTAP00000041966  ....F.SRLWS.R.................................................................
ENSBTAP00000008933  ....F.ALAKH.L.................................................................
ENSBTAP00000056088  ....-.-----.-.................................................................
ENSBTAP00000033794  ....F.LYILG.K.................................................................
ENSBTAP00000012786  ....F.IDFMT.R.................................................................
ENSBTAP00000030018  ....F.IDFMT.R.................................................................
ENSBTAP00000040233  ....F.LSRFG.Gidlninvikrggenemngcrtlkdleaqvg...................................
ENSBTAP00000003365  ....F.CIILR.K.................................................................
ENSBTAP00000053176  ....I.VCYLS.L.................................................................
ENSBTAP00000024301  ....F.IDFMS.R.................................................................
ENSBTAP00000022292  ....F.LAFES.V.................................................................
ENSBTAP00000015611  ....-.-----.-.................................................................
ENSBTAP00000012770  ....Y.LDFVL.A.................................................................
ENSBTAP00000000847  ....-.-----.-.................................................................
ENSBTAP00000053738  ....F.LSRFG.Gidlninvikrggenemngcrtlkdleaqvg...................................
ENSBTAP00000054975  ....-.-----.-.................................................................
ENSBTAP00000046639  ....F.KRAII.G.................................................................
ENSBTAP00000052345  ....F.FVALR.L.................................................................
ENSBTAP00000053164  ....-.-----.-.................................................................
ENSBTAP00000016774  ....-.-----.-.................................................................
ENSBTAP00000022630  ....-.-----.-.................................................................
ENSBTAP00000010796  ....F.LQNFS.S.................................................................
ENSBTAP00000021909  ....Y.RNVTY.G.................................................................
ENSBTAP00000033974  ....L.LALMG.L.................................................................
ENSBTAP00000006711  ....V.VCYLS.L.................................................................
ENSBTAP00000010796  ....F.LQKLG.Inysadihrpyaeeyfnfmghftkpqqvqeelkelqqstekampa.....................
ENSBTAP00000004912  ....F.VAFES.V.................................................................
ENSBTAP00000005979  ....F.LFLNT.L.................................................................
ENSBTAP00000053738  ....F.LQNFS.S.................................................................
ENSBTAP00000053746  ....F.LTIMS.Y.................................................................
ENSBTAP00000023221  ....-.-----.-.................................................................
ENSBTAP00000019429  ....F.LLIFH.K.................................................................
ENSBTAP00000052019  ....Y.LLMVF.Q.................................................................
ENSBTAP00000042244  ....F.LLIFR.K.................................................................
ENSBTAP00000053738  ....F.IELIE.Espklhkipaykdtkmplflawdsveeiih....................................
ENSBTAP00000018877  ....-.-----.-.................................................................
ENSBTAP00000053019  ....F.VSLMQ.E.................................................................
ENSBTAP00000003073  ....-.-----.-.................................................................
ENSBTAP00000012886  ....F.LQLMS.A.................................................................
ENSBTAP00000044222  ....-.-----.-.................................................................
ENSBTAP00000028499  ....-.-----.-.................................................................
ENSBTAP00000047378  ....F.KDGFI.Avlssqsglassdedsgslesvasravppkyvsgskwygrrshpepcgaaggapglleqparpsar
ENSBTAP00000009308  ....F.IKVFH.G.................................................................
ENSBTAP00000017060  ....F.YVALR.L.................................................................
ENSBTAP00000050406  ....F.VYIFQ.E.................................................................
ENSBTAP00000031879  ....F.VYIFQ.E.................................................................
ENSBTAP00000031854  ....F.ITIWR.K.................................................................
ENSBTAP00000001250  ....Y.VVALS.V.................................................................
ENSBTAP00000026035  ....F.LVLVF.K.................................................................
ENSBTAP00000011215  ....F.ITIWR.K.................................................................
ENSBTAP00000002128  ....F.VSAVS.K.................................................................
ENSBTAP00000053194  ....Y.IDFLT.D.................................................................
ENSBTAP00000056127  ....Y.KQATY.G.................................................................
ENSBTAP00000033188  ....F.VAALH.-.................................................................
ENSBTAP00000053548  ....F.VAALH.P.................................................................
ENSBTAP00000011687  ....F.YMLVC.I.................................................................
ENSBTAP00000007636  ....Y.IFLTT.V.................................................................
ENSBTAP00000020950  ....Y.NIQMY.D.................................................................
ENSBTAP00000009115  ....F.LKVL-.-.................................................................
ENSBTAP00000023873  ....-.-----.-.................................................................
ENSBTAP00000054471  ....-.-----.-.................................................................
ENSBTAP00000039694  ....F.RSFFQ.F.................................................................
ENSBTAP00000025205  ....-.-----.-.................................................................
ENSBTAP00000047882  ....-.-----.-.................................................................
ENSBTAP00000001368  ....F.QIIRG.N.................................................................
ENSBTAP00000029786  ....F.VSGLS.A.................................................................
ENSBTAP00000028993  ....-.-----.-.................................................................
ENSBTAP00000023678  ....L.IDTIQ.K.................................................................
ENSBTAP00000034710  ....F.LGVLT.-.................................................................
ENSBTAP00000031823  ....L.RNATY.G.................................................................
ENSBTAP00000038002  ....-.--YFS.L.................................................................
ENSBTAP00000021074  ....F.VLAIF.S.................................................................
ENSBTAP00000026544  edenF.LLLFR.Q.................................................................
ENSBTAP00000007217  ....Y.EEAMG.T.................................................................
ENSBTAP00000029792  ....F.VTGMS.G.................................................................
ENSBTAP00000044088  ....F.RRFME.Nlqaevqemeflqfskglsfmrkedfaewllfftdtenkdvywknvreklsagenisleefks...
ENSBTAP00000017319  ....F.MVLLL.S.................................................................
ENSBTAP00000044100  ....F.ESIAA.N.................................................................
ENSBTAP00000033594  ....T.LIFNI.D.................................................................
ENSBTAP00000026766  ....I.SCGLS.A.................................................................
ENSBTAP00000055894  ....F.VNMM-.-.................................................................
ENSBTAP00000015220  ....-.-----.-.................................................................
ENSBTAP00000033613  ....-.-----.-.................................................................
ENSBTAP00000056320  ....F.VWFLI.S.................................................................
ENSBTAP00000025249  ....-.-----.-.................................................................
ENSBTAP00000029159  ....F.EKIAA.S.................................................................
ENSBTAP00000044088  ....F.KSFCH.F.................................................................
ENSBTAP00000016319  ....F.YIALK.L.................................................................
ENSBTAP00000017662  ....F.LTVMT.D.................................................................
ENSBTAP00000012479  ....L.LWFLK.V.................................................................
ENSBTAP00000029886  ....F.LKFVE.Q.................................................................
ENSBTAP00000027388  ....F.LKMM-.-.................................................................
ENSBTAP00000039694  ....Y.LFLLC.I.................................................................
ENSBTAP00000023673  ....-.-----.-.................................................................
ENSBTAP00000041488  ....-.-----.-.................................................................
ENSBTAP00000001452  ....-.-----.-.................................................................
ENSBTAP00000028498  ....-.-----.-.................................................................
ENSBTAP00000001426  ....M.SRLLP.V.................................................................
ENSBTAP00000020240  ....-.---FL.K.................................................................
ENSBTAP00000053650  ....-.---FL.K.................................................................
ENSBTAP00000041651  ....-.-----.-.................................................................
ENSBTAP00000005154  ....F.QNYFA.-.................................................................
ENSBTAP00000021174  ....-.---LL.K.................................................................
ENSBTAP00000022068  ....F.YRGIE.A.................................................................
ENSBTAP00000026682  ....L.RQDLK.G.................................................................
ENSBTAP00000007636  ....V.ENFFT.F.................................................................
ENSBTAP00000027954  ....F.VNLM-.-.................................................................
ENSBTAP00000020778  ....-.-----.-.................................................................
ENSBTAP00000013601  ....L.YAVLA.M.................................................................
ENSBTAP00000005477  ....F.FKVYL.N.................................................................
ENSBTAP00000055305  ....-.---FL.K.................................................................
ENSBTAP00000036054  ....-.---FL.K.................................................................
ENSBTAP00000004912  ....F.NGFNS.L.................................................................
ENSBTAP00000022292  ....F.TQFLQ.E.................................................................
ENSBTAP00000002717  ....F.HLFYK.K.................................................................
ENSBTAP00000036015  ....Y.MPYLN.K.................................................................
ENSBTAP00000051638  ....F.SSAID.I.................................................................
ENSBTAP00000026766  ....L.IVGLV.L.................................................................
ENSBTAP00000053738  ....-.---MP.A.................................................................
ENSBTAP00000016306  ....L.QCDVS.V.................................................................
ENSBTAP00000013714  ....-.-----.-.................................................................
ENSBTAP00000036550  ....F.VSCLD.I.................................................................
ENSBTAP00000053738  ....-.-----.-.................................................................
ENSBTAP00000023383  ....F.AQLYR.S.................................................................
ENSBTAP00000027030  ....F.FYGLF.K.................................................................
ENSBTAP00000053270  ....F.FYGLF.K.................................................................
ENSBTAP00000054640  ....F.FYGLF.K.................................................................
ENSBTAP00000012770  ....F.FNYVM.R.................................................................
ENSBTAP00000009967  ....F.LLVVA.L.................................................................
ENSBTAP00000015183  ....L.TSFLL.L.................................................................
ENSBTAP00000014222  ....F.TNTLR.E.................................................................
ENSBTAP00000026288  ....F.FKGTR.Y.................................................................
ENSBTAP00000002128  ....-.--CLK.I.................................................................
ENSBTAP00000003365  ....Y.NFFEL.R.................................................................
ENSBTAP00000053738  ....F.L----.-.................................................................
ENSBTAP00000009228  ....-.-----.-.................................................................
ENSBTAP00000026785  ....-.-----.-.................................................................
ENSBTAP00000002578  ....Y.MPYLN.K.................................................................
ENSBTAP00000000106  ....L.RAA--.-.................................................................
ENSBTAP00000028840  ....-.-----.-.................................................................
ENSBTAP00000053594  ....F.GELLE.A.................................................................
ENSBTAP00000055414  ....-.-----.-.................................................................
ENSBTAP00000026698  ....V.ALALA.A.................................................................
ENSBTAP00000017015  ....F.LSHES.L.................................................................
ENSBTAP00000049908  ....-.-----.-.................................................................
ENSBTAP00000021395  ....F.VHVA-.-.................................................................
ENSBTAP00000007194  ....L.QDMPK.E.................................................................
ENSBTAP00000025455  ....-.-----.-.................................................................


                                                                           90                       
                                                                            |                       
d1dgua_               ......................................................FSD................TATPD
ENSBTAP00000019411  ......................................................KMK................DTDSE
ENSBTAP00000036057  ......................................................KMK................DTDSE
ENSBTAP00000038404  ......................................................TS-................RGKLE
ENSBTAP00000010971  ......................................................TS-................RGRLE
ENSBTAP00000019803  ......................................................IK-................-----
ENSBTAP00000014038  ......................................................FSV................KGDKE
ENSBTAP00000002055  ......................................................KMK................DTDSE
ENSBTAP00000049731  ......................................................KMK................DTDSE
ENSBTAP00000005577  ......................................................TS-................RGKLE
ENSBTAP00000034949  ......................................................TS-................AGKTN
ENSBTAP00000017447  ......................................................IC-................---PR
ENSBTAP00000010858  ......................................................---................--CVD
ENSBTAP00000046644  ......................................................FLN................NLCPR
ENSBTAP00000022814  ......................................................TS-................RGSFE
ENSBTAP00000019758  ......................................................KE-................-----
ENSBTAP00000019321  ......................................................TS-................RGSFE
ENSBTAP00000011677  ......................................................IK-................-----
ENSBTAP00000011680  ......................................................IK-................-----
ENSBTAP00000021742  ......................................................IL-................RGTTD
ENSBTAP00000005348  ......................................................---................-----
ENSBTAP00000016609  ......................................................FLN................KLCLR
ENSBTAP00000012740  ......................................................TYDgleqmhknlvnv....PLCVD
ENSBTAP00000018403  ......................................................GL-................QTSDT
ENSBTAP00000026407  ......................................................LAP................-----
ENSBTAP00000052557  ......................................................KMA................EKDTK
ENSBTAP00000054167  ......................................................LL-................RGTVQ
ENSBTAP00000010319  ......................................................KMS................EKDTK
ENSBTAP00000041545  ......................................................LT-................---QR
ENSBTAP00000055204  ......................................................IT-................-----
ENSBTAP00000003718  ......................................................LL-................RGTVH
ENSBTAP00000011676  ......................................................IR-................-----
ENSBTAP00000049395  ......................................................LTQ................RKEID
ENSBTAP00000054983  ......................................................LAK................-----
ENSBTAP00000052219  ......................................................LN-................-----
ENSBTAP00000025402  ......................................................SFLm...............SLCPR
ENSBTAP00000011678  ......................................................IR-................-----
ENSBTAP00000000433  ......................................................LGQkrfk............GKSPD
ENSBTAP00000021491  ......................................................KMS................EKDEK
ENSBTAP00000044733  ......................................................IQ-................-----
ENSBTAP00000010937  ......................................................MSL................RRDLY
ENSBTAP00000056439  ......................................................MSL................RRDLY
ENSBTAP00000055780  ......................................................CMKdds.............KGKSE
ENSBTAP00000038002  ......................................................LE-................GGRPE
ENSBTAP00000034705  ......................................................LL-................---KR
ENSBTAP00000035936  ......................................................VL-................RGTLE
ENSBTAP00000013699  ......................................................IQ-................-----
ENSBTAP00000002564  ......................................................---................---TL
ENSBTAP00000011496  ......................................................TS-................RGTLD
ENSBTAP00000019111  ......................................................WIL................ERDPH
ENSBTAP00000017036  ......................................................VL-................KGKVE
ENSBTAP00000003213  ......................................................MST................RRDLY
ENSBTAP00000055444  ......................................................MST................RRDLY
ENSBTAP00000024550  ......................................................LN-................-----
ENSBTAP00000015248  ......................................................KLN................GTDPE
ENSBTAP00000021328  ......................................................KLN................GTDPE
ENSBTAP00000037091  ......................................................KLN................GTDPE
ENSBTAP00000029967  ......................................................KLL................AETAD
ENSBTAP00000021449  ......................................................KLL................-AETA
ENSBTAP00000053176  ......................................................FLE................AELPD
ENSBTAP00000042361  ......................................................KLL................AETAD
ENSBTAP00000016509  ......................................................VL-................RGTLE
ENSBTAP00000026714  ......................................................KLL................AETAD
ENSBTAP00000004690  ......................................................IK-................-----
ENSBTAP00000010858  ......................................................---................-----
ENSBTAP00000013117  ......................................................LC-................---TR
ENSBTAP00000017574  ......................................................IT-................---YR
ENSBTAP00000004885  ......................................................---................LKDHE
ENSBTAP00000008961  ......................................................FQ-................-----
ENSBTAP00000028063  ......................................................---................-----
ENSBTAP00000012740  ......................................................E--................-----
ENSBTAP00000006283  ......................................................KLR................-EETA
ENSBTAP00000014306  ......................................................VAKnk..............DQGTY
ENSBTAP00000053252  ......................................................LC-................---TR
ENSBTAP00000014304  ......................................................VAKnk..............DQGTY
ENSBTAP00000045669  ......................................................---................-----
ENSBTAP00000041264  ......................................................FQP................WPTLL
ENSBTAP00000006711  ......................................................YLE................VDLPQ
ENSBTAP00000017358  ......................................................FQP................WGS--
ENSBTAP00000053274  ......................................................---................-----
ENSBTAP00000055296  ......................................................FQP................WGS--
ENSBTAP00000016852  ......................................................PM-................SRARK
ENSBTAP00000036380  ......................................................QIK................QEDPK
ENSBTAP00000041719  ......................................................VAKlp..............DRGSY
ENSBTAP00000049636  ......................................................ISNnk..............DQGTY
ENSBTAP00000024444  ......................................................KLK................GADPE
ENSBTAP00000004556  ......................................................---................-----
ENSBTAP00000038767  ......................................................FRP................IEDNE
ENSBTAP00000031285  ......................................................---................---CK
ENSBTAP00000011457  ......................................................FL-................RGTLE
ENSBTAP00000011047  ......................................................ISKnk..............DTGTY
ENSBTAP00000002564  ......................................................---................-----
ENSBTAP00000037104  ......................................................KLK................GTDPE
ENSBTAP00000002672  ......................................................KLN................GTDPE
ENSBTAP00000028269  ......................................................KLK................GADPE
ENSBTAP00000016647  ......................................................FRPvdeeddgnrdpkepepLNSRM
ENSBTAP00000004536  ......................................................---................-QERE
ENSBTAP00000042177  ......................................................---................----E
ENSBTAP00000028063  ......................................................---................-----
ENSBTAP00000050283  ......................................................ISRnk..............EQGTY
ENSBTAP00000048539  ......................................................LCN................PVNTE
ENSBTAP00000045669  ......................................................---................----M
ENSBTAP00000007972  ......................................................PM-................SQARE
ENSBTAP00000040815  ......................................................---................-----
ENSBTAP00000025661  ......................................................LCN................PANTE
ENSBTAP00000028350  ......................................................FSD................TATPD
ENSBTAP00000053274  ......................................................---................----M
ENSBTAP00000021537  ......................................................MSE................MAPRD
ENSBTAP00000055481  ......................................................---................--SSR
ENSBTAP00000039155  ......................................................KVK................AGDSE
ENSBTAP00000029333  ......................................................---................--SSR
ENSBTAP00000016315  ......................................................IV-................-----
ENSBTAP00000021091  ......................................................LM-................-----
ENSBTAP00000021618  ......................................................FM-................KGSPE
ENSBTAP00000055520  ......................................................---................PRASE
ENSBTAP00000055624  ......................................................---................PRASE
ENSBTAP00000016319  ......................................................VV-................-----
ENSBTAP00000034078  ......................................................VLLerry............RPIPE
ENSBTAP00000006645  ......................................................FSE................QACPS
ENSBTAP00000021909  ......................................................HDG................-NADE
ENSBTAP00000001426  ......................................................EENfllcfrq.........HVGSS
ENSBTAP00000015802  ......................................................---................LQDHE
ENSBTAP00000032680  ......................................................---................LQDHE
ENSBTAP00000055007  ......................................................QMKeda.............KGKTE
ENSBTAP00000020148  ......................................................LA-................IACHE
ENSBTAP00000052345  ......................................................IN-................-----
ENSBTAP00000029334  ......................................................---................---SR
ENSBTAP00000052345  ......................................................VY-................-----
ENSBTAP00000056127  ......................................................HE-................ESGPE
ENSBTAP00000012557  ......................................................KPVkevqssliet......VYRYR
ENSBTAP00000011888  ......................................................LI-................HGSPM
ENSBTAP00000017060  ......................................................VY-................-----
ENSBTAP00000031854  ......................................................EE-................DKRNP
ENSBTAP00000031823  ......................................................AE-................PGEEE
ENSBTAP00000021603  ......................................................FM-................KGSPE
ENSBTAP00000010838  ......................................................IA-................-----
ENSBTAP00000014575  ......................................................LCE................SAPRE
ENSBTAP00000011215  ......................................................EE-................DKRNP
ENSBTAP00000053698  ......................................................KLVssegr...........DGFLG
ENSBTAP00000006806  ......................................................---................-ETAM
ENSBTAP00000029334  ......................................................IK-................-----
ENSBTAP00000044105  ......................................................IA-................-----
ENSBTAP00000026904  ......................................................---................-----
ENSBTAP00000017060  ......................................................IQ-................-----
ENSBTAP00000055520  ......................................................---................-----
ENSBTAP00000044226  ......................................................---................-ETAM
ENSBTAP00000055624  ......................................................---................-----
ENSBTAP00000042182  ......................................................LL-................-----
ENSBTAP00000010796  ......................................................LLKak..............ETSLM
ENSBTAP00000021174  ......................................................EENflllfrcq........QLKSC
ENSBTAP00000006275  ......................................................---................-----
ENSBTAP00000020950  ......................................................DP-................TASED
ENSBTAP00000053738  ......................................................LLKak..............ETSLM
ENSBTAP00000004963  ......................................................FL-................RGTFE
ENSBTAP00000023774  ......................................................KLStsgip...........EKFHG
ENSBTAP00000020395  ......................................................RETe...............NVKSS
ENSBTAP00000020150  ......................................................---................-EHAM
ENSBTAP00000025561  ......................................................---................-----
ENSBTAP00000053738  ......................................................VTK................AKTRW
ENSBTAP00000034009  ......................................................---................-EDHL
ENSBTAP00000020539  ......................................................EKLsqqniqssllet....LYRNR
ENSBTAP00000020778  ......................................................TVEnqqgqdvd........DSWVR
ENSBTAP00000017461  ......................................................KKE................AQLYR
ENSBTAP00000044096  ......................................................---................----I
ENSBTAP00000008523  ......................................................---................----I
ENSBTAP00000035196  ......................................................FIQ................RGRHE
ENSBTAP00000041997  ......................................................IK-................-----
ENSBTAP00000025499  ......................................................---................KKKSP
ENSBTAP00000055481  ......................................................IK-................-----
ENSBTAP00000002174  ......................................................IK-................-----
ENSBTAP00000000589  ......................................................---................-----
ENSBTAP00000028239  ......................................................IE-................-----
ENSBTAP00000014894  ......................................................ETT................DTDTA
ENSBTAP00000026544  ......................................................QENfllqfkmdacs.....SEERK
ENSBTAP00000029333  ......................................................IK-................-----
ENSBTAP00000041966  ......................................................LV-................-----
ENSBTAP00000008933  ......................................................I--................-----
ENSBTAP00000056088  ......................................................---................-EDHL
ENSBTAP00000033794  ......................................................LVK................-----
ENSBTAP00000012786  ......................................................ETA................DTDTA
ENSBTAP00000030018  ......................................................ETA................ETDTA
ENSBTAP00000040233  ......................................................E-K................IFKNI
ENSBTAP00000003365  ......................................................E--................KPTSK
ENSBTAP00000053176  ......................................................LE-................RGRPE
ENSBTAP00000024301  ......................................................ETA................DTDTA
ENSBTAP00000022292  ......................................................LC-................--APD
ENSBTAP00000015611  ......................................................---................-----
ENSBTAP00000012770  ......................................................LE-................NRKEP
ENSBTAP00000000847  ......................................................---................-----
ENSBTAP00000053738  ......................................................E-K................IFKNI
ENSBTAP00000054975  ......................................................---................AKMSA
ENSBTAP00000046639  ......................................................EM-................NEYRK
ENSBTAP00000052345  ......................................................VA-................-----
ENSBTAP00000053164  ......................................................---................NYQNF
ENSBTAP00000016774  ......................................................---................-----
ENSBTAP00000022630  ......................................................---................----P
ENSBTAP00000010796  ......................................................YVE................-ETAV
ENSBTAP00000021909  ......................................................TY-................LDDPD
ENSBTAP00000033974  ......................................................YWEk...............AQNQE
ENSBTAP00000006711  ......................................................LE-................SGRPQ
ENSBTAP00000010796  ......................................................RDK................LKDHD
ENSBTAP00000004912  ......................................................LC-................--APD
ENSBTAP00000005979  ......................................................FIQ................RGRHE
ENSBTAP00000053738  ......................................................YVE................-ETAV
ENSBTAP00000053746  ......................................................FRPidttmdeeqv......QLCRK
ENSBTAP00000023221  ......................................................---................LDPND
ENSBTAP00000019429  ......................................................---................-----
ENSBTAP00000052019  ......................................................L--................-----
ENSBTAP00000042244  ......................................................A--................-----
ENSBTAP00000053738  ......................................................D-S................IAKNL
ENSBTAP00000018877  ......................................................---................-----
ENSBTAP00000053019  ......................................................LK-................SKDIS
ENSBTAP00000003073  ......................................................---................LDPNR
ENSBTAP00000012886  ......................................................IQ-................-----
ENSBTAP00000044222  ......................................................---................-----
ENSBTAP00000028499  ......................................................---................-----
ENSBTAP00000047378  sklrrsaslesveslksdeeadsakepqnelfeaqgqlptwgsevfgsarkprsHS-................FDTPE
ENSBTAP00000009308  ......................................................LK-................-----
ENSBTAP00000017060  ......................................................VA-................-----
ENSBTAP00000050406  ......................................................VK-................SSDIA
ENSBTAP00000031879  ......................................................VK-................SSDIA
ENSBTAP00000031854  ......................................................LL-................SNHHD
ENSBTAP00000001250  ......................................................VCR................PARTL
ENSBTAP00000026035  ......................................................VA-................-----
ENSBTAP00000011215  ......................................................LL-................SNHHD
ENSBTAP00000002128  ......................................................EQ-................NLPEY
ENSBTAP00000053194  ......................................................KESe...............NIRSS
ENSBTAP00000056127  ......................................................YY-................LGNPT
ENSBTAP00000033188  ......................................................---................-----
ENSBTAP00000053548  ......................................................---................-----
ENSBTAP00000011687  ......................................................LLA................QENHL
ENSBTAP00000007636  ......................................................LS-................--TPQ
ENSBTAP00000020950  ......................................................RV-................-----
ENSBTAP00000009115  ......................................................---................-----
ENSBTAP00000023873  ......................................................---................-----
ENSBTAP00000054471  ......................................................---................-----
ENSBTAP00000039694  ......................................................LN-................---NL
ENSBTAP00000025205  ......................................................---................-----
ENSBTAP00000047882  ......................................................---................---PQ
ENSBTAP00000001368  ......................................................FP-................-----
ENSBTAP00000029786  ......................................................AC-................HGDLT
ENSBTAP00000028993  ......................................................---................-----
ENSBTAP00000023678  ......................................................QLK................DRPCR
ENSBTAP00000034710  ......................................................---................-----
ENSBTAP00000031823  ......................................................HYE................PGEEF
ENSBTAP00000038002  ......................................................LE-................GGRPE
ENSBTAP00000021074  ......................................................FL-................-----
ENSBTAP00000026544  ......................................................ET-................PLDSS
ENSBTAP00000007217  ......................................................MQ-................-----
ENSBTAP00000029792  ......................................................MY-................HGDLT
ENSBTAP00000044088  ......................................................FCH................FATHL
ENSBTAP00000017319  ......................................................---................-----
ENSBTAP00000044100  ......................................................FP-................-----
ENSBTAP00000033594  ......................................................LL-................EIRNG
ENSBTAP00000026766  ......................................................CC-................RGPLA
ENSBTAP00000055894  ......................................................---................-----
ENSBTAP00000015220  ......................................................---................-----
ENSBTAP00000033613  ......................................................---................-----
ENSBTAP00000056320  ......................................................EE-................DKKTP
ENSBTAP00000025249  ......................................................---................-----
ENSBTAP00000029159  ......................................................FP-................-----
ENSBTAP00000044088  ......................................................AT-................---HL
ENSBTAP00000016319  ......................................................VA-................-----
ENSBTAP00000017662  ......................................................---................-----
ENSBTAP00000012479  ......................................................AA-................SEDTE
ENSBTAP00000029886  ......................................................NE-................-----
ENSBTAP00000027388  ......................................................---................-----
ENSBTAP00000039694  ......................................................LT-................--KPH
ENSBTAP00000023673  ......................................................---................-----
ENSBTAP00000041488  ......................................................---................-----
ENSBTAP00000001452  ......................................................---................-----
ENSBTAP00000028498  ......................................................---................----I
ENSBTAP00000001426  ......................................................QENfllkfqg.........MKLTS
ENSBTAP00000020240  ......................................................LK-................----D
ENSBTAP00000053650  ......................................................LK-................----D
ENSBTAP00000041651  ......................................................---................-MSRE
ENSBTAP00000005154  ......................................................---................-----
ENSBTAP00000021174  ......................................................FQG................VKMCG
ENSBTAP00000022068  ......................................................IR-................NG---
ENSBTAP00000026682  ......................................................---................KGHTD
ENSBTAP00000007636  ......................................................LK-................NINDV
ENSBTAP00000027954  ......................................................---................-----
ENSBTAP00000020778  ......................................................---................-----
ENSBTAP00000013601  ......................................................I--................-----
ENSBTAP00000005477  ......................................................HRPp...............FGNTM
ENSBTAP00000055305  ......................................................LK-................----D
ENSBTAP00000036054  ......................................................LK-................----D
ENSBTAP00000004912  ......................................................LN-................---NM
ENSBTAP00000022292  ......................................................LQ-................----L
ENSBTAP00000002717  ......................................................LMFeq..............QKSIL
ENSBTAP00000036015  ......................................................YI-................LDKVE
ENSBTAP00000051638  ......................................................MY-................NGSFT
ENSBTAP00000026766  ......................................................LT-................RGRDE
ENSBTAP00000053738  ......................................................RDK................LKDHD
ENSBTAP00000016306  ......................................................EE-................----D
ENSBTAP00000013714  ......................................................---................-----
ENSBTAP00000036550  ......................................................MY-................NGEMN
ENSBTAP00000053738  ......................................................---................-QQQD
ENSBTAP00000023383  ......................................................LM-................-----
ENSBTAP00000027030  ......................................................NGK................PLTPS
ENSBTAP00000053270  ......................................................NGK................PLTPS
ENSBTAP00000054640  ......................................................NGK................PLTPS
ENSBTAP00000012770  ......................................................KV-................---WL
ENSBTAP00000009967  ......................................................PW-................PIPLE
ENSBTAP00000015183  ......................................................TL-................-----
ENSBTAP00000014222  ......................................................LEH................TEHET
ENSBTAP00000026288  ......................................................LS-................-----
ENSBTAP00000002128  ......................................................FL-................YILYF
ENSBTAP00000003365  ......................................................TSG................EKCDE
ENSBTAP00000053738  ......................................................---................-----
ENSBTAP00000009228  ......................................................---................-----
ENSBTAP00000026785  ......................................................---................-----
ENSBTAP00000002578  ......................................................FI-................LEKVQ
ENSBTAP00000000106  ......................................................---................-----
ENSBTAP00000028840  ......................................................---................-----
ENSBTAP00000053594  ......................................................RG-................AGFSG
ENSBTAP00000055414  ......................................................---................-----
ENSBTAP00000026698  ......................................................LSG................GRSLE
ENSBTAP00000017015  ......................................................L--................-----
ENSBTAP00000049908  ......................................................---................-----
ENSBTAP00000021395  ......................................................---................-----
ENSBTAP00000007194  ......................................................LEP................SAVLP
ENSBTAP00000025455  ......................................................---................----E


                                                                                                    
                                                                                                    
d1dgua_               ...............I..............................................................
ENSBTAP00000019411  ...............E..............................................................
ENSBTAP00000036057  ...............E..............................................................
ENSBTAP00000038404  ...............Q..............................................................
ENSBTAP00000010971  ...............Q..............................................................
ENSBTAP00000019803  ...............-..............................................................
ENSBTAP00000014038  ...............Q..............................................................
ENSBTAP00000002055  ...............E..............................................................
ENSBTAP00000049731  ...............E..............................................................
ENSBTAP00000005577  ...............Q..............................................................
ENSBTAP00000034949  ...............Q..............................................................
ENSBTAP00000017447  ...............T..............................................................
ENSBTAP00000010858  ...............M..............................................................
ENSBTAP00000046644  ...............P..............................................................
ENSBTAP00000022814  ...............Q..............................................................
ENSBTAP00000019758  ...............-..............................................................
ENSBTAP00000019321  ...............Q..............................................................
ENSBTAP00000011677  ...............-..............................................................
ENSBTAP00000011680  ...............-..............................................................
ENSBTAP00000021742  ...............D..............................................................
ENSBTAP00000005348  ...............-..............................................................
ENSBTAP00000016609  ...............P..............................................................
ENSBTAP00000012740  ...............M..............................................................
ENSBTAP00000018403  ...............E..............................................................
ENSBTAP00000026407  ...............-..............................................................
ENSBTAP00000052557  ...............E..............................................................
ENSBTAP00000054167  ...............E..............................................................
ENSBTAP00000010319  ...............E..............................................................
ENSBTAP00000041545  ...............P..............................................................
ENSBTAP00000055204  ...............-..............................................................
ENSBTAP00000003718  ...............E..............................................................
ENSBTAP00000011676  ...............-..............................................................
ENSBTAP00000049395  ...............R..............................................................
ENSBTAP00000054983  ...............-..............................................................
ENSBTAP00000052219  ...............-..............................................................
ENSBTAP00000025402  ...............P..............................................................
ENSBTAP00000011678  ...............-..............................................................
ENSBTAP00000000433  ...............E..............................................................
ENSBTAP00000021491  ...............E..............................................................
ENSBTAP00000044733  ...............-..............................................................
ENSBTAP00000010937  ...............-..............................................................
ENSBTAP00000056439  ...............-..............................................................
ENSBTAP00000055780  ...............E..............................................................
ENSBTAP00000038002  ...............D..............................................................
ENSBTAP00000034705  ...............P..............................................................
ENSBTAP00000035936  ...............H..............................................................
ENSBTAP00000013699  ...............-..............................................................
ENSBTAP00000002564  ...............T..............................................................
ENSBTAP00000011496  ...............E..............................................................
ENSBTAP00000019111  ...............E..............................................................
ENSBTAP00000017036  ...............Q..............................................................
ENSBTAP00000003213  ...............-..............................................................
ENSBTAP00000055444  ...............-..............................................................
ENSBTAP00000024550  ...............-..............................................................
ENSBTAP00000015248  ...............D..............................................................
ENSBTAP00000021328  ...............D..............................................................
ENSBTAP00000037091  ...............D..............................................................
ENSBTAP00000029967  ...........migvR..............................................................
ENSBTAP00000021449  ..........gmigvQ..............................................................
ENSBTAP00000053176  ...............D..............................................................
ENSBTAP00000042361  ...........migvK..............................................................
ENSBTAP00000016509  ...............H..............................................................
ENSBTAP00000026714  ...........migvK..............................................................
ENSBTAP00000004690  ...............-..............................................................
ENSBTAP00000010858  ...............-..............................................................
ENSBTAP00000013117  ...............P..............................................................
ENSBTAP00000017574  ...............E..............................................................
ENSBTAP00000004885  ...............K..............................................................
ENSBTAP00000008961  ...............-..............................................................
ENSBTAP00000028063  ...............-..............................................................
ENSBTAP00000012740  ...............-..............................................................
ENSBTAP00000006283  ..........hmlglR..............................................................
ENSBTAP00000014306  ...............E..............................................................
ENSBTAP00000053252  ...............P..............................................................
ENSBTAP00000014304  ...............E..............................................................
ENSBTAP00000045669  ...............-..............................................................
ENSBTAP00000041264  ...............K..............................................................
ENSBTAP00000006711  ...............P..............................................................
ENSBTAP00000017358  ...............-..............................................................
ENSBTAP00000053274  ...............-..............................................................
ENSBTAP00000055296  ...............-..............................................................
ENSBTAP00000016852  ...............E..............................................................
ENSBTAP00000036380  ...............K..............................................................
ENSBTAP00000041719  ...............Q..............................................................
ENSBTAP00000049636  ...............E..............................................................
ENSBTAP00000024444  ...............E..............................................................
ENSBTAP00000004556  ...............-..............................................................
ENSBTAP00000038767  kskdvngpeplnsrsN..............................................................
ENSBTAP00000031285  ...............D..............................................................
ENSBTAP00000011457  ...............E..............................................................
ENSBTAP00000011047  ...............E..............................................................
ENSBTAP00000002564  ...............-..............................................................
ENSBTAP00000037104  ...............E..............................................................
ENSBTAP00000002672  ...............E..............................................................
ENSBTAP00000028269  ...............D..............................................................
ENSBTAP00000016647  ...............N..............................................................
ENSBTAP00000004536  ...............Q..............................................................
ENSBTAP00000042177  ...............R..............................................................
ENSBTAP00000028063  ...............-..............................................................
ENSBTAP00000050283  ...............E..............................................................
ENSBTAP00000048539  ...............K..............................................................
ENSBTAP00000045669  ...............D..............................................................
ENSBTAP00000007972  ...............A..............................................................
ENSBTAP00000040815  ...............R..............................................................
ENSBTAP00000025661  ...............E..............................................................
ENSBTAP00000028350  ...............I..............................................................
ENSBTAP00000053274  ...............D..............................................................
ENSBTAP00000021537  ...............L..............................................................
ENSBTAP00000055481  ...............L..............................................................
ENSBTAP00000039155  ...............D..............................................................
ENSBTAP00000029333  ...............L..............................................................
ENSBTAP00000016315  ...............-..............................................................
ENSBTAP00000021091  ...............-..............................................................
ENSBTAP00000021618  ...............E..............................................................
ENSBTAP00000055520  ...............L..............................................................
ENSBTAP00000055624  ...............L..............................................................
ENSBTAP00000016319  ...............-..............................................................
ENSBTAP00000034078  ...............D..............................................................
ENSBTAP00000006645  ...............L..............................................................
ENSBTAP00000021909  ...............P..............................................................
ENSBTAP00000001426  ...............T..............................................................
ENSBTAP00000015802  ...............K..............................................................
ENSBTAP00000032680  ...............K..............................................................
ENSBTAP00000055007  ...............E..............................................................
ENSBTAP00000020148  ...............S..............................................................
ENSBTAP00000052345  ...............-..............................................................
ENSBTAP00000029334  ...............L..............................................................
ENSBTAP00000052345  ...............-..............................................................
ENSBTAP00000056127  ...............P..............................................................
ENSBTAP00000012557  ...............S..............................................................
ENSBTAP00000011888  ...............D..............................................................
ENSBTAP00000017060  ...............-..............................................................
ENSBTAP00000031854  ...............T..............................................................
ENSBTAP00000031823  ...............P..............................................................
ENSBTAP00000021603  ...............D..............................................................
ENSBTAP00000010838  ...............-..............................................................
ENSBTAP00000014575  ...............L..............................................................
ENSBTAP00000011215  ...............T..............................................................
ENSBTAP00000053698  ...............N..............................................................
ENSBTAP00000006806  ...............E..............................................................
ENSBTAP00000029334  ...............-..............................................................
ENSBTAP00000044105  ...............-..............................................................
ENSBTAP00000026904  ...............-..............................................................
ENSBTAP00000017060  ...............-..............................................................
ENSBTAP00000055520  ...............-..............................................................
ENSBTAP00000044226  ...............E..............................................................
ENSBTAP00000055624  ...............-..............................................................
ENSBTAP00000042182  ...............-..............................................................
ENSBTAP00000010796  ...............Q..............................................................
ENSBTAP00000021174  ...............E..............................................................
ENSBTAP00000006275  ...............-..............................................................
ENSBTAP00000020950  ...............P..............................................................
ENSBTAP00000053738  ...............Q..............................................................
ENSBTAP00000004963  ...............E..............................................................
ENSBTAP00000023774  ...............T..............................................................
ENSBTAP00000020395  ...............E..............................................................
ENSBTAP00000020150  ...............E..............................................................
ENSBTAP00000025561  ...............D..............................................................
ENSBTAP00000053738  ...............S..............................................................
ENSBTAP00000034009  ...............E..............................................................
ENSBTAP00000020539  ...............S..............................................................
ENSBTAP00000020778  ...............D..............................................................
ENSBTAP00000017461  ...............N..............................................................
ENSBTAP00000044096  ...............E..............................................................
ENSBTAP00000008523  ...............E..............................................................
ENSBTAP00000035196  ...............T..............................................................
ENSBTAP00000041997  ...............-..............................................................
ENSBTAP00000025499  ...............E..............................................................
ENSBTAP00000055481  ...............-..............................................................
ENSBTAP00000002174  ...............-..............................................................
ENSBTAP00000000589  ...............-..............................................................
ENSBTAP00000028239  ...............-..............................................................
ENSBTAP00000014894  ...............D..............................................................
ENSBTAP00000026544  ...............R..............................................................
ENSBTAP00000029333  ...............-..............................................................
ENSBTAP00000041966  ...............-..............................................................
ENSBTAP00000008933  ...............-..............................................................
ENSBTAP00000056088  ...............E..............................................................
ENSBTAP00000033794  ...............-..............................................................
ENSBTAP00000012786  ...............E..............................................................
ENSBTAP00000030018  ...............E..............................................................
ENSBTAP00000040233  ...............K..............................................................
ENSBTAP00000003365  ...............A..............................................................
ENSBTAP00000053176  ...............D..............................................................
ENSBTAP00000024301  ...............D..............................................................
ENSBTAP00000022292  ...............S..............................................................
ENSBTAP00000015611  ...............-..............................................................
ENSBTAP00000012770  ...............A..............................................................
ENSBTAP00000000847  ...............-..............................................................
ENSBTAP00000053738  ...............K..............................................................
ENSBTAP00000054975  ...............S..............................................................
ENSBTAP00000046639  ...............S..............................................................
ENSBTAP00000052345  ...............-..............................................................
ENSBTAP00000053164  ...............D..............................................................
ENSBTAP00000016774  ...............-..............................................................
ENSBTAP00000022630  ...............E..............................................................
ENSBTAP00000010796  ...............Ewaekmprgprplspkemanqellarlhkavtshyh...........................
ENSBTAP00000021909  ...............P..............................................................
ENSBTAP00000033974  ...............G..............................................................
ENSBTAP00000006711  ...............D..............................................................
ENSBTAP00000010796  ...............Q..............................................................
ENSBTAP00000004912  ...............A..............................................................
ENSBTAP00000005979  ...............T..............................................................
ENSBTAP00000053738  ...............Ewaekmprgprplspkemanqellarlhkavtshyh...........................
ENSBTAP00000053746  ...............E..............................................................
ENSBTAP00000023221  ...............F..............................................................
ENSBTAP00000019429  ...............-..............................................................
ENSBTAP00000052019  ...............-..............................................................
ENSBTAP00000042244  ...............-..............................................................
ENSBTAP00000053738  ...............S..............................................................
ENSBTAP00000018877  ...............-..............................................................
ENSBTAP00000053019  ...............K..............................................................
ENSBTAP00000003073  ...............F..............................................................
ENSBTAP00000012886  ...............-..............................................................
ENSBTAP00000044222  ...............-..............................................................
ENSBTAP00000028499  ...............-..............................................................
ENSBTAP00000047378  ...............T..............................................................
ENSBTAP00000009308  ...............-..............................................................
ENSBTAP00000017060  ...............-..............................................................
ENSBTAP00000050406  ...............K..............................................................
ENSBTAP00000031879  ...............K..............................................................
ENSBTAP00000031854  ...............D..............................................................
ENSBTAP00000001250  ...............D..............................................................
ENSBTAP00000026035  ...............-..............................................................
ENSBTAP00000011215  ...............D..............................................................
ENSBTAP00000002128  ...............D..............................................................
ENSBTAP00000053194  ...............D..............................................................
ENSBTAP00000056127  ...............E..............................................................
ENSBTAP00000033188  ...............-..............................................................
ENSBTAP00000053548  ...............-..............................................................
ENSBTAP00000011687  ...............E..............................................................
ENSBTAP00000007636  ...............R..............................................................
ENSBTAP00000020950  ...............-..............................................................
ENSBTAP00000009115  ...............-..............................................................
ENSBTAP00000023873  ...............-..............................................................
ENSBTAP00000054471  ...............-..............................................................
ENSBTAP00000039694  ...............E..............................................................
ENSBTAP00000025205  ...............-..............................................................
ENSBTAP00000047882  ...............E..............................................................
ENSBTAP00000001368  ...............-..............................................................
ENSBTAP00000029786  ...............E..............................................................
ENSBTAP00000028993  ...............-..............................................................
ENSBTAP00000023678  ...............D..............................................................
ENSBTAP00000034710  ...............-..............................................................
ENSBTAP00000031823  ...............H..............................................................
ENSBTAP00000038002  ...............D..............................................................
ENSBTAP00000021074  ...............-..............................................................
ENSBTAP00000026544  ...............V..............................................................
ENSBTAP00000007217  ...............I..............................................................
ENSBTAP00000029792  ...............E..............................................................
ENSBTAP00000044088  ...............E..............................................................
ENSBTAP00000017319  ...............-..............................................................
ENSBTAP00000044100  ...............-..............................................................
ENSBTAP00000033594  ...............P..............................................................
ENSBTAP00000026766  ...............E..............................................................
ENSBTAP00000055894  ...............-..............................................................
ENSBTAP00000015220  ...............-..............................................................
ENSBTAP00000033613  ...............-..............................................................
ENSBTAP00000056320  ...............T..............................................................
ENSBTAP00000025249  ...............-..............................................................
ENSBTAP00000029159  ...............-..............................................................
ENSBTAP00000044088  ...............E..............................................................
ENSBTAP00000016319  ...............-..............................................................
ENSBTAP00000017662  ...............-..............................................................
ENSBTAP00000012479  ...............Qnkgvedsnvketqssshqssiapqdynsqsevnesllevlkmalratkaklnie........
ENSBTAP00000029886  ...............-..............................................................
ENSBTAP00000027388  ...............-..............................................................
ENSBTAP00000039694  ...............A..............................................................
ENSBTAP00000023673  ...............-..............................................................
ENSBTAP00000041488  ...............-..............................................................
ENSBTAP00000001452  ...............-..............................................................
ENSBTAP00000028498  ...............E..............................................................
ENSBTAP00000001426  ...............E..............................................................
ENSBTAP00000020240  ...............L..............................................................
ENSBTAP00000053650  ...............L..............................................................
ENSBTAP00000041651  ...............Q..............................................................
ENSBTAP00000005154  ...............-..............................................................
ENSBTAP00000021174  ...............K..............................................................
ENSBTAP00000022068  ...............-..............................................................
ENSBTAP00000026682  ...............A..............................................................
ENSBTAP00000007636  ...............D..............................................................
ENSBTAP00000027954  ...............-..............................................................
ENSBTAP00000020778  ...............-..............................................................
ENSBTAP00000013601  ...............-..............................................................
ENSBTAP00000005477  ...............S..............................................................
ENSBTAP00000055305  ...............L..............................................................
ENSBTAP00000036054  ...............L..............................................................
ENSBTAP00000004912  ...............E..............................................................
ENSBTAP00000022292  ...............E..............................................................
ENSBTAP00000002717  ...............D..............................................................
ENSBTAP00000036015  ...............-..............................................................
ENSBTAP00000051638  ...............E..............................................................
ENSBTAP00000026766  ...............E..............................................................
ENSBTAP00000053738  ...............Q..............................................................
ENSBTAP00000016306  ...............S..............................................................
ENSBTAP00000013714  ...............E..............................................................
ENSBTAP00000036550  ...............E..............................................................
ENSBTAP00000053738  ...............P..............................................................
ENSBTAP00000023383  ...............-..............................................................
ENSBTAP00000027030  ...............A..............................................................
ENSBTAP00000053270  ...............A..............................................................
ENSBTAP00000054640  ...............A..............................................................
ENSBTAP00000012770  ...............H..............................................................
ENSBTAP00000009967  ...............E..............................................................
ENSBTAP00000015183  ...............-..............................................................
ENSBTAP00000014222  ...............T..............................................................
ENSBTAP00000026288  ...............-..............................................................
ENSBTAP00000002128  ...............A..............................................................
ENSBTAP00000003365  ...............D..............................................................
ENSBTAP00000053738  ...............-..............................................................
ENSBTAP00000009228  ...............-..............................................................
ENSBTAP00000026785  ...............-..............................................................
ENSBTAP00000002578  ...............Dnfdkiefnrmcwtlcvkknltknplfiteedaf.............................
ENSBTAP00000000106  ...............-..............................................................
ENSBTAP00000028840  ...............-..............................................................
ENSBTAP00000053594  ...............E..............................................................
ENSBTAP00000055414  ...............Tdmrrqmfadlflhcdrgkvgfldrqrtlalletfydqsskvlrgtlrnprqwpfvefgeidl
ENSBTAP00000026698  ...............E..............................................................
ENSBTAP00000017015  ...............-..............................................................
ENSBTAP00000049908  ...............-..............................................................
ENSBTAP00000021395  ...............-..............................................................
ENSBTAP00000007194  ...............V..............................................................
ENSBTAP00000025455  ...............L..............................................................


                                                                                                    
                                                                                                    
d1dgua_               ..............................................................................
ENSBTAP00000019411  ..............................................................................
ENSBTAP00000036057  ..............................................................................
ENSBTAP00000038404  ..............................................................................
ENSBTAP00000010971  ..............................................................................
ENSBTAP00000019803  ..............................................................................
ENSBTAP00000014038  ..............................................................................
ENSBTAP00000002055  ..............................................................................
ENSBTAP00000049731  ..............................................................................
ENSBTAP00000005577  ..............................................................................
ENSBTAP00000034949  ..............................................................................
ENSBTAP00000017447  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000046644  ..............................................................................
ENSBTAP00000022814  ..............................................................................
ENSBTAP00000019758  ..............................................................................
ENSBTAP00000019321  ..............................................................................
ENSBTAP00000011677  ..............................................................................
ENSBTAP00000011680  ..............................................................................
ENSBTAP00000021742  ..............................................................................
ENSBTAP00000005348  ..............................................................................
ENSBTAP00000016609  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000018403  ..............................................................................
ENSBTAP00000026407  ..............................................................................
ENSBTAP00000052557  ..............................................................................
ENSBTAP00000054167  ..............................................................................
ENSBTAP00000010319  ..............................................................................
ENSBTAP00000041545  ..............................................................................
ENSBTAP00000055204  ..............................................................................
ENSBTAP00000003718  ..............................................................................
ENSBTAP00000011676  ..............................................................................
ENSBTAP00000049395  ..............................................................................
ENSBTAP00000054983  ..............................................................................
ENSBTAP00000052219  ..............................................................................
ENSBTAP00000025402  ..............................................................................
ENSBTAP00000011678  ..............................................................................
ENSBTAP00000000433  ..............................................................................
ENSBTAP00000021491  ..............................................................................
ENSBTAP00000044733  ..............................................................................
ENSBTAP00000010937  ..............................................................................
ENSBTAP00000056439  ..............................................................................
ENSBTAP00000055780  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000034705  ..............................................................................
ENSBTAP00000035936  ..............................................................................
ENSBTAP00000013699  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000011496  ..............................................................................
ENSBTAP00000019111  ..............................................................................
ENSBTAP00000017036  ..............................................................................
ENSBTAP00000003213  ..............................................................................
ENSBTAP00000055444  ..............................................................................
ENSBTAP00000024550  ..............................................................................
ENSBTAP00000015248  ..............................................................................
ENSBTAP00000021328  ..............................................................................
ENSBTAP00000037091  ..............................................................................
ENSBTAP00000029967  ..............................................................................
ENSBTAP00000021449  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000042361  ..............................................................................
ENSBTAP00000016509  ..............................................................................
ENSBTAP00000026714  ..............................................................................
ENSBTAP00000004690  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000013117  ..............................................................................
ENSBTAP00000017574  ..............................................................................
ENSBTAP00000004885  ..............................................................................
ENSBTAP00000008961  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000006283  ..............................................................................
ENSBTAP00000014306  ..............................................................................
ENSBTAP00000053252  ..............................................................................
ENSBTAP00000014304  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000041264  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000017358  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000055296  ..............................................................................
ENSBTAP00000016852  ..............................................................................
ENSBTAP00000036380  ..............................................................................
ENSBTAP00000041719  ..............................................................................
ENSBTAP00000049636  ..............................................................................
ENSBTAP00000024444  ..............................................................................
ENSBTAP00000004556  ..............................................................................
ENSBTAP00000038767  ..............................................................................
ENSBTAP00000031285  ..............................................................................
ENSBTAP00000011457  ..............................................................................
ENSBTAP00000011047  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000037104  ..............................................................................
ENSBTAP00000002672  ..............................................................................
ENSBTAP00000028269  ..............................................................................
ENSBTAP00000016647  ..............................................................................
ENSBTAP00000004536  ..............................................................................
ENSBTAP00000042177  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000050283  ..............................................................................
ENSBTAP00000048539  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000007972  ..............................................................................
ENSBTAP00000040815  ..............................................................................
ENSBTAP00000025661  ..............................................................................
ENSBTAP00000028350  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000021537  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000039155  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000016315  ..............................................................................
ENSBTAP00000021091  ..............................................................................
ENSBTAP00000021618  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000034078  ..............................................................................
ENSBTAP00000006645  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000015802  ..............................................................................
ENSBTAP00000032680  ..............................................................................
ENSBTAP00000055007  ..............................................................................
ENSBTAP00000020148  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000012557  ..............................................................................
ENSBTAP00000011888  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000021603  ..............................................................................
ENSBTAP00000010838  ..............................................................................
ENSBTAP00000014575  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000053698  ..............................................................................
ENSBTAP00000006806  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000044105  ..............................................................................
ENSBTAP00000026904  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000044226  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000042182  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000006275  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000004963  ..............................................................................
ENSBTAP00000023774  ..............................................................................
ENSBTAP00000020395  ..............................................................................
ENSBTAP00000020150  ..............................................................................
ENSBTAP00000025561  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000034009  ..............................................................................
ENSBTAP00000020539  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000017461  ..............................................................................
ENSBTAP00000044096  ..............................................................................
ENSBTAP00000008523  ..............................................................................
ENSBTAP00000035196  ..............................................................................
ENSBTAP00000041997  ..............................................................................
ENSBTAP00000025499  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000002174  ..............................................................................
ENSBTAP00000000589  ..............................................................................
ENSBTAP00000028239  ..............................................................................
ENSBTAP00000014894  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000041966  ..............................................................................
ENSBTAP00000008933  ..............................................................................
ENSBTAP00000056088  ..............................................................................
ENSBTAP00000033794  ..............................................................................
ENSBTAP00000012786  ..............................................................................
ENSBTAP00000030018  ..............................................................................
ENSBTAP00000040233  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000024301  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000015611  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000000847  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000054975  ..............................................................................
ENSBTAP00000046639  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000053164  ..............................................................................
ENSBTAP00000016774  ..............................................................................
ENSBTAP00000022630  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000033974  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000005979  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000053746  ..............................................................................
ENSBTAP00000023221  ..............................................................................
ENSBTAP00000019429  ..............................................................................
ENSBTAP00000052019  ..............................................................................
ENSBTAP00000042244  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000018877  ..............................................................................
ENSBTAP00000053019  ..............................................................................
ENSBTAP00000003073  ..............................................................................
ENSBTAP00000012886  ..............................................................................
ENSBTAP00000044222  ..............................................................................
ENSBTAP00000028499  ..............................................................................
ENSBTAP00000047378  ..............................................................................
ENSBTAP00000009308  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000050406  ..............................................................................
ENSBTAP00000031879  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000001250  ..............................................................................
ENSBTAP00000026035  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000053194  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000033188  ..............................................................................
ENSBTAP00000053548  ..............................................................................
ENSBTAP00000011687  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000009115  ..............................................................................
ENSBTAP00000023873  ..............................................................................
ENSBTAP00000054471  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000025205  ..............................................................................
ENSBTAP00000047882  ..............................................................................
ENSBTAP00000001368  ..............................................................................
ENSBTAP00000029786  ..............................................................................
ENSBTAP00000028993  ..............................................................................
ENSBTAP00000023678  ..............................................................................
ENSBTAP00000034710  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000021074  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000007217  ..............................................................................
ENSBTAP00000029792  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000017319  ..............................................................................
ENSBTAP00000044100  ..............................................................................
ENSBTAP00000033594  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000055894  ..............................................................................
ENSBTAP00000015220  ..............................................................................
ENSBTAP00000033613  ..............................................................................
ENSBTAP00000056320  ..............................................................................
ENSBTAP00000025249  ..............................................................................
ENSBTAP00000029159  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000017662  ..............................................................................
ENSBTAP00000012479  ..............................................................................
ENSBTAP00000029886  ..............................................................................
ENSBTAP00000027388  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000023673  ..............................................................................
ENSBTAP00000041488  ..............................................................................
ENSBTAP00000001452  ..............................................................................
ENSBTAP00000028498  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000020240  ..............................................................................
ENSBTAP00000053650  ..............................................................................
ENSBTAP00000041651  ..............................................................................
ENSBTAP00000005154  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000022068  ..............................................................................
ENSBTAP00000026682  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000027954  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000013601  ..............................................................................
ENSBTAP00000005477  ..............................................................................
ENSBTAP00000055305  ..............................................................................
ENSBTAP00000036054  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000002717  ..............................................................................
ENSBTAP00000036015  ..............................................................................
ENSBTAP00000051638  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000016306  ..............................................................................
ENSBTAP00000013714  ..............................................................................
ENSBTAP00000036550  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000023383  ..............................................................................
ENSBTAP00000027030  ..............................................................................
ENSBTAP00000053270  ..............................................................................
ENSBTAP00000054640  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000009967  ..............................................................................
ENSBTAP00000015183  ..............................................................................
ENSBTAP00000014222  ..............................................................................
ENSBTAP00000026288  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000009228  ..............................................................................
ENSBTAP00000026785  ..............................................................................
ENSBTAP00000002578  ..............................................................................
ENSBTAP00000000106  ..............................................................................
ENSBTAP00000028840  ..............................................................................
ENSBTAP00000053594  ..............................................................................
ENSBTAP00000055414  pefwgdmdnqkhiyedfdnvllemntlpsekhfsktqskllaspedqhehyrestlpqsppeqqrgatveqgpngist
ENSBTAP00000026698  ..............................................................................
ENSBTAP00000017015  ..............................................................................
ENSBTAP00000049908  ..............................................................................
ENSBTAP00000021395  ..............................................................................
ENSBTAP00000007194  ..............................................................................
ENSBTAP00000025455  ..............................................................................


                                                                                                    
                                                                                                    
d1dgua_               ..............................................................................
ENSBTAP00000019411  ..............................................................................
ENSBTAP00000036057  ..............................................................................
ENSBTAP00000038404  ..............................................................................
ENSBTAP00000010971  ..............................................................................
ENSBTAP00000019803  ..............................................................................
ENSBTAP00000014038  ..............................................................................
ENSBTAP00000002055  ..............................................................................
ENSBTAP00000049731  ..............................................................................
ENSBTAP00000005577  ..............................................................................
ENSBTAP00000034949  ..............................................................................
ENSBTAP00000017447  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000046644  ..............................................................................
ENSBTAP00000022814  ..............................................................................
ENSBTAP00000019758  ..............................................................................
ENSBTAP00000019321  ..............................................................................
ENSBTAP00000011677  ..............................................................................
ENSBTAP00000011680  ..............................................................................
ENSBTAP00000021742  ..............................................................................
ENSBTAP00000005348  ..............................................................................
ENSBTAP00000016609  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000018403  ..............................................................................
ENSBTAP00000026407  ..............................................................................
ENSBTAP00000052557  ..............................................................................
ENSBTAP00000054167  ..............................................................................
ENSBTAP00000010319  ..............................................................................
ENSBTAP00000041545  ..............................................................................
ENSBTAP00000055204  ..............................................................................
ENSBTAP00000003718  ..............................................................................
ENSBTAP00000011676  ..............................................................................
ENSBTAP00000049395  ..............................................................................
ENSBTAP00000054983  ..............................................................................
ENSBTAP00000052219  ..............................................................................
ENSBTAP00000025402  ..............................................................................
ENSBTAP00000011678  ..............................................................................
ENSBTAP00000000433  ..............................................................................
ENSBTAP00000021491  ..............................................................................
ENSBTAP00000044733  ..............................................................................
ENSBTAP00000010937  ..............................................................................
ENSBTAP00000056439  ..............................................................................
ENSBTAP00000055780  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000034705  ..............................................................................
ENSBTAP00000035936  ..............................................................................
ENSBTAP00000013699  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000011496  ..............................................................................
ENSBTAP00000019111  ..............................................................................
ENSBTAP00000017036  ..............................................................................
ENSBTAP00000003213  ..............................................................................
ENSBTAP00000055444  ..............................................................................
ENSBTAP00000024550  ..............................................................................
ENSBTAP00000015248  ..............................................................................
ENSBTAP00000021328  ..............................................................................
ENSBTAP00000037091  ..............................................................................
ENSBTAP00000029967  ..............................................................................
ENSBTAP00000021449  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000042361  ..............................................................................
ENSBTAP00000016509  ..............................................................................
ENSBTAP00000026714  ..............................................................................
ENSBTAP00000004690  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000013117  ..............................................................................
ENSBTAP00000017574  ..............................................................................
ENSBTAP00000004885  ..............................................................................
ENSBTAP00000008961  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000006283  ..............................................................................
ENSBTAP00000014306  ..............................................................................
ENSBTAP00000053252  ..............................................................................
ENSBTAP00000014304  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000041264  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000017358  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000055296  ..............................................................................
ENSBTAP00000016852  ..............................................................................
ENSBTAP00000036380  ..............................................................................
ENSBTAP00000041719  ..............................................................................
ENSBTAP00000049636  ..............................................................................
ENSBTAP00000024444  ..............................................................................
ENSBTAP00000004556  ..............................................................................
ENSBTAP00000038767  ..............................................................................
ENSBTAP00000031285  ..............................................................................
ENSBTAP00000011457  ..............................................................................
ENSBTAP00000011047  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000037104  ..............................................................................
ENSBTAP00000002672  ..............................................................................
ENSBTAP00000028269  ..............................................................................
ENSBTAP00000016647  ..............................................................................
ENSBTAP00000004536  ..............................................................................
ENSBTAP00000042177  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000050283  ..............................................................................
ENSBTAP00000048539  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000007972  ..............................................................................
ENSBTAP00000040815  ..............................................................................
ENSBTAP00000025661  ..............................................................................
ENSBTAP00000028350  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000021537  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000039155  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000016315  ..............................................................................
ENSBTAP00000021091  ..............................................................................
ENSBTAP00000021618  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000034078  ..............................................................................
ENSBTAP00000006645  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000015802  ..............................................................................
ENSBTAP00000032680  ..............................................................................
ENSBTAP00000055007  ..............................................................................
ENSBTAP00000020148  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000012557  ..............................................................................
ENSBTAP00000011888  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000021603  ..............................................................................
ENSBTAP00000010838  ..............................................................................
ENSBTAP00000014575  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000053698  ..............................................................................
ENSBTAP00000006806  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000044105  ..............................................................................
ENSBTAP00000026904  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000044226  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000042182  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000006275  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000004963  ..............................................................................
ENSBTAP00000023774  ..............................................................................
ENSBTAP00000020395  ..............................................................................
ENSBTAP00000020150  ..............................................................................
ENSBTAP00000025561  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000034009  ..............................................................................
ENSBTAP00000020539  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000017461  ..............................................................................
ENSBTAP00000044096  ..............................................................................
ENSBTAP00000008523  ..............................................................................
ENSBTAP00000035196  ..............................................................................
ENSBTAP00000041997  ..............................................................................
ENSBTAP00000025499  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000002174  ..............................................................................
ENSBTAP00000000589  ..............................................................................
ENSBTAP00000028239  ..............................................................................
ENSBTAP00000014894  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000041966  ..............................................................................
ENSBTAP00000008933  ..............................................................................
ENSBTAP00000056088  ..............................................................................
ENSBTAP00000033794  ..............................................................................
ENSBTAP00000012786  ..............................................................................
ENSBTAP00000030018  ..............................................................................
ENSBTAP00000040233  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000024301  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000015611  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000000847  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000054975  ..............................................................................
ENSBTAP00000046639  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000053164  ..............................................................................
ENSBTAP00000016774  ..............................................................................
ENSBTAP00000022630  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000033974  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000005979  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000053746  ..............................................................................
ENSBTAP00000023221  ..............................................................................
ENSBTAP00000019429  ..............................................................................
ENSBTAP00000052019  ..............................................................................
ENSBTAP00000042244  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000018877  ..............................................................................
ENSBTAP00000053019  ..............................................................................
ENSBTAP00000003073  ..............................................................................
ENSBTAP00000012886  ..............................................................................
ENSBTAP00000044222  ..............................................................................
ENSBTAP00000028499  ..............................................................................
ENSBTAP00000047378  ..............................................................................
ENSBTAP00000009308  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000050406  ..............................................................................
ENSBTAP00000031879  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000001250  ..............................................................................
ENSBTAP00000026035  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000053194  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000033188  ..............................................................................
ENSBTAP00000053548  ..............................................................................
ENSBTAP00000011687  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000009115  ..............................................................................
ENSBTAP00000023873  ..............................................................................
ENSBTAP00000054471  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000025205  ..............................................................................
ENSBTAP00000047882  ..............................................................................
ENSBTAP00000001368  ..............................................................................
ENSBTAP00000029786  ..............................................................................
ENSBTAP00000028993  ..............................................................................
ENSBTAP00000023678  ..............................................................................
ENSBTAP00000034710  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000021074  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000007217  ..............................................................................
ENSBTAP00000029792  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000017319  ..............................................................................
ENSBTAP00000044100  ..............................................................................
ENSBTAP00000033594  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000055894  ..............................................................................
ENSBTAP00000015220  ..............................................................................
ENSBTAP00000033613  ..............................................................................
ENSBTAP00000056320  ..............................................................................
ENSBTAP00000025249  ..............................................................................
ENSBTAP00000029159  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000017662  ..............................................................................
ENSBTAP00000012479  ..............................................................................
ENSBTAP00000029886  ..............................................................................
ENSBTAP00000027388  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000023673  ..............................................................................
ENSBTAP00000041488  ..............................................................................
ENSBTAP00000001452  ..............................................................................
ENSBTAP00000028498  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000020240  ..............................................................................
ENSBTAP00000053650  ..............................................................................
ENSBTAP00000041651  ..............................................................................
ENSBTAP00000005154  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000022068  ..............................................................................
ENSBTAP00000026682  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000027954  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000013601  ..............................................................................
ENSBTAP00000005477  ..............................................................................
ENSBTAP00000055305  ..............................................................................
ENSBTAP00000036054  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000002717  ..............................................................................
ENSBTAP00000036015  ..............................................................................
ENSBTAP00000051638  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000016306  ..............................................................................
ENSBTAP00000013714  ..............................................................................
ENSBTAP00000036550  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000023383  ..............................................................................
ENSBTAP00000027030  ..............................................................................
ENSBTAP00000053270  ..............................................................................
ENSBTAP00000054640  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000009967  ..............................................................................
ENSBTAP00000015183  ..............................................................................
ENSBTAP00000014222  ..............................................................................
ENSBTAP00000026288  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000009228  ..............................................................................
ENSBTAP00000026785  ..............................................................................
ENSBTAP00000002578  ..............................................................................
ENSBTAP00000000106  ..............................................................................
ENSBTAP00000028840  ..............................................................................
ENSBTAP00000053594  ..............................................................................
ENSBTAP00000055414  reqeqpeestgeqelneesvskegtytgstpeqrssreliteqrphhepiteqgvpqgthiestaeqglseesitteg
ENSBTAP00000026698  ..............................................................................
ENSBTAP00000017015  ..............................................................................
ENSBTAP00000049908  ..............................................................................
ENSBTAP00000021395  ..............................................................................
ENSBTAP00000007194  ..............................................................................
ENSBTAP00000025455  ..............................................................................


                                                                                                    
                                                                                                    
d1dgua_               ..............................................................................
ENSBTAP00000019411  ..............................................................................
ENSBTAP00000036057  ..............................................................................
ENSBTAP00000038404  ..............................................................................
ENSBTAP00000010971  ..............................................................................
ENSBTAP00000019803  ..............................................................................
ENSBTAP00000014038  ..............................................................................
ENSBTAP00000002055  ..............................................................................
ENSBTAP00000049731  ..............................................................................
ENSBTAP00000005577  ..............................................................................
ENSBTAP00000034949  ..............................................................................
ENSBTAP00000017447  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000046644  ..............................................................................
ENSBTAP00000022814  ..............................................................................
ENSBTAP00000019758  ..............................................................................
ENSBTAP00000019321  ..............................................................................
ENSBTAP00000011677  ..............................................................................
ENSBTAP00000011680  ..............................................................................
ENSBTAP00000021742  ..............................................................................
ENSBTAP00000005348  ..............................................................................
ENSBTAP00000016609  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000018403  ..............................................................................
ENSBTAP00000026407  ..............................................................................
ENSBTAP00000052557  ..............................................................................
ENSBTAP00000054167  ..............................................................................
ENSBTAP00000010319  ..............................................................................
ENSBTAP00000041545  ..............................................................................
ENSBTAP00000055204  ..............................................................................
ENSBTAP00000003718  ..............................................................................
ENSBTAP00000011676  ..............................................................................
ENSBTAP00000049395  ..............................................................................
ENSBTAP00000054983  ..............................................................................
ENSBTAP00000052219  ..............................................................................
ENSBTAP00000025402  ..............................................................................
ENSBTAP00000011678  ..............................................................................
ENSBTAP00000000433  ..............................................................................
ENSBTAP00000021491  ..............................................................................
ENSBTAP00000044733  ..............................................................................
ENSBTAP00000010937  ..............................................................................
ENSBTAP00000056439  ..............................................................................
ENSBTAP00000055780  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000034705  ..............................................................................
ENSBTAP00000035936  ..............................................................................
ENSBTAP00000013699  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000011496  ..............................................................................
ENSBTAP00000019111  ..............................................................................
ENSBTAP00000017036  ..............................................................................
ENSBTAP00000003213  ..............................................................................
ENSBTAP00000055444  ..............................................................................
ENSBTAP00000024550  ..............................................................................
ENSBTAP00000015248  ..............................................................................
ENSBTAP00000021328  ..............................................................................
ENSBTAP00000037091  ..............................................................................
ENSBTAP00000029967  ..............................................................................
ENSBTAP00000021449  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000042361  ..............................................................................
ENSBTAP00000016509  ..............................................................................
ENSBTAP00000026714  ..............................................................................
ENSBTAP00000004690  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000013117  ..............................................................................
ENSBTAP00000017574  ..............................................................................
ENSBTAP00000004885  ..............................................................................
ENSBTAP00000008961  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000006283  ..............................................................................
ENSBTAP00000014306  ..............................................................................
ENSBTAP00000053252  ..............................................................................
ENSBTAP00000014304  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000041264  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000017358  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000055296  ..............................................................................
ENSBTAP00000016852  ..............................................................................
ENSBTAP00000036380  ..............................................................................
ENSBTAP00000041719  ..............................................................................
ENSBTAP00000049636  ..............................................................................
ENSBTAP00000024444  ..............................................................................
ENSBTAP00000004556  ..............................................................................
ENSBTAP00000038767  ..............................................................................
ENSBTAP00000031285  ..............................................................................
ENSBTAP00000011457  ..............................................................................
ENSBTAP00000011047  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000037104  ..............................................................................
ENSBTAP00000002672  ..............................................................................
ENSBTAP00000028269  ..............................................................................
ENSBTAP00000016647  ..............................................................................
ENSBTAP00000004536  ..............................................................................
ENSBTAP00000042177  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000050283  ..............................................................................
ENSBTAP00000048539  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000007972  ..............................................................................
ENSBTAP00000040815  ..............................................................................
ENSBTAP00000025661  ..............................................................................
ENSBTAP00000028350  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000021537  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000039155  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000016315  ..............................................................................
ENSBTAP00000021091  ..............................................................................
ENSBTAP00000021618  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000034078  ..............................................................................
ENSBTAP00000006645  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000015802  ..............................................................................
ENSBTAP00000032680  ..............................................................................
ENSBTAP00000055007  ..............................................................................
ENSBTAP00000020148  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000012557  ..............................................................................
ENSBTAP00000011888  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000021603  ..............................................................................
ENSBTAP00000010838  ..............................................................................
ENSBTAP00000014575  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000053698  ..............................................................................
ENSBTAP00000006806  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000044105  ..............................................................................
ENSBTAP00000026904  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000044226  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000042182  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000006275  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000004963  ..............................................................................
ENSBTAP00000023774  ..............................................................................
ENSBTAP00000020395  ..............................................................................
ENSBTAP00000020150  ..............................................................................
ENSBTAP00000025561  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000034009  ..............................................................................
ENSBTAP00000020539  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000017461  ..............................................................................
ENSBTAP00000044096  ..............................................................................
ENSBTAP00000008523  ..............................................................................
ENSBTAP00000035196  ..............................................................................
ENSBTAP00000041997  ..............................................................................
ENSBTAP00000025499  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000002174  ..............................................................................
ENSBTAP00000000589  ..............................................................................
ENSBTAP00000028239  ..............................................................................
ENSBTAP00000014894  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000041966  ..............................................................................
ENSBTAP00000008933  ..............................................................................
ENSBTAP00000056088  ..............................................................................
ENSBTAP00000033794  ..............................................................................
ENSBTAP00000012786  ..............................................................................
ENSBTAP00000030018  ..............................................................................
ENSBTAP00000040233  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000024301  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000015611  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000000847  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000054975  ..............................................................................
ENSBTAP00000046639  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000053164  ..............................................................................
ENSBTAP00000016774  ..............................................................................
ENSBTAP00000022630  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000033974  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000005979  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000053746  ..............................................................................
ENSBTAP00000023221  ..............................................................................
ENSBTAP00000019429  ..............................................................................
ENSBTAP00000052019  ..............................................................................
ENSBTAP00000042244  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000018877  ..............................................................................
ENSBTAP00000053019  ..............................................................................
ENSBTAP00000003073  ..............................................................................
ENSBTAP00000012886  ..............................................................................
ENSBTAP00000044222  ..............................................................................
ENSBTAP00000028499  ..............................................................................
ENSBTAP00000047378  ..............................................................................
ENSBTAP00000009308  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000050406  ..............................................................................
ENSBTAP00000031879  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000001250  ..............................................................................
ENSBTAP00000026035  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000053194  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000033188  ..............................................................................
ENSBTAP00000053548  ..............................................................................
ENSBTAP00000011687  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000009115  ..............................................................................
ENSBTAP00000023873  ..............................................................................
ENSBTAP00000054471  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000025205  ..............................................................................
ENSBTAP00000047882  ..............................................................................
ENSBTAP00000001368  ..............................................................................
ENSBTAP00000029786  ..............................................................................
ENSBTAP00000028993  ..............................................................................
ENSBTAP00000023678  ..............................................................................
ENSBTAP00000034710  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000021074  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000007217  ..............................................................................
ENSBTAP00000029792  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000017319  ..............................................................................
ENSBTAP00000044100  ..............................................................................
ENSBTAP00000033594  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000055894  ..............................................................................
ENSBTAP00000015220  ..............................................................................
ENSBTAP00000033613  ..............................................................................
ENSBTAP00000056320  ..............................................................................
ENSBTAP00000025249  ..............................................................................
ENSBTAP00000029159  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000017662  ..............................................................................
ENSBTAP00000012479  ..............................................................................
ENSBTAP00000029886  ..............................................................................
ENSBTAP00000027388  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000023673  ..............................................................................
ENSBTAP00000041488  ..............................................................................
ENSBTAP00000001452  ..............................................................................
ENSBTAP00000028498  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000020240  ..............................................................................
ENSBTAP00000053650  ..............................................................................
ENSBTAP00000041651  ..............................................................................
ENSBTAP00000005154  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000022068  ..............................................................................
ENSBTAP00000026682  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000027954  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000013601  ..............................................................................
ENSBTAP00000005477  ..............................................................................
ENSBTAP00000055305  ..............................................................................
ENSBTAP00000036054  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000002717  ..............................................................................
ENSBTAP00000036015  ..............................................................................
ENSBTAP00000051638  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000016306  ..............................................................................
ENSBTAP00000013714  ..............................................................................
ENSBTAP00000036550  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000023383  ..............................................................................
ENSBTAP00000027030  ..............................................................................
ENSBTAP00000053270  ..............................................................................
ENSBTAP00000054640  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000009967  ..............................................................................
ENSBTAP00000015183  ..............................................................................
ENSBTAP00000014222  ..............................................................................
ENSBTAP00000026288  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000009228  ..............................................................................
ENSBTAP00000026785  ..............................................................................
ENSBTAP00000002578  ..............................................................................
ENSBTAP00000000106  ..............................................................................
ENSBTAP00000028840  ..............................................................................
ENSBTAP00000053594  ..............................................................................
ENSBTAP00000055414  qhegsttgqgshgksteeqgsrresqsdqgqpretmaeqeahresqsdqgphggetileeqqdtdltsqsrkgsltge
ENSBTAP00000026698  ..............................................................................
ENSBTAP00000017015  ..............................................................................
ENSBTAP00000049908  ..............................................................................
ENSBTAP00000021395  ..............................................................................
ENSBTAP00000007194  ..............................................................................
ENSBTAP00000025455  ..............................................................................


                                                                                                    
                                                                                                    
d1dgua_               ..............................................................................
ENSBTAP00000019411  ..............................................................................
ENSBTAP00000036057  ..............................................................................
ENSBTAP00000038404  ..............................................................................
ENSBTAP00000010971  ..............................................................................
ENSBTAP00000019803  ..............................................................................
ENSBTAP00000014038  ..............................................................................
ENSBTAP00000002055  ..............................................................................
ENSBTAP00000049731  ..............................................................................
ENSBTAP00000005577  ..............................................................................
ENSBTAP00000034949  ..............................................................................
ENSBTAP00000017447  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000046644  ..............................................................................
ENSBTAP00000022814  ..............................................................................
ENSBTAP00000019758  ..............................................................................
ENSBTAP00000019321  ..............................................................................
ENSBTAP00000011677  ..............................................................................
ENSBTAP00000011680  ..............................................................................
ENSBTAP00000021742  ..............................................................................
ENSBTAP00000005348  ..............................................................................
ENSBTAP00000016609  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000018403  ..............................................................................
ENSBTAP00000026407  ..............................................................................
ENSBTAP00000052557  ..............................................................................
ENSBTAP00000054167  ..............................................................................
ENSBTAP00000010319  ..............................................................................
ENSBTAP00000041545  ..............................................................................
ENSBTAP00000055204  ..............................................................................
ENSBTAP00000003718  ..............................................................................
ENSBTAP00000011676  ..............................................................................
ENSBTAP00000049395  ..............................................................................
ENSBTAP00000054983  ..............................................................................
ENSBTAP00000052219  ..............................................................................
ENSBTAP00000025402  ..............................................................................
ENSBTAP00000011678  ..............................................................................
ENSBTAP00000000433  ..............................................................................
ENSBTAP00000021491  ..............................................................................
ENSBTAP00000044733  ..............................................................................
ENSBTAP00000010937  ..............................................................................
ENSBTAP00000056439  ..............................................................................
ENSBTAP00000055780  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000034705  ..............................................................................
ENSBTAP00000035936  ..............................................................................
ENSBTAP00000013699  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000011496  ..............................................................................
ENSBTAP00000019111  ..............................................................................
ENSBTAP00000017036  ..............................................................................
ENSBTAP00000003213  ..............................................................................
ENSBTAP00000055444  ..............................................................................
ENSBTAP00000024550  ..............................................................................
ENSBTAP00000015248  ..............................................................................
ENSBTAP00000021328  ..............................................................................
ENSBTAP00000037091  ..............................................................................
ENSBTAP00000029967  ..............................................................................
ENSBTAP00000021449  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000042361  ..............................................................................
ENSBTAP00000016509  ..............................................................................
ENSBTAP00000026714  ..............................................................................
ENSBTAP00000004690  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000013117  ..............................................................................
ENSBTAP00000017574  ..............................................................................
ENSBTAP00000004885  ..............................................................................
ENSBTAP00000008961  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000006283  ..............................................................................
ENSBTAP00000014306  ..............................................................................
ENSBTAP00000053252  ..............................................................................
ENSBTAP00000014304  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000041264  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000017358  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000055296  ..............................................................................
ENSBTAP00000016852  ..............................................................................
ENSBTAP00000036380  ..............................................................................
ENSBTAP00000041719  ..............................................................................
ENSBTAP00000049636  ..............................................................................
ENSBTAP00000024444  ..............................................................................
ENSBTAP00000004556  ..............................................................................
ENSBTAP00000038767  ..............................................................................
ENSBTAP00000031285  ..............................................................................
ENSBTAP00000011457  ..............................................................................
ENSBTAP00000011047  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000037104  ..............................................................................
ENSBTAP00000002672  ..............................................................................
ENSBTAP00000028269  ..............................................................................
ENSBTAP00000016647  ..............................................................................
ENSBTAP00000004536  ..............................................................................
ENSBTAP00000042177  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000050283  ..............................................................................
ENSBTAP00000048539  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000007972  ..............................................................................
ENSBTAP00000040815  ..............................................................................
ENSBTAP00000025661  ..............................................................................
ENSBTAP00000028350  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000021537  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000039155  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000016315  ..............................................................................
ENSBTAP00000021091  ..............................................................................
ENSBTAP00000021618  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000034078  ..............................................................................
ENSBTAP00000006645  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000015802  ..............................................................................
ENSBTAP00000032680  ..............................................................................
ENSBTAP00000055007  ..............................................................................
ENSBTAP00000020148  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000012557  ..............................................................................
ENSBTAP00000011888  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000021603  ..............................................................................
ENSBTAP00000010838  ..............................................................................
ENSBTAP00000014575  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000053698  ..............................................................................
ENSBTAP00000006806  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000044105  ..............................................................................
ENSBTAP00000026904  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000044226  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000042182  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000006275  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000004963  ..............................................................................
ENSBTAP00000023774  ..............................................................................
ENSBTAP00000020395  ..............................................................................
ENSBTAP00000020150  ..............................................................................
ENSBTAP00000025561  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000034009  ..............................................................................
ENSBTAP00000020539  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000017461  ..............................................................................
ENSBTAP00000044096  ..............................................................................
ENSBTAP00000008523  ..............................................................................
ENSBTAP00000035196  ..............................................................................
ENSBTAP00000041997  ..............................................................................
ENSBTAP00000025499  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000002174  ..............................................................................
ENSBTAP00000000589  ..............................................................................
ENSBTAP00000028239  ..............................................................................
ENSBTAP00000014894  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000041966  ..............................................................................
ENSBTAP00000008933  ..............................................................................
ENSBTAP00000056088  ..............................................................................
ENSBTAP00000033794  ..............................................................................
ENSBTAP00000012786  ..............................................................................
ENSBTAP00000030018  ..............................................................................
ENSBTAP00000040233  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000024301  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000015611  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000000847  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000054975  ..............................................................................
ENSBTAP00000046639  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000053164  ..............................................................................
ENSBTAP00000016774  ..............................................................................
ENSBTAP00000022630  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000033974  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000005979  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000053746  ..............................................................................
ENSBTAP00000023221  ..............................................................................
ENSBTAP00000019429  ..............................................................................
ENSBTAP00000052019  ..............................................................................
ENSBTAP00000042244  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000018877  ..............................................................................
ENSBTAP00000053019  ..............................................................................
ENSBTAP00000003073  ..............................................................................
ENSBTAP00000012886  ..............................................................................
ENSBTAP00000044222  ..............................................................................
ENSBTAP00000028499  ..............................................................................
ENSBTAP00000047378  ..............................................................................
ENSBTAP00000009308  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000050406  ..............................................................................
ENSBTAP00000031879  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000001250  ..............................................................................
ENSBTAP00000026035  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000053194  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000033188  ..............................................................................
ENSBTAP00000053548  ..............................................................................
ENSBTAP00000011687  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000009115  ..............................................................................
ENSBTAP00000023873  ..............................................................................
ENSBTAP00000054471  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000025205  ..............................................................................
ENSBTAP00000047882  ..............................................................................
ENSBTAP00000001368  ..............................................................................
ENSBTAP00000029786  ..............................................................................
ENSBTAP00000028993  ..............................................................................
ENSBTAP00000023678  ..............................................................................
ENSBTAP00000034710  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000021074  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000007217  ..............................................................................
ENSBTAP00000029792  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000017319  ..............................................................................
ENSBTAP00000044100  ..............................................................................
ENSBTAP00000033594  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000055894  ..............................................................................
ENSBTAP00000015220  ..............................................................................
ENSBTAP00000033613  ..............................................................................
ENSBTAP00000056320  ..............................................................................
ENSBTAP00000025249  ..............................................................................
ENSBTAP00000029159  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000017662  ..............................................................................
ENSBTAP00000012479  ..............................................................................
ENSBTAP00000029886  ..............................................................................
ENSBTAP00000027388  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000023673  ..............................................................................
ENSBTAP00000041488  ..............................................................................
ENSBTAP00000001452  ..............................................................................
ENSBTAP00000028498  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000020240  ..............................................................................
ENSBTAP00000053650  ..............................................................................
ENSBTAP00000041651  ..............................................................................
ENSBTAP00000005154  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000022068  ..............................................................................
ENSBTAP00000026682  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000027954  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000013601  ..............................................................................
ENSBTAP00000005477  ..............................................................................
ENSBTAP00000055305  ..............................................................................
ENSBTAP00000036054  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000002717  ..............................................................................
ENSBTAP00000036015  ..............................................................................
ENSBTAP00000051638  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000016306  ..............................................................................
ENSBTAP00000013714  ..............................................................................
ENSBTAP00000036550  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000023383  ..............................................................................
ENSBTAP00000027030  ..............................................................................
ENSBTAP00000053270  ..............................................................................
ENSBTAP00000054640  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000009967  ..............................................................................
ENSBTAP00000015183  ..............................................................................
ENSBTAP00000014222  ..............................................................................
ENSBTAP00000026288  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000009228  ..............................................................................
ENSBTAP00000026785  ..............................................................................
ENSBTAP00000002578  ..............................................................................
ENSBTAP00000000106  ..............................................................................
ENSBTAP00000028840  ..............................................................................
ENSBTAP00000053594  ..............................................................................
ENSBTAP00000055414  sktsresisfehteippqegrtqahayeellfvspelqaktgvsipedhlsepakkevqkdkscepksqkiegkswtg
ENSBTAP00000026698  ..............................................................................
ENSBTAP00000017015  ..............................................................................
ENSBTAP00000049908  ..............................................................................
ENSBTAP00000021395  ..............................................................................
ENSBTAP00000007194  ..............................................................................
ENSBTAP00000025455  ..............................................................................


                                                                                                    
                                                                                                    
d1dgua_               ..............................................................................
ENSBTAP00000019411  ..............................................................................
ENSBTAP00000036057  ..............................................................................
ENSBTAP00000038404  ..............................................................................
ENSBTAP00000010971  ..............................................................................
ENSBTAP00000019803  ..............................................................................
ENSBTAP00000014038  ..............................................................................
ENSBTAP00000002055  ..............................................................................
ENSBTAP00000049731  ..............................................................................
ENSBTAP00000005577  ..............................................................................
ENSBTAP00000034949  ..............................................................................
ENSBTAP00000017447  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000046644  ..............................................................................
ENSBTAP00000022814  ..............................................................................
ENSBTAP00000019758  ..............................................................................
ENSBTAP00000019321  ..............................................................................
ENSBTAP00000011677  ..............................................................................
ENSBTAP00000011680  ..............................................................................
ENSBTAP00000021742  ..............................................................................
ENSBTAP00000005348  ..............................................................................
ENSBTAP00000016609  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000018403  ..............................................................................
ENSBTAP00000026407  ..............................................................................
ENSBTAP00000052557  ..............................................................................
ENSBTAP00000054167  ..............................................................................
ENSBTAP00000010319  ..............................................................................
ENSBTAP00000041545  ..............................................................................
ENSBTAP00000055204  ..............................................................................
ENSBTAP00000003718  ..............................................................................
ENSBTAP00000011676  ..............................................................................
ENSBTAP00000049395  ..............................................................................
ENSBTAP00000054983  ..............................................................................
ENSBTAP00000052219  ..............................................................................
ENSBTAP00000025402  ..............................................................................
ENSBTAP00000011678  ..............................................................................
ENSBTAP00000000433  ..............................................................................
ENSBTAP00000021491  ..............................................................................
ENSBTAP00000044733  ..............................................................................
ENSBTAP00000010937  ..............................................................................
ENSBTAP00000056439  ..............................................................................
ENSBTAP00000055780  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000034705  ..............................................................................
ENSBTAP00000035936  ..............................................................................
ENSBTAP00000013699  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000011496  ..............................................................................
ENSBTAP00000019111  ..............................................................................
ENSBTAP00000017036  ..............................................................................
ENSBTAP00000003213  ..............................................................................
ENSBTAP00000055444  ..............................................................................
ENSBTAP00000024550  ..............................................................................
ENSBTAP00000015248  ..............................................................................
ENSBTAP00000021328  ..............................................................................
ENSBTAP00000037091  ..............................................................................
ENSBTAP00000029967  ..............................................................................
ENSBTAP00000021449  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000042361  ..............................................................................
ENSBTAP00000016509  ..............................................................................
ENSBTAP00000026714  ..............................................................................
ENSBTAP00000004690  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000013117  ..............................................................................
ENSBTAP00000017574  ..............................................................................
ENSBTAP00000004885  ..............................................................................
ENSBTAP00000008961  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000006283  ..............................................................................
ENSBTAP00000014306  ..............................................................................
ENSBTAP00000053252  ..............................................................................
ENSBTAP00000014304  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000041264  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000017358  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000055296  ..............................................................................
ENSBTAP00000016852  ..............................................................................
ENSBTAP00000036380  ..............................................................................
ENSBTAP00000041719  ..............................................................................
ENSBTAP00000049636  ..............................................................................
ENSBTAP00000024444  ..............................................................................
ENSBTAP00000004556  ..............................................................................
ENSBTAP00000038767  ..............................................................................
ENSBTAP00000031285  ..............................................................................
ENSBTAP00000011457  ..............................................................................
ENSBTAP00000011047  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000037104  ..............................................................................
ENSBTAP00000002672  ..............................................................................
ENSBTAP00000028269  ..............................................................................
ENSBTAP00000016647  ..............................................................................
ENSBTAP00000004536  ..............................................................................
ENSBTAP00000042177  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000050283  ..............................................................................
ENSBTAP00000048539  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000007972  ..............................................................................
ENSBTAP00000040815  ..............................................................................
ENSBTAP00000025661  ..............................................................................
ENSBTAP00000028350  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000021537  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000039155  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000016315  ..............................................................................
ENSBTAP00000021091  ..............................................................................
ENSBTAP00000021618  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000034078  ..............................................................................
ENSBTAP00000006645  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000015802  ..............................................................................
ENSBTAP00000032680  ..............................................................................
ENSBTAP00000055007  ..............................................................................
ENSBTAP00000020148  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000012557  ..............................................................................
ENSBTAP00000011888  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000021603  ..............................................................................
ENSBTAP00000010838  ..............................................................................
ENSBTAP00000014575  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000053698  ..............................................................................
ENSBTAP00000006806  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000044105  ..............................................................................
ENSBTAP00000026904  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000044226  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000042182  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000006275  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000004963  ..............................................................................
ENSBTAP00000023774  ..............................................................................
ENSBTAP00000020395  ..............................................................................
ENSBTAP00000020150  ..............................................................................
ENSBTAP00000025561  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000034009  ..............................................................................
ENSBTAP00000020539  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000017461  ..............................................................................
ENSBTAP00000044096  ..............................................................................
ENSBTAP00000008523  ..............................................................................
ENSBTAP00000035196  ..............................................................................
ENSBTAP00000041997  ..............................................................................
ENSBTAP00000025499  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000002174  ..............................................................................
ENSBTAP00000000589  ..............................................................................
ENSBTAP00000028239  ..............................................................................
ENSBTAP00000014894  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000041966  ..............................................................................
ENSBTAP00000008933  ..............................................................................
ENSBTAP00000056088  ..............................................................................
ENSBTAP00000033794  ..............................................................................
ENSBTAP00000012786  ..............................................................................
ENSBTAP00000030018  ..............................................................................
ENSBTAP00000040233  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000024301  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000015611  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000000847  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000054975  ..............................................................................
ENSBTAP00000046639  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000053164  ..............................................................................
ENSBTAP00000016774  ..............................................................................
ENSBTAP00000022630  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000033974  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000005979  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000053746  ..............................................................................
ENSBTAP00000023221  ..............................................................................
ENSBTAP00000019429  ..............................................................................
ENSBTAP00000052019  ..............................................................................
ENSBTAP00000042244  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000018877  ..............................................................................
ENSBTAP00000053019  ..............................................................................
ENSBTAP00000003073  ..............................................................................
ENSBTAP00000012886  ..............................................................................
ENSBTAP00000044222  ..............................................................................
ENSBTAP00000028499  ..............................................................................
ENSBTAP00000047378  ..............................................................................
ENSBTAP00000009308  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000050406  ..............................................................................
ENSBTAP00000031879  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000001250  ..............................................................................
ENSBTAP00000026035  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000053194  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000033188  ..............................................................................
ENSBTAP00000053548  ..............................................................................
ENSBTAP00000011687  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000009115  ..............................................................................
ENSBTAP00000023873  ..............................................................................
ENSBTAP00000054471  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000025205  ..............................................................................
ENSBTAP00000047882  ..............................................................................
ENSBTAP00000001368  ..............................................................................
ENSBTAP00000029786  ..............................................................................
ENSBTAP00000028993  ..............................................................................
ENSBTAP00000023678  ..............................................................................
ENSBTAP00000034710  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000021074  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000007217  ..............................................................................
ENSBTAP00000029792  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000017319  ..............................................................................
ENSBTAP00000044100  ..............................................................................
ENSBTAP00000033594  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000055894  ..............................................................................
ENSBTAP00000015220  ..............................................................................
ENSBTAP00000033613  ..............................................................................
ENSBTAP00000056320  ..............................................................................
ENSBTAP00000025249  ..............................................................................
ENSBTAP00000029159  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000017662  ..............................................................................
ENSBTAP00000012479  ..............................................................................
ENSBTAP00000029886  ..............................................................................
ENSBTAP00000027388  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000023673  ..............................................................................
ENSBTAP00000041488  ..............................................................................
ENSBTAP00000001452  ..............................................................................
ENSBTAP00000028498  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000020240  ..............................................................................
ENSBTAP00000053650  ..............................................................................
ENSBTAP00000041651  ..............................................................................
ENSBTAP00000005154  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000022068  ..............................................................................
ENSBTAP00000026682  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000027954  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000013601  ..............................................................................
ENSBTAP00000005477  ..............................................................................
ENSBTAP00000055305  ..............................................................................
ENSBTAP00000036054  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000002717  ..............................................................................
ENSBTAP00000036015  ..............................................................................
ENSBTAP00000051638  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000016306  ..............................................................................
ENSBTAP00000013714  ..............................................................................
ENSBTAP00000036550  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000023383  ..............................................................................
ENSBTAP00000027030  ..............................................................................
ENSBTAP00000053270  ..............................................................................
ENSBTAP00000054640  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000009967  ..............................................................................
ENSBTAP00000015183  ..............................................................................
ENSBTAP00000014222  ..............................................................................
ENSBTAP00000026288  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000009228  ..............................................................................
ENSBTAP00000026785  ..............................................................................
ENSBTAP00000002578  ..............................................................................
ENSBTAP00000000106  ..............................................................................
ENSBTAP00000028840  ..............................................................................
ENSBTAP00000053594  ..............................................................................
ENSBTAP00000055414  elltcnwnmkyakhedeeqahliydnsrftdlhsiirniqsykeikgrstfngvsvnllqfvqlletfvgedsplsvs
ENSBTAP00000026698  ..............................................................................
ENSBTAP00000017015  ..............................................................................
ENSBTAP00000049908  ..............................................................................
ENSBTAP00000021395  ..............................................................................
ENSBTAP00000007194  ..............................................................................
ENSBTAP00000025455  ..............................................................................


                                                         100                                        
                                                           |                                        
d1dgua_               ....................................KS........................................
ENSBTAP00000019411  ....................................EI........................................
ENSBTAP00000036057  ....................................EI........................................
ENSBTAP00000038404  ....................................KL........................................
ENSBTAP00000010971  ....................................KL........................................
ENSBTAP00000019803  ....................................KW........................................
ENSBTAP00000014038  ....................................KL........................................
ENSBTAP00000002055  ....................................EI........................................
ENSBTAP00000049731  ....................................EI........................................
ENSBTAP00000005577  ....................................KL........................................
ENSBTAP00000034949  ....................................KL........................................
ENSBTAP00000017447  ....................................DI........................................
ENSBTAP00000010858  ....................................CL........................................
ENSBTAP00000046644  ....................................EI........................................
ENSBTAP00000022814  ....................................KL........................................
ENSBTAP00000019758  ....................................--........................................
ENSBTAP00000019321  ....................................KL........................................
ENSBTAP00000011677  ....................................TW........................................
ENSBTAP00000011680  ....................................TW........................................
ENSBTAP00000021742  ....................................RL........................................
ENSBTAP00000005348  ....................................--........................................
ENSBTAP00000016609  ....................................DI........................................
ENSBTAP00000012740  ....................................CL........................................
ENSBTAP00000018403  ....................................GL........................................
ENSBTAP00000026407  ....................................--........................................
ENSBTAP00000052557  ....................................EI........................................
ENSBTAP00000054167  ....................................KL........................................
ENSBTAP00000010319  ....................................EI........................................
ENSBTAP00000041545  ....................................EV........................................
ENSBTAP00000055204  ....................................DW........................................
ENSBTAP00000003718  ....................................KL........................................
ENSBTAP00000011676  ....................................KY........................................
ENSBTAP00000049395  ....................................TF........................................
ENSBTAP00000054983  ....................................--........................................
ENSBTAP00000052219  ....................................GW........................................
ENSBTAP00000025402  ....................................EI........................................
ENSBTAP00000011678  ....................................NY........................................
ENSBTAP00000000433  ....................................AL........................................
ENSBTAP00000021491  ....................................EI........................................
ENSBTAP00000044733  ....................................KY........................................
ENSBTAP00000010937  ....................................--........................................
ENSBTAP00000056439  ....................................--........................................
ENSBTAP00000055780  ....................................EL........................................
ENSBTAP00000038002  ....................................KL........................................
ENSBTAP00000034705  ....................................EL........................................
ENSBTAP00000035936  ....................................KL........................................
ENSBTAP00000013699  ....................................QW........................................
ENSBTAP00000002564  ....................................TA........................................
ENSBTAP00000011496  ....................................KL........................................
ENSBTAP00000019111  ....................................EI........................................
ENSBTAP00000017036  ....................................KL........................................
ENSBTAP00000003213  ....................................--........................................
ENSBTAP00000055444  ....................................--........................................
ENSBTAP00000024550  ....................................SW........................................
ENSBTAP00000015248  ....................................VI........................................
ENSBTAP00000021328  ....................................VI........................................
ENSBTAP00000037091  ....................................VI........................................
ENSBTAP00000029967  ....................................EL........................................
ENSBTAP00000021449  ....................................EM........................................
ENSBTAP00000053176  ....................................FT........................................
ENSBTAP00000042361  ....................................EL........................................
ENSBTAP00000016509  ....................................KL........................................
ENSBTAP00000026714  ....................................EL........................................
ENSBTAP00000004690  ....................................KW........................................
ENSBTAP00000010858  ....................................--........................................
ENSBTAP00000013117  ....................................EI........................................
ENSBTAP00000017574  ....................................EI........................................
ENSBTAP00000004885  ....................................KM........................................
ENSBTAP00000008961  ....................................--........................................
ENSBTAP00000028063  ....................................--........................................
ENSBTAP00000012740  ....................................--........................................
ENSBTAP00000006283  ....................................EL........................................
ENSBTAP00000014306  ....................................DY........................................
ENSBTAP00000053252  ....................................EV........................................
ENSBTAP00000014304  ....................................DY........................................
ENSBTAP00000045669  ....................................LL........................................
ENSBTAP00000041264  ....................................--........................................
ENSBTAP00000006711  ....................................LS........................................
ENSBTAP00000017358  ....................................--........................................
ENSBTAP00000053274  ....................................LL........................................
ENSBTAP00000055296  ....................................--........................................
ENSBTAP00000016852  ....................................VI........................................
ENSBTAP00000036380  ....................................EI........................................
ENSBTAP00000041719  ....................................DY........................................
ENSBTAP00000049636  ....................................DF........................................
ENSBTAP00000024444  ....................................TI........................................
ENSBTAP00000004556  ....................................--........................................
ENSBTAP00000038767  ....................................KL........................................
ENSBTAP00000031285  ....................................SI........................................
ENSBTAP00000011457  ....................................KM........................................
ENSBTAP00000011047  ....................................DF........................................
ENSBTAP00000002564  ....................................--........................................
ENSBTAP00000037104  ....................................TI........................................
ENSBTAP00000002672  ....................................AI........................................
ENSBTAP00000028269  ....................................VI........................................
ENSBTAP00000016647  ....................................KL........................................
ENSBTAP00000004536  ....................................RL........................................
ENSBTAP00000042177  ....................................VV........................................
ENSBTAP00000028063  ....................................--........................................
ENSBTAP00000050283  ....................................DF........................................
ENSBTAP00000048539  ....................................IL........................................
ENSBTAP00000045669  ....................................KL........................................
ENSBTAP00000007972  ....................................VV........................................
ENSBTAP00000040815  ....................................VV........................................
ENSBTAP00000025661  ....................................II........................................
ENSBTAP00000028350  ....................................KS........................................
ENSBTAP00000053274  ....................................KL........................................
ENSBTAP00000021537  ....................................KA........................................
ENSBTAP00000055481  ....................................KY........................................
ENSBTAP00000039155  ....................................HI........................................
ENSBTAP00000029333  ....................................KY........................................
ENSBTAP00000016315  ....................................--........................................
ENSBTAP00000021091  ....................................FY........................................
ENSBTAP00000021618  ....................................KS........................................
ENSBTAP00000055520  ....................................TL........................................
ENSBTAP00000055624  ....................................TL........................................
ENSBTAP00000016319  ....................................--........................................
ENSBTAP00000034078  ....................................IL........................................
ENSBTAP00000006645  ....................................KI........................................
ENSBTAP00000021909  ....................................EWvkte....................................
ENSBTAP00000001426  ....................................EF........................................
ENSBTAP00000015802  ....................................KL........................................
ENSBTAP00000032680  ....................................KL........................................
ENSBTAP00000055007  ....................................EL........................................
ENSBTAP00000020148  ....................................FI........................................
ENSBTAP00000052345  ....................................--........................................
ENSBTAP00000029334  ....................................KY........................................
ENSBTAP00000052345  ....................................--........................................
ENSBTAP00000056127  ....................................DWvlse....................................
ENSBTAP00000012557  ....................................DL........................................
ENSBTAP00000011888  ....................................KL........................................
ENSBTAP00000017060  ....................................--........................................
ENSBTAP00000031854  ....................................SI........................................
ENSBTAP00000031823  ....................................AWvqte....................................
ENSBTAP00000021603  ....................................KS........................................
ENSBTAP00000010838  ....................................--........................................
ENSBTAP00000014575  ....................................KA........................................
ENSBTAP00000011215  ....................................SI........................................
ENSBTAP00000053698  ....................................TI........................................
ENSBTAP00000006806  ....................................TL........................................
ENSBTAP00000029334  ....................................--........................................
ENSBTAP00000044105  ....................................--........................................
ENSBTAP00000026904  ....................................--........................................
ENSBTAP00000017060  ....................................--........................................
ENSBTAP00000055520  ....................................--........................................
ENSBTAP00000044226  ....................................TL........................................
ENSBTAP00000055624  ....................................--........................................
ENSBTAP00000042182  ....................................EW........................................
ENSBTAP00000010796  ....................................RMkiqnankmkeagaetcsfysallriqpkivhcwrpm....
ENSBTAP00000021174  ....................................EF........................................
ENSBTAP00000006275  ....................................AL........................................
ENSBTAP00000020950  ....................................EWilvek...................................
ENSBTAP00000053738  ....................................RMkiqnankmkeagaetcsfysallriqpkivhcwrpm....
ENSBTAP00000004963  ....................................KL........................................
ENSBTAP00000023774  ....................................DF........................................
ENSBTAP00000020395  ....................................EI........................................
ENSBTAP00000020150  ....................................TM........................................
ENSBTAP00000025561  ....................................VM........................................
ENSBTAP00000053738  ....................................DL........................................
ENSBTAP00000034009  ....................................GI........................................
ENSBTAP00000020539  ....................................NL........................................
ENSBTAP00000020778  ....................................RK........................................
ENSBTAP00000017461  ....................................EV........................................
ENSBTAP00000044096  ....................................TI........................................
ENSBTAP00000008523  ....................................TI........................................
ENSBTAP00000035196  ....................................TWtvlrrfgydddldltpeylfpllkippdcttelnhhaylf
ENSBTAP00000041997  ....................................--........................................
ENSBTAP00000025499  ....................................DV........................................
ENSBTAP00000055481  ....................................--........................................
ENSBTAP00000002174  ....................................--........................................
ENSBTAP00000000589  ....................................--........................................
ENSBTAP00000028239  ....................................--........................................
ENSBTAP00000014894  ....................................QV........................................
ENSBTAP00000026544  ....................................DF........................................
ENSBTAP00000029333  ....................................--........................................
ENSBTAP00000041966  ....................................HC........................................
ENSBTAP00000008933  ....................................--........................................
ENSBTAP00000056088  ....................................GI........................................
ENSBTAP00000033794  ....................................--........................................
ENSBTAP00000012786  ....................................QV........................................
ENSBTAP00000030018  ....................................QV........................................
ENSBTAP00000040233  ....................................TV........................................
ENSBTAP00000003365  ....................................EL........................................
ENSBTAP00000053176  ....................................KL........................................
ENSBTAP00000024301  ....................................QV........................................
ENSBTAP00000022292  ....................................MF........................................
ENSBTAP00000015611  ....................................--........................................
ENSBTAP00000012770  ....................................AL........................................
ENSBTAP00000000847  ....................................--........................................
ENSBTAP00000053738  ....................................TV........................................
ENSBTAP00000054975  ....................................QV........................................
ENSBTAP00000046639  ....................................FV........................................
ENSBTAP00000052345  ....................................--........................................
ENSBTAP00000053164  ....................................TL........................................
ENSBTAP00000016774  ....................................--........................................
ENSBTAP00000022630  ....................................EL........................................
ENSBTAP00000010796  ....................................AI........................................
ENSBTAP00000021909  ....................................DDgfnykqmmvrd.............................
ENSBTAP00000033974  ....................................EL........................................
ENSBTAP00000006711  ....................................KL........................................
ENSBTAP00000010796  ....................................DI........................................
ENSBTAP00000004912  ....................................LF........................................
ENSBTAP00000005979  ....................................TWtilrrfgygdsleltadylcpplrvppgcsaelnhrgyqf
ENSBTAP00000053738  ....................................AI........................................
ENSBTAP00000053746  ....................................KL........................................
ENSBTAP00000023221  ....................................DP........................................
ENSBTAP00000019429  ....................................--........................................
ENSBTAP00000052019  ....................................--........................................
ENSBTAP00000042244  ....................................--........................................
ENSBTAP00000053738  ....................................AF........................................
ENSBTAP00000018877  ....................................--........................................
ENSBTAP00000053019  ....................................TF........................................
ENSBTAP00000003073  ....................................NP........................................
ENSBTAP00000012886  ....................................--........................................
ENSBTAP00000044222  ....................................TL........................................
ENSBTAP00000028499  ....................................--........................................
ENSBTAP00000047378  ....................................RV........................................
ENSBTAP00000009308  ....................................--........................................
ENSBTAP00000017060  ....................................--........................................
ENSBTAP00000050406  ....................................TF........................................
ENSBTAP00000031879  ....................................TF........................................
ENSBTAP00000031854  ....................................AS........................................
ENSBTAP00000001250  ....................................TI........................................
ENSBTAP00000026035  ....................................--........................................
ENSBTAP00000011215  ....................................AS........................................
ENSBTAP00000002128  ....................................VL........................................
ENSBTAP00000053194  ....................................EL........................................
ENSBTAP00000056127  ....................................FQdtsdhhtfkkmlprd.........................
ENSBTAP00000033188  ....................................--........................................
ENSBTAP00000053548  ....................................--........................................
ENSBTAP00000011687  ....................................EQfifrhs..................................
ENSBTAP00000007636  ....................................NF........................................
ENSBTAP00000020950  ....................................--........................................
ENSBTAP00000009115  ....................................--........................................
ENSBTAP00000023873  ....................................--........................................
ENSBTAP00000054471  ....................................-A........................................
ENSBTAP00000039694  ....................................DF........................................
ENSBTAP00000025205  ....................................-A........................................
ENSBTAP00000047882  ....................................LQ........................................
ENSBTAP00000001368  ....................................-Y........................................
ENSBTAP00000029786  ....................................KL........................................
ENSBTAP00000028993  ....................................RL........................................
ENSBTAP00000023678  ....................................NI........................................
ENSBTAP00000034710  ....................................--........................................
ENSBTAP00000031823  ....................................DVedaetykkmlard...........................
ENSBTAP00000038002  ....................................KL........................................
ENSBTAP00000021074  ....................................--........................................
ENSBTAP00000026544  ....................................EF........................................
ENSBTAP00000007217  ....................................SP........................................
ENSBTAP00000029792  ....................................KL........................................
ENSBTAP00000044088  ....................................DF........................................
ENSBTAP00000017319  ....................................--........................................
ENSBTAP00000044100  ....................................-F........................................
ENSBTAP00000033594  ....................................RS........................................
ENSBTAP00000026766  ....................................RQ........................................
ENSBTAP00000055894  ....................................--........................................
ENSBTAP00000015220  ....................................--........................................
ENSBTAP00000033613  ....................................--........................................
ENSBTAP00000056320  ....................................SI........................................
ENSBTAP00000025249  ....................................--........................................
ENSBTAP00000029159  ....................................--........................................
ENSBTAP00000044088  ....................................DF........................................
ENSBTAP00000016319  ....................................--........................................
ENSBTAP00000017662  ....................................--........................................
ENSBTAP00000012479  ....................................KL........................................
ENSBTAP00000029886  ....................................TA........................................
ENSBTAP00000027388  ....................................--........................................
ENSBTAP00000039694  ....................................GF........................................
ENSBTAP00000023673  ....................................QA........................................
ENSBTAP00000041488  ....................................QA........................................
ENSBTAP00000001452  ....................................--........................................
ENSBTAP00000028498  ....................................TL........................................
ENSBTAP00000001426  ....................................EF........................................
ENSBTAP00000020240  ....................................TS........................................
ENSBTAP00000053650  ....................................TS........................................
ENSBTAP00000041651  ....................................VL........................................
ENSBTAP00000005154  ....................................--........................................
ENSBTAP00000021174  ....................................EF........................................
ENSBTAP00000022068  ....................................--........................................
ENSBTAP00000026682  ....................................EI........................................
ENSBTAP00000007636  ....................................TA........................................
ENSBTAP00000027954  ....................................--........................................
ENSBTAP00000020778  ....................................--........................................
ENSBTAP00000013601  ....................................--........................................
ENSBTAP00000005477  ....................................GI........................................
ENSBTAP00000055305  ....................................TS........................................
ENSBTAP00000036054  ....................................TS........................................
ENSBTAP00000004912  ....................................LI........................................
ENSBTAP00000022292  ....................................HA........................................
ENSBTAP00000002717  ....................................EFkkdss...................................
ENSBTAP00000036015  ....................................--........................................
ENSBTAP00000051638  ....................................KL........................................
ENSBTAP00000026766  ....................................KA........................................
ENSBTAP00000053738  ....................................DI........................................
ENSBTAP00000016306  ....................................RQ........................................
ENSBTAP00000013714  ....................................QA........................................
ENSBTAP00000036550  ....................................KI........................................
ENSBTAP00000053738  ....................................AF........................................
ENSBTAP00000023383  ....................................--........................................
ENSBTAP00000027030  ....................................STpyrqlkrhismqsfdesgrrttapsamms...........
ENSBTAP00000053270  ....................................STpyrqlkrhismqsfdesgrrttapsamms...........
ENSBTAP00000054640  ....................................STpyrqlkrhismqsfdesgrrttapsamms...........
ENSBTAP00000012770  ....................................QT........................................
ENSBTAP00000009967  ....................................EL........................................
ENSBTAP00000015183  ....................................--........................................
ENSBTAP00000014222  ....................................KL........................................
ENSBTAP00000026288  ....................................--........................................
ENSBTAP00000002128  ....................................AF........................................
ENSBTAP00000003365  ....................................AW........................................
ENSBTAP00000053738  ....................................--........................................
ENSBTAP00000009228  ....................................--........................................
ENSBTAP00000026785  ....................................--........................................
ENSBTAP00000002578  ....................................KI........................................
ENSBTAP00000000106  ....................................--........................................
ENSBTAP00000028840  ....................................--........................................
ENSBTAP00000053594  ....................................RF........................................
ENSBTAP00000055414  ealtsffrkgfvetkeekmsglekarqnasrirrelLL........................................
ENSBTAP00000026698  ....................................LT........................................
ENSBTAP00000017015  ....................................--........................................
ENSBTAP00000049908  ....................................-L........................................
ENSBTAP00000021395  ....................................--........................................
ENSBTAP00000007194  ....................................DC........................................
ENSBTAP00000025455  ....................................LL........................................


                                            110                                           120       
                                              |                                             |       
d1dgua_               .HYA...FRIF...........DFDDD...................................G.TLNREDLSRLVNCL
ENSBTAP00000019411  .REA...FRVF...........DKDGN...................................G.YISAAELRHVMTNL
ENSBTAP00000036057  .REA...FRVF...........DKDGN...................................G.YISAAELRHVMTNL
ENSBTAP00000038404  .KWA...FSMY...........DLDGN...................................G.YISKAEMLEIVQAI
ENSBTAP00000010971  .MWA...FSMY...........DLDGN...................................G.YISREEMLEIVQAI
ENSBTAP00000019803  .QAV...YKQF...........DVDRS...................................G.TIGSSELPGAFEAA
ENSBTAP00000014038  .RFA...FRIY...........DMDKD...................................G.YISNGELFQVLKMM
ENSBTAP00000002055  .REA...FRVF...........DKDGN...................................G.YISAAELRHVMTNL
ENSBTAP00000049731  .REA...FRVF...........DKDGN...................................G.YISAAELRHVMTNL
ENSBTAP00000005577  .KWA...FSMY...........DLDGN...................................G.YISRSEMLEIVQAI
ENSBTAP00000034949  .EWA...FSLY...........DVDGN...................................G.TISKNEVLEIVTAI
ENSBTAP00000017447  .EDL...FKKI...........NGDKT...................................D.YLTVDQLVSFLNEH
ENSBTAP00000010858  .NWL...LNVY...........DTGRT...................................G.RIRVLSFKTGI---
ENSBTAP00000046644  .DNI...FSEF...........GAKSK...................................P.YLTVDQMMDFINLK
ENSBTAP00000022814  .NWA...FNMY...........DLDGD...................................G.KITRVEMLEIIEAI
ENSBTAP00000019758  .---...----...........-----...................................-.--------------
ENSBTAP00000019321  .NWA...FEMY...........DLDGD...................................G.RITRLEMLEIIEAI
ENSBTAP00000011677  .QKI...FKHY...........DTDQS...................................G.TINSYEMRNAVKDA
ENSBTAP00000011680  .QKI...FKHY...........DTDQS...................................G.TINSYEMRNAVKDA
ENSBTAP00000021742  .NWA...FNLY...........DLNKD...................................G.CITKEEMLDIMKSI
ENSBTAP00000005348  .---...----...........-----...................................-.--------------
ENSBTAP00000016609  .DKI...LLEI...........GAKGK...................................P.YLTLEQLMDFINQK
ENSBTAP00000012740  .NWL...LNVY...........DTGRT...................................G.KIRVQSLKIGLIAL
ENSBTAP00000018403  .REI...FRAF...........DQDDD...................................G.YISVDELRQATSQL
ENSBTAP00000026407  .---...----...........-----...................................-.--------------
ENSBTAP00000052557  .LKA...FRLF...........DDDET...................................G.KISFKNLKRVAKEL
ENSBTAP00000054167  .NWA...FNLY...........DINKD...................................G.YITKEEMLDIMKAI
ENSBTAP00000010319  .LKA...FKLF...........DDDET...................................G.KISFKNLKRVAKEL
ENSBTAP00000041545  .QEL...FEKF...........SSDGQ...................................-.KLTLLEFVDFLQEE
ENSBTAP00000055204  .QNV...FRTY...........DRDNS...................................G.MIDKNELKQALSGF
ENSBTAP00000003718  .RWT...FNLY...........DINKD...................................G.YINKEEMMDIVKAI
ENSBTAP00000011676  .LDI...FRET...........DHNHS...................................G.TIDAHEMRTALKKA
ENSBTAP00000049395  .EEA...----...........-TGSK...................................E.TLSVDQLVTFLQHQ
ENSBTAP00000054983  .---...----...........-----...................................-.--------------
ENSBTAP00000052219  .RQH...FISF...........DSDRS...................................G.TVDPQELQKALTTM
ENSBTAP00000025402  .DEI...FTSY...........HSKAK...................................P.YMTKEHLAKFINQK
ENSBTAP00000011678  .LSI...FRKF...........DLDKS...................................G.SMSAYEMRMAIEFA
ENSBTAP00000000433  .ENI...YKLM...........-----...................................-.--------------
ENSBTAP00000021491  .LKA...FKLF...........DDDDT...................................G.SISLNNIKRVAKEL
ENSBTAP00000044733  .QKI...YREI...........DVDRS...................................G.TMNSYEMRKALEEA
ENSBTAP00000010937  .--L...LLLS...........YSDKK...................................D.HLTVEELAQFLKVE
ENSBTAP00000056439  .--L...LLLS...........YSDKK...................................D.HLTVEELAQFLKVE
ENSBTAP00000055780  .SDL...FRMF...........DKNAD...................................G.YIDLEELKIMLQAT
ENSBTAP00000038002  .---...----...........-----...................................-.--------------
ENSBTAP00000034705  .EEI...FHRY...........SGE-D...................................R.VLSASELLEFLEDQ
ENSBTAP00000035936  .KWT...FKIY...........DKDRN...................................G.CIDRQELLDIVESI
ENSBTAP00000013699  .KNL...FQQY...........DRDCS...................................G.SISYTELQQALSQM
ENSBTAP00000002564  .LEI...FNEH...........DLQAS...................................EhVMDVVEVIHCLTAL
ENSBTAP00000011496  .RWA...FKLY...........DLDND...................................G.YITRNEMLDIVDAI
ENSBTAP00000019111  .LKA...FKLF...........DDDDS...................................G.KISLRNLRRVAREL
ENSBTAP00000017036  .RWY...FKLY...........DVDGN...................................G.CIDRDELLTIIRAI
ENSBTAP00000003213  .--L...LMLT...........YSNHK...................................D.HLDATDLLRFLEVE
ENSBTAP00000055444  .--L...LMLT...........YSNHK...................................D.HLDATDLLRFLEVE
ENSBTAP00000024550  .KQN...FITV...........DKDGS...................................G.SVEHHELNQAIAAM
ENSBTAP00000015248  .RNA...FACF...........DEEAS...................................G.FIHEDHLRELLTTM
ENSBTAP00000021328  .RNA...FACF...........DEEAT...................................G.TIQEDYLRELLTTM
ENSBTAP00000037091  .RNA...FACF...........DEEAT...................................G.TIQEDYLRELLTTM
ENSBTAP00000029967  .RDA...FREF...........DTNGD...................................G.CISLGELRAALKAL
ENSBTAP00000021449  .RDA...FKEF...........DANGD...................................G.EITLGELQQAMQRL
ENSBTAP00000053176  .THL...FMSF...........-----...................................-.--------------
ENSBTAP00000042361  .RDA...FREF...........DTNGD...................................G.EISTSELREAMRKL
ENSBTAP00000016509  .KWT...FKIY...........DKDRN...................................G.CIDRQELLDIVEVK
ENSBTAP00000026714  .RDA...FREF...........DTNGD...................................G.EISTSELREAMRKL
ENSBTAP00000004690  .TDI...FREC...........DQDQS...................................G.TLNSYEMRLAVEKA
ENSBTAP00000010858  .---...----...........-----...................................-.--------------
ENSBTAP00000013117  .YFL...LVQF...........SSNKE...................................-.FLDTKDLMMFLEAE
ENSBTAP00000017574  .IEI...FNTY...........SENRK...................................I.LLEKNLVEFLMREQ
ENSBTAP00000004885  .KLA...FKSL...........DKNND...................................G.KIEASEIVQSLQIL
ENSBTAP00000008961  .---...----...........-----...................................-.--------------
ENSBTAP00000028063  .NFM...IAAY...........DSEGR...................................G.KLTVFSVKAMLATM
ENSBTAP00000012740  .---...----...........-----...................................-.--------------
ENSBTAP00000006283  .RIA...FREF...........DRDRD...................................G.RITVAELREAAPAL
ENSBTAP00000014306  .VEG...LRVF...........DKEGN...................................G.TVMGAEIRHVLVTL
ENSBTAP00000053252  .YFL...LVQI...........SKNKE...................................-.YLDANDLMLFLEAE
ENSBTAP00000014304  .VEG...LRVF...........DKEGN...................................G.TVMGAEIRHVLVTL
ENSBTAP00000045669  .NFL...LAAF...........DPEGH...................................G.KISVFAVKMALATL
ENSBTAP00000041264  .---...----...........-----...................................-.--------------
ENSBTAP00000006711  .THL...FLA-...........-----...................................-.--------------
ENSBTAP00000017358  .---...----...........-----...................................-.--------------
ENSBTAP00000053274  .NFL...LAAF...........DPEGH...................................G.KISVFAVKMALATL
ENSBTAP00000055296  .---...----...........-----...................................-.--------------
ENSBTAP00000016852  .MQA...FRKL...........DKTGD...................................G.VITIEDLREVYNAK
ENSBTAP00000036380  .LLA...MLMA...........DKEKK...................................G.YIMASELRSKLMQL
ENSBTAP00000041719  .LEG...LRVF...........DKEQN...................................G.KVMGAELRHVLTTL
ENSBTAP00000049636  .VEG...LRVF...........DKEGN...................................G.TVMGAELRHVLATL
ENSBTAP00000024444  .LNA...FKVF...........DPEGK...................................G.VLKADYIKEMLTTQ
ENSBTAP00000004556  .---...----...........-----...................................-.--------------
ENSBTAP00000038767  .HFA...FRLY...........DLDKD...................................D.KISRDELLQVLRMM
ENSBTAP00000031285  .GWM...FSKL...........DTSAD...................................L.FLDQTELAAINLDK
ENSBTAP00000011457  .KYC...FEVF...........DLNGD...................................S.FISKEEMFHMLKNS
ENSBTAP00000011047  .VEG...LRVF...........DKEGN...................................G.TVMGAELRHVLATL
ENSBTAP00000002564  .---...----...........-----...................................-.--------------
ENSBTAP00000037104  .LHA...FKVF...........DTEGK...................................G.FVKADFIKEKLMTQ
ENSBTAP00000002672  .LSA...FRLF...........DPSGK...................................G.VVNKDEFRQLLLTQ
ENSBTAP00000028269  .TGA...FKVL...........DPEGK...................................G.TIKKKFLEELLTTQ
ENSBTAP00000016647  .RFA...FQLY...........DLDRD...................................G.KISRHEMLQALRLM
ENSBTAP00000004536  .LLL...FHSL...........DRNQD...................................G.QIDVSEIQQSFRAL
ENSBTAP00000042177  .HWY...FKLL...........DKNNS...................................G.DIGKKEIKPFKRFL
ENSBTAP00000028063  .---...----...........-----...................................-.----SKFDQFL---
ENSBTAP00000050283  .VEG...LRVF...........DKESN...................................G.TVMGAELRHVLATL
ENSBTAP00000048539  .QMS...FKLF...........DLDKD...................................G.FITEQELAAILRAA
ENSBTAP00000045669  .RYI...FSMI...........-SDSS...................................G.VMVYGRYDQFLREV
ENSBTAP00000007972  .TAA...FAKL...........DRSGD...................................G.VVTVDDLRGVYSGR
ENSBTAP00000040815  .HWY...FSQL...........DSNSS...................................S.DINKREMKPFKRYV
ENSBTAP00000025661  .QVA...FKLF...........DVDED...................................G.FITEEEFSTILQAS
ENSBTAP00000028350  .HYA...FRIF...........DFDDD...................................G.TLNREDLSQLVNCL
ENSBTAP00000053274  .RYI...FSMI...........-SDSS...................................G.VMVYGRYDQFLREV
ENSBTAP00000021537  .YYA...FKIY...........DFNND...................................D.YICAWDLEQTVTKL
ENSBTAP00000055481  .RQL...FNSH...........DKTMS...................................G.HLTGPQARTILMQS
ENSBTAP00000039155  .WEA...FHVF...........DKDSK...................................I.LVSTAKRRHAMTWL
ENSBTAP00000029333  .RQL...FNSH...........DKTMS...................................G.HLTGPQARTILMQS
ENSBTAP00000016315  .---...----...........-----...................................-.--------------
ENSBTAP00000021091  .QEV...FHKQ...........DTNRS...................................G.SLNWAQLRAAMREA
ENSBTAP00000021618  .RLM...FRMY...........DFDGN...................................G.LISKDEFIRMLRSF
ENSBTAP00000055520  .SLL...TTMY...........DSTGT...................................G.FIKL----------
ENSBTAP00000055624  .SLL...TTMY...........DSTGT...................................G.FIKL----------
ENSBTAP00000016319  .---...----...........-----...................................-.--------------
ENSBTAP00000034078  .LRA...FEVL...........DPAKR...................................G.FLSKDELIKYMTEE
ENSBTAP00000006645  .EYA...FRIY...........DFNEN...................................G.FIDEEDLQRIILRL
ENSBTAP00000021909  .REQ...FVEFr..........DKNRD...................................G.KMDKEETKDWILPS
ENSBTAP00000001426  .MEA...WRKY...........DTDRS...................................G.YIEANELKGFLSDL
ENSBTAP00000015802  .RLV...FKSL...........DKKND...................................G.RIDAQEIMQSLRDL
ENSBTAP00000032680  .RLV...FKSL...........DKKND...................................G.RIDAQEIMQSLRDL
ENSBTAP00000055007  .AEC...FRIF...........DR---...................................-.--------------
ENSBTAP00000020148  .K--...----...........-----...................................-.--------------
ENSBTAP00000052345  .---...----...........-----...................................-.--------------
ENSBTAP00000029334  .RQK...FNSL...........DKSMS...................................G.YLSGFQARNALLQS
ENSBTAP00000052345  .---...----...........-----...................................-.--------------
ENSBTAP00000056127  .REQ...FNEFr..........DLNKD...................................G.KLDKDEISHWILPQ
ENSBTAP00000012557  .QII...FNII...........DSDHS...................................G.LISMEEFRSMWRLF
ENSBTAP00000011888  .KFL...FQVY...........DVDGKhplwdgrrtqregqrerpvsvtaqhwassspetgsG.SIDADELRTVLQSC
ENSBTAP00000017060  .---...----...........-----...................................-.--------------
ENSBTAP00000031854  .EYW...FRCM...........DVDGD...................................G.VLSMYELEYFYEEQ
ENSBTAP00000031823  .REQ...FRDFr..........DLNKD...................................G.KLNGSEVGHWVLPP
ENSBTAP00000021603  .RLM...FTMY...........DLDGN...................................G.FLSKDEFFTMMRVP
ENSBTAP00000010838  .---...----...........-----...................................-.--------------
ENSBTAP00000014575  .SYA...FKIY...........DFNTD...................................N.FICKEDLQLTLARL
ENSBTAP00000011215  .EYW...FRCM...........DVDGD...................................G.VLSMYELEYFYEEQ
ENSBTAP00000053698  .DSI...FWQF...........DMQ--...................................-.RITLEELKHILYHA
ENSBTAP00000006806  .INV...FHAHs..........GKEGD...................................KyKLSKKELKELLQTE
ENSBTAP00000029334  .---...----...........-----...................................-.--------------
ENSBTAP00000044105  .---...----...........-----...................................-.--------------
ENSBTAP00000026904  .---...----...........-----...................................-.KLNKGELKMLLQRE
ENSBTAP00000017060  .---...----...........-----...................................-.--------------
ENSBTAP00000055520  .---...----...........-----...................................-.--------------
ENSBTAP00000044226  .INV...FHAHs..........GKEGD...................................KyKLSKKELKELLQTE
ENSBTAP00000055624  .---...----...........-----...................................-.--------------
ENSBTAP00000042182  .QAT...FDKF...........DEDAS...................................G.TMNSYELRLALNAA
ENSBTAP00000010796  .RRT...FKAY...........DEGGT...................................G.LLSVADFRKVLRQY
ENSBTAP00000021174  .MKT...WRKY...........DTDHS...................................G.FIETEELKNFLKDL
ENSBTAP00000006275  .IDV...FHQYs..........GREGD...................................KhKLKKSELKELINNE
ENSBTAP00000020950  .DRF...MNDY...........DRDAD...................................G.RLDPQELLSWVVPN
ENSBTAP00000053738  .RRT...FKAY...........DEGGT...................................G.LLSVADFRKVLRQY
ENSBTAP00000004963  .KFC...FEVY...........YFNGD...................................G.YISRERIYDMLKNS
ENSBTAP00000023774  .DTV...FWKC...........DMQ--...................................-.KLTVDELKRLLYDT
ENSBTAP00000020395  .ESA...FRAL...........SSEGK...................................P.YVTKEELYQNLTRE
ENSBTAP00000020150  .MFT...FHKF...........AGDK-...................................G.YLTKEDLRVLMEKE
ENSBTAP00000025561  .VST...FHKYs..........GKEGD...................................KfKLNKSELKELLTRE
ENSBTAP00000053738  .SKN...FIET...........DSEGN...................................G.ILRRRDMKNALYGF
ENSBTAP00000034009  .INI...FHQYsv.........RVGHF...................................D.TLNKRELKQLITKE
ENSBTAP00000020539  .ETI...FRII...........DSDHS...................................G.SISLDEFRHTWKLF
ENSBTAP00000020778  .REF...EELI...........DANHD...................................G.IVTMAELEDYMDPM
ENSBTAP00000017461  .RHI...FTAF...........DRHYR...................................G.YLTLEDFKKAFKQV
ENSBTAP00000044096  .INI...FHQYsv.........RLGHY...................................D.TLIQKEFKQLVQKE
ENSBTAP00000008523  .INI...FHQYsv.........RLGHY...................................D.TLIQKEFKQLVQKE
ENSBTAP00000035196  lQST...FDKH...........DLDRD...................................C.ALSPDELKDLFKVF
ENSBTAP00000041997  .---...----...........-----...................................-.--------------
ENSBTAP00000025499  .KKV...FHIL...........DKDKS...................................G.FIEEEELGFILKGF
ENSBTAP00000055481  .---...----...........-----...................................-.--------------
ENSBTAP00000002174  .---...----...........-----...................................-.--------------
ENSBTAP00000000589  .-AT...FHKYs..........GQEGD...................................KfKLSKGEMKELLHKE
ENSBTAP00000028239  .---...----...........-----...................................-.--------------
ENSBTAP00000014894  .IAS...FKVL...........AGDKN...................................-.FITAEELRR-----
ENSBTAP00000026544  .EKI...FAHY...........DVSKT...................................G.ALEGPEVDGFVKDM
ENSBTAP00000029333  .---...----...........-----...................................-.--------------
ENSBTAP00000041966  .QSV...FQNS...........PKNAG...................................V.FLSSD-LWKAIRDT
ENSBTAP00000008933  .---...----...........-----...................................-.--------------
ENSBTAP00000056088  .INI...FHQYsv.........RVGHF...................................D.TLNKRELKQLITKE
ENSBTAP00000033794  .---...----...........-----...................................-.--------------
ENSBTAP00000012786  .IAS...FRIL...........ASDKP...................................-.YILAEELRR-----
ENSBTAP00000030018  .VAS...FKIL...........AGDKN...................................-.YITAEELRRELPAE
ENSBTAP00000040233  .IKA...LMLI...........DVNTT...................................G.LVQPHELRRVLETF
ENSBTAP00000003365  .LKS...FKQL...........DVNDN...................................G.SILHTDLYKLLTKK
ENSBTAP00000053176  .EFM...FRLY...........DTDGN...................................G.FLDSSELENIISQM
ENSBTAP00000024301  .MAS...FKIL...........AGDKN...................................-.YITVDELRR-----
ENSBTAP00000022292  .IVA...FQLF...........DKSGN...................................G.EVTFENVKEIFGQT
ENSBTAP00000015611  .---...----...........---EC...................................G.TLSKDELKELLEKE
ENSBTAP00000012770  .QYI...FKLL...........DIENK...................................G.YLNVFSLNYFFRAI
ENSBTAP00000000847  .VTT...FHKYs..........GREGS...................................KlTLSRKELKELIKKE
ENSBTAP00000053738  .IKA...LMLI...........DVNTT...................................G.LVQPHELRRVLETF
ENSBTAP00000054975  .KDV...FRFI...........DNDQS...................................G.YLDEEELKFFLQKF
ENSBTAP00000046639  .RKA...FMKL...........DFNKT...................................G.SVSIIDIRKCYCAK
ENSBTAP00000052345  .---...----...........-----...................................-.--------------
ENSBTAP00000053164  .LAA...FRHY...........DKKGD...................................G.VIDRAELQEACDQA
ENSBTAP00000016774  .---...----...........-----...................................-.AVYRDDLKQLLETE
ENSBTAP00000022630  .KGI...FEKYa..........AKEGD...................................PnQLSKEELKLLLQTE
ENSBTAP00000010796  .AQE...FENF...........DTMKT...................................N.TASRDEFRSICTRH
ENSBTAP00000021909  .ERR...FKMA...........DKDGD...................................L.IATKEEFTAFL---
ENSBTAP00000033974  .RAA...LCIF...........DKEAR...................................G.YIDWDTLKYVLMNV
ENSBTAP00000006711  .EFM...FRLY...........DSDEN...................................G.LLDQAEMDRIVSQM
ENSBTAP00000010796  .SKA...LAKL...........DKSRT...................................G.YISLGRLQRLLQEC
ENSBTAP00000004912  .MVA...FQLF...........DKAGK...................................G.EVTFEDVKQVFGQT
ENSBTAP00000005979  vQRM...FEKH...........DQDRD...................................G.ALSPAELQSLFSVF
ENSBTAP00000053738  .AQE...FENF...........DTMKT...................................N.TASRDEFRSICTRH
ENSBTAP00000053746  .RFL...FHMY...........DSDSD...................................G.RITLEEYRNVVEEL
ENSBTAP00000023221  .KTF...FKLH...........DVNSD...................................G.FLDEQELEALFTKE
ENSBTAP00000019429  .---...----...........-----...................................-.--------------
ENSBTAP00000052019  .---...----...........-----...................................-.--------------
ENSBTAP00000042244  .---...----...........-----...................................-.--------------
ENSBTAP00000053738  .CNM...LRSY...........DLGDT...................................G.LIGRNNFKKIMRVF
ENSBTAP00000018877  .---...----...........-----...................................N.KISKSSFRKMLQKE
ENSBTAP00000053019  .R--...----...........-----...................................-.--------------
ENSBTAP00000003073  .KTF...FILH...........DINSD...................................G.VLDEQELEALFTKE
ENSBTAP00000012886  .---...----...........-----...................................-.--------------
ENSBTAP00000044222  .VRT...FQEY...........SQFSG...................................N.PLCQAKFKELLEKE
ENSBTAP00000028499  .---...----...........--GRK...................................G.SLSVNEFKELVTQQ
ENSBTAP00000047378  .WGL...WEEL...........GVGSS...................................G.HLTEQELALVCQSI
ENSBTAP00000009308  .---...----...........-----...................................-.--------------
ENSBTAP00000017060  .---...----...........-----...................................-.--------------
ENSBTAP00000050406  .RKA...----...........-----...................................-.--------------
ENSBTAP00000031879  .RKA...----...........-----...................................-.--------------
ENSBTAP00000031854  .KFI...CLLA...........KPSCS...................................-.SLEQDDFIPLLQDV
ENSBTAP00000001250  .QLA...FKMF...........G-SQD...................................G.SVEEHALSSILKTA
ENSBTAP00000026035  .---...----...........-----...................................-.--------------
ENSBTAP00000011215  .KFI...CLLA...........KPSCS...................................-.SLEQDDFIPLLQDV
ENSBTAP00000002128  .TDV...VKAI...........DKIKD...................................E.NIDYGDLNTCLQNL
ENSBTAP00000053194  .EDS...FQAL...........A-EGK...................................A.YITKEDMKQALTPE
ENSBTAP00000056127  .ERR...FKAA...........DLDSD...................................Q.TATREEFTAFL---
ENSBTAP00000033188  .---...----...........-----...................................-.--------------
ENSBTAP00000053548  .---...----...........-----...................................-.--------------
ENSBTAP00000011687  .RPV...FELL...........DLDGE...................................L.KIGPDHLHMYNFLF
ENSBTAP00000007636  .EIA...FKMF...........DLNGD...................................G.EVDMEEFEQVQSII
ENSBTAP00000020950  .---...----...........-----...................................-.-IDFVENTALDDAE
ENSBTAP00000009115  .---...----...........-----...................................-.--------------
ENSBTAP00000023873  .---...----...........-----...................................-.--------------
ENSBTAP00000054471  .QEF...FQTC...........DKEGK...................................G.FIARADMQRLHKEL
ENSBTAP00000039694  .AIA...LNMY...........NFASR...................................-.SIGQDEFKRAVYVA
ENSBTAP00000025205  .QEF...FQTC...........DKEGK...................................G.FIARADMQRLHKEL
ENSBTAP00000047882  .LHY...FKMH...........DYDGN...................................N.LLDGLELSTAITHV
ENSBTAP00000001368  .LSA...FGDL...........DQNQD...................................G.CISKEEMVSYFL--
ENSBTAP00000029786  .KLL...YKMH...........-----...................................-.--------------
ENSBTAP00000028993  .RSV...FAAC...........DANRS...................................G.RLEREEFRALCAEL
ENSBTAP00000023678  .REA...FQIY...........DKEAS...................................G.YVDRETFFKICGSY
ENSBTAP00000034710  .---...----...........-----...................................-.--------------
ENSBTAP00000031823  .ERR...FRVA...........DQDGD...................................S.MATREELTAFL---
ENSBTAP00000038002  .EFT...FKLY...........DTDRN...................................G.ILDSSEVDRIIIQM
ENSBTAP00000021074  .---...----...........-----...................................-.--------------
ENSBTAP00000026544  .MRI...WRKY...........DADSS...................................G.FISAAELCNFLRDL
ENSBTAP00000007217  .LDL...FQLL...........DQNHD...................................G.RLQLREVLAQNRLG
ENSBTAP00000029792  .KVL...YKL-...........-----...................................-.--------------
ENSBTAP00000044088  .AIA...MQMF...........SLAHR...................................-.PVRLAEFKRAVKVA
ENSBTAP00000017319  .---...----...........-----...................................-.--------------
ENSBTAP00000044100  .LDS...FCVL...........DKDQD...................................G.LISKDEMMAYFLRA
ENSBTAP00000033594  .HES...FQEM...........DLNDD...................................W.KLSKNEVKVYLKKE
ENSBTAP00000026766  .KYC...FLLV...........QV---...................................-.--------------
ENSBTAP00000055894  .---...----...........-----...................................-.--------------
ENSBTAP00000015220  .--L...FEHM...........DLNKD...................................G.EVPVEEFSTFIKAQ
ENSBTAP00000033613  .-NL...FEEI...........DKDGD...................................G.EVLLEEFSEYIHAQ
ENSBTAP00000056320  .EYW...FRM-...........DLDGD...................................V.ALFMFELEYFYEEQ
ENSBTAP00000025249  .---...----...........-----...................................-.--------DFLVNC
ENSBTAP00000029159  .-FS...FCVM...........DKDRE...................................G.LISRDEITAYFMR-
ENSBTAP00000044088  .AIA...MQMF...........SLAHR...................................-.PVRLAEFKRAVKVA
ENSBTAP00000016319  .---...----...........-----...................................-.--------------
ENSBTAP00000017662  .---...----...........-----...................................-.--------------
ENSBTAP00000012479  .NLS...FRKE...........DRSFS...................................G.CLPPPKVRAICGKH
ENSBTAP00000029886  .INI...TTYA...........DQENN...................................K.---------LLRGL
ENSBTAP00000027388  .---...----...........-----...................................-.--------------
ENSBTAP00000039694  .RIA...FNMF...........DTDGN...................................E.MVDKKEFLVLQEIF
ENSBTAP00000023673  .QEL...FLLC...........DKEAK...................................G.FITRHDLQGLQSDL
ENSBTAP00000041488  .QEL...FLLC...........DKEAK...................................G.FITRHDLQGLQSDL
ENSBTAP00000001452  .-ET...FKQI...........DTDND...................................R.QLSKTEISHYLKKE
ENSBTAP00000028498  .IKN...FHQY...........SVEGG...................................KeTLTPSELRDLVTQQ
ENSBTAP00000001426  .NAI...FTFY...........DKDGS...................................G.YIDENELDALLKDL
ENSBTAP00000020240  .SDT...FKEY...........DPDGK...................................G.VISKRDFHKAMESH
ENSBTAP00000053650  .SDT...FKEY...........DPDGK...................................G.VISKRDFHKAMESH
ENSBTAP00000041651  .LYL...FALH...........DYDQS...................................G.QLDGLELLSMLTAA
ENSBTAP00000005154  .---...----...........----D...................................G.VLSPGELRELFSGV
ENSBTAP00000021174  .NKA...FELY...........DQDGN...................................G.YIDENELDALLKDL
ENSBTAP00000022068  .---...----...........-----...................................-.--------------
ENSBTAP00000026682  .EAI...FTKY...........DQDGD...................................Q.ELTEHE--------
ENSBTAP00000007636  .LSF...YHMA...........GAS--...................................-.-LDKVTMQQVARTV
ENSBTAP00000027954  .---...----...........-----...................................-.--------------
ENSBTAP00000020778  .---...----...........DLNTD...................................R.RISAKEMQKWIMQK
ENSBTAP00000013601  .---...----...........-----...................................-.--------------
ENSBTAP00000005477  .QQS...FDILgft........NSKGE...................................K.AIQREDFLNLLHTK
ENSBTAP00000055305  .SDT...FKEY...........DPDGK...................................G.IISKKEFQKAMEGQ
ENSBTAP00000036054  .SDT...FKEY...........DPDGK...................................G.IISKKEFQKAMEGQ
ENSBTAP00000004912  .RKI...YSTL...........AGNRK...................................DvEVTKEEFVLAAQKF
ENSBTAP00000022292  .RQA...FALK...........DKSKS...................................G.LISGLDFSDIMVTI
ENSBTAP00000002717  .VFL...LGNT...........DRPDA...................................S.AVHLHDFQRFLLHE
ENSBTAP00000036015  .---...----...........----E...................................G.AFVKEHFDELCWTL
ENSBTAP00000051638  .KLL...FKLHispaytevqykDPSKG...................................D.ELSKEELLYFSQ--
ENSBTAP00000026766  .KYI...FSLF...........ASESG...................................S.YVIREEMERMLHVV
ENSBTAP00000053738  .SKA...LAKL...........DKSRT...................................G.YISLGRLQRLLQEC
ENSBTAP00000016306  .EWT...FTLY...........DFDNN...................................G.KVTREDITSLLHTI
ENSBTAP00000013714  .RRV...FQTY...........DPEDN...................................G.FIPDSLLEDVMKAL
ENSBTAP00000036550  .KLL...YRL-...........-----...................................-.--------------
ENSBTAP00000053738  .RKR...FLDF...........TKEPN...................................G.KIHTHDFKKVLEDY
ENSBTAP00000023383  .---...----...........-----...................................-.--------------
ENSBTAP00000027030  .TIG...FRVFsc.........LDDGM...................................G.YASVERILDTWQEE
ENSBTAP00000053270  .TIG...FRVFsc.........LDDGM...................................G.YASVERILDTWQEE
ENSBTAP00000054640  .TIG...FRVFsc.........LDDGM...................................G.YASVERILDTWQEE
ENSBTAP00000012770  .RIG...LSLY...........DVAGQ...................................G.YLRESDLENYILEL
ENSBTAP00000009967  .LETlqrFKAL...........DAEQL...................................G.TITYEQYKQA----
ENSBTAP00000015183  .---...----...........-----...................................-.--------------
ENSBTAP00000014222  .TAA...FTRF...........DQDGN...................................G.VLDEKEQKETQQKL
ENSBTAP00000026288  .---...----...........-----...................................-.--------------
ENSBTAP00000002128  .QNA...LKIF...........HRIKC...................................G.RVPVSEVDKVLDSM
ENSBTAP00000003365  .AVC...RENF...........DTKKN...................................-.--------------
ENSBTAP00000053738  .---...----...........-----...................................-.--------------
ENSBTAP00000009228  .SEA...FQDY...........VTDPR...................................G.LISKKDFKKAMDSQ
ENSBTAP00000026785  .---...----...........-----...................................-.VISVSELINAMKQI
ENSBTAP00000002578  .WVI...FNFL...........SEDKY...................................PlIIVPEEIEYLLKKL
ENSBTAP00000000106  .---...----...........-----...................................-.--------------
ENSBTAP00000028840  .---...----...........-----...................................-.--------------
ENSBTAP00000053594  .EEA...FAQF...........DAEGD...................................G.TVDAENMLEALKNS
ENSBTAP00000055414  .KAL...FQKW...........DCDGS...................................G.FLDLKEIDELLYTY
ENSBTAP00000026698  .RLA...FELF...........-----...................................-.--------------
ENSBTAP00000017015  .---...----...........-----...................................-.--------------
ENSBTAP00000049908  .LMA...FVYF...........DQSHC...................................G.YLLEKDLEEIFYTL
ENSBTAP00000021395  .---...----...........-----...................................-.--------------
ENSBTAP00000007194  .LLA...FVYF...........DANWC...................................G.YLHRRDLERILLTL
ENSBTAP00000025455  .KAL...FQKW...........DCDGS...................................G.FLDLKEIDELLYTY


                      130                        140                                                
                        |                          |                                                
d1dgua_               TGEGE.......DT..........RLSASE........MK......................................
ENSBTAP00000019411  -----.......GE..........KLTDEE........--......................................
ENSBTAP00000036057  -----.......GE..........KLTDEE........--......................................
ENSBTAP00000038404  YKMVSsvm....KM..........PEDEST........PE......................................
ENSBTAP00000010971  YKMVSsvm....KM..........PEDEST........PE......................................
ENSBTAP00000019803  -----.......GF..........RLNEHL........--......................................
ENSBTAP00000014038  V----.......GN..........NLKDTQ........LQ......................................
ENSBTAP00000002055  -----.......GE..........KLTDEE........--......................................
ENSBTAP00000049731  -----.......GE..........KLTDEE........--......................................
ENSBTAP00000005577  YKMVSsvm....KM..........PEDEST........PE......................................
ENSBTAP00000034949  FKMIS.......PEdtk.......HLPEDEnt......PE......................................
ENSBTAP00000017447  Q----.......-Rdp........RLNEILfpfy....DA......................................
ENSBTAP00000010858  -----.......--..........------........--......................................
ENSBTAP00000046644  Q----.......-RdprlneilypPLKQEQ........--......................................
ENSBTAP00000022814  YKMVGtvimm..KM..........NEDGLT........PE......................................
ENSBTAP00000019758  -----.......--..........------........--......................................
ENSBTAP00000019321  YKMVG.......-Tvimmrm....NQDGLT........PQ......................................
ENSBTAP00000011677  -----.......GF..........HLNNQ-........--......................................
ENSBTAP00000011680  -----.......GF..........HLNNQ-........--......................................
ENSBTAP00000021742  YDMMG.......KYtyp.......ALREEA........PR......................................
ENSBTAP00000005348  -----.......--..........------........--......................................
ENSBTAP00000016609  -----.......--..........------........--......................................
ENSBTAP00000012740  -----.......--..........------........--......................................
ENSBTAP00000018403  -----.......GE..........KVSQDE........--......................................
ENSBTAP00000026407  -----.......--..........------........--......................................
ENSBTAP00000052557  -----.......GE..........NLTDEE........--......................................
ENSBTAP00000054167  YDMMG.......KCtyp.......VLKEDA........PR......................................
ENSBTAP00000010319  -----.......GE..........NLSDEE........--......................................
ENSBTAP00000041545  -----.......--..........QKEGER........AS......................................
ENSBTAP00000055204  -----.......GY..........RLSDQF........--......................................
ENSBTAP00000003718  YDMMG.......KYtyp.......VLKEDT........PR......................................
ENSBTAP00000011676  -----.......GF..........TLSDQ-........--......................................
ENSBTAP00000049395  -----.......--..........------........--......................................
ENSBTAP00000054983  -----.......--..........------........--......................................
ENSBTAP00000052219  -----.......GF..........RLSPQA........--......................................
ENSBTAP00000025402  -----.......--..........------........--......................................
ENSBTAP00000011678  -----.......GF..........KLNKKL........--......................................
ENSBTAP00000000433  -----.......--..........------........--......................................
ENSBTAP00000021491  -----.......GE..........NLTDDE........--......................................
ENSBTAP00000044733  -----.......GF..........KMPCQL........--......................................
ENSBTAP00000010937  QKMT-.......--..........NVTTDY........--......................................
ENSBTAP00000056439  QKMT-.......--..........NVTTDY........--......................................
ENSBTAP00000055780  -----.......GE..........TITEDD........--......................................
ENSBTAP00000038002  -----.......--..........------........--......................................
ENSBTAP00000034705  -----.......GEh.........KATLAH........--......................................
ENSBTAP00000035936  YKLKK.......AC..........SVEVEAeqqgklltPE......................................
ENSBTAP00000013699  -----.......GY..........NLSPQF........--......................................
ENSBTAP00000002564  -----.......YE..........RLEE--........--......................................
ENSBTAP00000011496  YQMVG.......NTv.........ELPEEEnt......PE......................................
ENSBTAP00000019111  -----.......GE..........NMSDEE........--......................................
ENSBTAP00000017036  RAINP.......C-..........SDSTMT........AE......................................
ENSBTAP00000003213  QKMT-.......--..........GVTLES........--......................................
ENSBTAP00000055444  QKMT-.......--..........GVTLES........--......................................
ENSBTAP00000024550  -----.......GY..........RLSPQT........--......................................
ENSBTAP00000015248  -----.......GD..........RFTDEE........--......................................
ENSBTAP00000021328  -----.......GD..........RFTDEE........--......................................
ENSBTAP00000037091  -----.......GD..........RFTDEE........--......................................
ENSBTAP00000029967  L----.......GE..........RLSQRE........--......................................
ENSBTAP00000021449  L----.......GD..........KLTSQE........--......................................
ENSBTAP00000053176  -----.......--..........------........--......................................
ENSBTAP00000042361  L----.......GH..........QVGHRD........--......................................
ENSBTAP00000016509  RPWGPpq.....GK..........LLT---........PE......................................
ENSBTAP00000026714  L----.......GH..........QVGHRD........--......................................
ENSBTAP00000004690  -----.......GI..........KLNNKV........--......................................
ENSBTAP00000010858  -----.......--..........------........--......................................
ENSBTAP00000013117  QGVA-.......--..........HINEEI........--......................................
ENSBTAP00000017574  Y----.......TL..........DFNKSI........--......................................
ENSBTAP00000004885  -----.......GL..........TISEQQ........--......................................
ENSBTAP00000008961  -----.......--..........------........--......................................
ENSBTAP00000028063  -----.......--..........------........--......................................
ENSBTAP00000012740  -----.......--..........------........--......................................
ENSBTAP00000006283  L----.......GE..........PLVGPE........--......................................
ENSBTAP00000014306  -----.......GE..........KMTEEE........--......................................
ENSBTAP00000053252  QGVT-.......--..........HITEDM........--......................................
ENSBTAP00000014304  -----.......GE..........KMTEEE........--......................................
ENSBTAP00000045669  -----.......--..........------........--......................................
ENSBTAP00000041264  -----.......--..........------........--......................................
ENSBTAP00000006711  -----.......--..........------........--......................................
ENSBTAP00000017358  -----.......--..........------........--......................................
ENSBTAP00000053274  -----.......--..........------........--......................................
ENSBTAP00000055296  -----.......--..........------........--......................................
ENSBTAP00000016852  --HHP.......KY..........QNGEWT........EE......................................
ENSBTAP00000036380  -----.......GE..........KLTHKE........--......................................
ENSBTAP00000041719  -----.......GE..........RMTEEE........--......................................
ENSBTAP00000049636  -----.......GE..........KMKEEE........--......................................
ENSBTAP00000024444  -----.......AE..........RFSKEE........--......................................
ENSBTAP00000004556  -----.......--..........------........--......................................
ENSBTAP00000038767  V----.......GV..........NISDEQ........LG......................................
ENSBTAP00000031285  YEVC-.......--..........------........--......................................
ENSBTAP00000011457  LLKQP.......SE..........EDPDEG........IK......................................
ENSBTAP00000011047  -----.......GE..........KLTEDE........--......................................
ENSBTAP00000002564  -----.......--..........------........--......................................
ENSBTAP00000037104  -----.......AD..........RFSEEE........--......................................
ENSBTAP00000002672  -----.......AD..........KFSPAE........--......................................
ENSBTAP00000028269  -----.......CD..........RFSQEE........--......................................
ENSBTAP00000016647  V----.......GV..........QVTEEQ........LE......................................
ENSBTAP00000004536  -----.......GI..........SISLEQ........--......................................
ENSBTAP00000042177  R----.......KK..........SKPKKC........--......................................
ENSBTAP00000028063  -----.......--..........------........--......................................
ENSBTAP00000050283  -----.......GE..........KMSEAE........--......................................
ENSBTAP00000048539  F----.......--..........GVPDLD........--......................................
ENSBTAP00000045669  LKLPTavfegp.SF..........GYTEQS........--......................................
ENSBTAP00000007972  --THP.......KV..........RSGEWT........EE......................................
ENSBTAP00000040815  K----.......KK..........AKPKKC........--......................................
ENSBTAP00000025661  L----.......--..........GVPDLD........--......................................
ENSBTAP00000028350  TGESE.......DT..........RLSASE........MK......................................
ENSBTAP00000053274  LKLPTavfegp.SF..........GYTEQS........--......................................
ENSBTAP00000021537  T----.......RG..........ELSTEE........VS......................................
ENSBTAP00000055481  -----.......--..........SLPQAQ........--......................................
ENSBTAP00000039155  -----.......GK..........KLNNQE........--......................................
ENSBTAP00000029333  -----.......--..........SLPQAQ........--......................................
ENSBTAP00000016315  -----.......--..........------........--......................................
ENSBTAP00000021091  -----.......GI..........MLSDDV........--......................................
ENSBTAP00000021618  IEIS-.......NN..........CLTKTQ........LA......................................
ENSBTAP00000055520  -----.......--..........------........--......................................
ENSBTAP00000055624  -----.......--..........------........--......................................
ENSBTAP00000016319  -----.......--..........------........--......................................
ENSBTAP00000034078  -----.......GE..........PFSQEE........--......................................
ENSBTAP00000006645  LNSD-.......--..........DMSEDL........LT......................................
ENSBTAP00000021909  -----.......DY..........DHAEAE........--......................................
ENSBTAP00000001426  LKKA-.......NR..........PYDEPK........LQ......................................
ENSBTAP00000015802  -----.......GV..........KISEQQ........--......................................
ENSBTAP00000032680  -----.......GV..........KISEQQ........--......................................
ENSBTAP00000055007  -----.......--..........------........--......................................
ENSBTAP00000020148  -----.......--..........------........--......................................
ENSBTAP00000052345  -----.......--..........------........--......................................
ENSBTAP00000029334  -----.......--..........NLSQTQ........--......................................
ENSBTAP00000052345  -----.......--..........------........--......................................
ENSBTAP00000056127  -----.......DY..........DHAQAE........--......................................
ENSBTAP00000012557  KSHY-.......SV..........HIDDSQ........--......................................
ENSBTAP00000011888  LYES-.......AI..........SLPKEK........LD......................................
ENSBTAP00000017060  -----.......--..........------........--......................................
ENSBTAP00000031854  CERME.......AM..........GIEPLP........FH......................................
ENSBTAP00000031823  -----.......AQ..........DQPLVE........--......................................
ENSBTAP00000021603  PTPRPrsfieisNN..........CLTKTQ........LA......................................
ENSBTAP00000010838  -----.......--..........------........--......................................
ENSBTAP00000014575  T----.......KS..........ELDEDE........VV......................................
ENSBTAP00000011215  CERME.......AM..........GIEPLP........FH......................................
ENSBTAP00000053698  F----.......RD..........HLTMKD........--......................................
ENSBTAP00000006806  LSGFL.......DA..........QKDADA........--......................................
ENSBTAP00000029334  -----.......--..........------........--......................................
ENSBTAP00000044105  -----.......--..........------........--......................................
ENSBTAP00000026904  LTEFL.......SC..........QKDPEL........--......................................
ENSBTAP00000017060  -----.......--..........------........--......................................
ENSBTAP00000055520  -----.......--..........------........--......................................
ENSBTAP00000044226  LSGFL.......DA..........QKDADA........--......................................
ENSBTAP00000055624  -----.......--..........------........--......................................
ENSBTAP00000042182  -----.......GF..........HLNNQL........--......................................
ENSBTAP00000010796  -----.......SI..........NLSEEE........--......................................
ENSBTAP00000021174  LEKA-.......NK..........TVDDTK........LA......................................
ENSBTAP00000006275  LSHFL.......EE..........IKEQEV........--......................................
ENSBTAP00000020950  -----.......NQ..........GIAQEE........--......................................
ENSBTAP00000053738  -----.......SI..........NLSEEE........--......................................
ENSBTAP00000004963  L----.......--..........------........--......................................
ENSBTAP00000023774  F----.......CE..........HLSMKD........--......................................
ENSBTAP00000020395  -----.......--..........-----Q........--......................................
ENSBTAP00000020150  FPGFL.......EN..........QKDPLA........--......................................
ENSBTAP00000025561  LPSFL.......GK..........RTDETA........--......................................
ENSBTAP00000053738  -----.......DI..........PLTPRE........--......................................
ENSBTAP00000034009  LPKTL.......QN..........TKDQPT........--......................................
ENSBTAP00000020539  SSHM-.......NI..........DITDDC........--......................................
ENSBTAP00000020778  -----.......NE..........FSALNE........--......................................
ENSBTAP00000017461  -----.......AP..........KLSERI........--......................................
ENSBTAP00000044096  LPNFLk......KQ..........KKNEAA........--......................................
ENSBTAP00000008523  LPNFLk......KQ..........KKNEAA........--......................................
ENSBTAP00000035196  PYIPW.......GP..........DVNNTV........--......................................
ENSBTAP00000041997  -----.......--..........------........--......................................
ENSBTAP00000025499  --SPD.......AR..........DLSVKE........--......................................
ENSBTAP00000055481  -----.......--..........------........--......................................
ENSBTAP00000002174  -----.......--..........------........--......................................
ENSBTAP00000000589  LPSFV.......GE..........KVDEEG........--......................................
ENSBTAP00000028239  -----.......--..........------........--......................................
ENSBTAP00000014894  -----.......--..........ELPPDQ........--......................................
ENSBTAP00000026544  MELV-.......QP..........SIRGVD........LD......................................
ENSBTAP00000029333  -----.......--..........------........--......................................
ENSBTAP00000041966  DFLA-.......GI..........SITSE-........--......................................
ENSBTAP00000008933  -----.......--..........------........--......................................
ENSBTAP00000056088  LPKTL.......QQ..........NTKDQP........--......................................
ENSBTAP00000033794  -----.......--..........------........--......................................
ENSBTAP00000012786  -----.......--..........ELPPDQ........--......................................
ENSBTAP00000030018  -----.......--..........------........--......................................
ENSBTAP00000040233  -----.......CL..........KMKDEE........--......................................
ENSBTAP00000003365  -----.......GE..........KMTREE........--......................................
ENSBTAP00000053176  MHVAE.......YL..........EWDVTE........LN......................................
ENSBTAP00000024301  -----.......--..........------........--......................................
ENSBTAP00000022292  TIHH-.......HI..........PFNWD-........--......................................
ENSBTAP00000015611  FRPIL.......KN..........PDDPDT........--......................................
ENSBTAP00000012770  QELMK.......IH..........GQDPVS........FQ......................................
ENSBTAP00000000847  L--CL.......GE..........KMRESS........--......................................
ENSBTAP00000053738  -----.......CL..........KMKDEE........--......................................
ENSBTAP00000054975  --ESG.......AR..........ELTESE........--......................................
ENSBTAP00000046639  --MHP.......RVisg.......HSTEEE........IK......................................
ENSBTAP00000052345  -----.......--..........------........--......................................
ENSBTAP00000053164  -----.......CL..........HLDEKL........--......................................
ENSBTAP00000016774  C----.......PK..........FMKKKD........--......................................
ENSBTAP00000022630  FPSLL.......KG..........PST---........--......................................
ENSBTAP00000010796  -----.......VQ..........VLTDEQ........--......................................
ENSBTAP00000021909  -----.......--..........------........--......................................
ENSBTAP00000033974  -----.......GE..........PLNEQM........--......................................
ENSBTAP00000006711  LHIAQ.......YL..........EWDPTE........LR......................................
ENSBTAP00000010796  -----.......GC..........SLKEEE........LI......................................
ENSBTAP00000004912  TIHQ-.......HI..........PFNWD-........--......................................
ENSBTAP00000005979  PAAPW.......GP..........HLPSTV........--......................................
ENSBTAP00000053738  -----.......VQ..........VLTDEQ........--......................................
ENSBTAP00000053746  LSGNP.......--..........HIEKES........AR......................................
ENSBTAP00000023221  LEKVY.......DP..........KNEEDDmvemeee.RL......................................
ENSBTAP00000019429  -----.......--..........------........--......................................
ENSBTAP00000052019  -----.......--..........------........--......................................
ENSBTAP00000042244  -----.......--..........------........--......................................
ENSBTAP00000053738  -----.......CP..........FLTTEH........--......................................
ENSBTAP00000018877  LNHM-.......--..........-LTDTG........NR......................................
ENSBTAP00000053019  -----.......--..........------........--......................................
ENSBTAP00000003073  LEKVY.......DP..........KNEDDDmremeee.RL......................................
ENSBTAP00000012886  -----.......--..........------........--......................................
ENSBTAP00000044222  LPTWA.......PT..........TLRECD........--......................................
ENSBTAP00000028499  LPHLL.......KD..........VGS---........--......................................
ENSBTAP00000047378  -----.......GLq.........GLAKEE........--......................................
ENSBTAP00000009308  -----.......--..........------........--......................................
ENSBTAP00000017060  -----.......--..........------........--......................................
ENSBTAP00000050406  -----.......--..........------........--......................................
ENSBTAP00000031879  -----.......--..........------........--......................................
ENSBTAP00000031854  VDTHP.......GLtflkdap...EFHSRY........IT......................................
ENSBTAP00000001250  L----.......--..........GVAELT........--......................................
ENSBTAP00000026035  -----.......--..........------........--......................................
ENSBTAP00000011215  VDTHP.......GLtflkdap...EFHSRY........IT......................................
ENSBTAP00000002128  -----.......GV..........YLSKPE........FQ......................................
ENSBTAP00000053194  -----.......--..........------........--......................................
ENSBTAP00000056127  -----.......--..........------........--......................................
ENSBTAP00000033188  -----.......--..........------........--......................................
ENSBTAP00000053548  -----.......--..........------........--......................................
ENSBTAP00000011687  -----.......--..........NIKKQQ........--......................................
ENSBTAP00000007636  RSQT-.......SM..........GMRHRD........RSttgntlksglcsalttyffgadlkgkltiknflefqrk
ENSBTAP00000020950  -----.......--..........EESFRQ........LH......................................
ENSBTAP00000009115  -----.......--..........------........--......................................
ENSBTAP00000023873  -----.......--..........------........--......................................
ENSBTAP00000054471  -----.......--..........PLSLED........--......................................
ENSBTAP00000039694  T----.......GL..........KLSPHL........--......................................
ENSBTAP00000025205  -----.......--..........PLSLED........--......................................
ENSBTAP00000047882  HKEEG.......SEqa........PMNEDE........LI......................................
ENSBTAP00000001368  -----.......--..........------........--......................................
ENSBTAP00000029786  -----.......--..........------........--......................................
ENSBTAP00000028993  -----.......--..........RVRPAD........--......................................
ENSBTAP00000023678  -----.......QL..........PVDDSL........--......................................
ENSBTAP00000034710  -----.......--..........------........--......................................
ENSBTAP00000031823  -----.......--..........------........--......................................
ENSBTAP00000038002  MRMAE.......YL..........DWDVSE........LR......................................
ENSBTAP00000021074  -----.......--..........------........--......................................
ENSBTAP00000026544  -----.......--..........------........--......................................
ENSBTAP00000007217  N----.......GR..........WMTPET........--......................................
ENSBTAP00000029792  -----.......--..........------........--......................................
ENSBTAP00000044088  T----.......GQ..........ELSNNI........--......................................
ENSBTAP00000017319  -----.......--..........------........--......................................
ENSBTAP00000044100  -----.......--..........------........--......................................
ENSBTAP00000033594  FEKH-.......GA..........VVNESH........HD......................................
ENSBTAP00000026766  -----.......--..........------........--......................................
ENSBTAP00000055894  -----.......--..........------........--......................................
ENSBTAP00000015220  VSEGK.......GR..........LLPGQD........PE......................................
ENSBTAP00000033613  VASGK.......GK..........LAPGFD........AE......................................
ENSBTAP00000056320  SRRLD.......SM..........AIEALP........FE......................................
ENSBTAP00000025249  Q----.......GE..........HYTYDE........IL......................................
ENSBTAP00000029159  -----.......--..........------........--......................................
ENSBTAP00000044088  T----.......GQ..........ELSNNI........--......................................
ENSBTAP00000016319  -----.......--..........------........--......................................
ENSBTAP00000017662  -----.......--..........------........--......................................
ENSBTAP00000012479  -----.......GL..........YLTLSL........--......................................
ENSBTAP00000029886  C----.......--..........------........--......................................
ENSBTAP00000027388  -----.......--..........------........--......................................
ENSBTAP00000039694  RKKNE.......KR..........ET----........-Kgdeekramlrlqlygyhsptnsvlktdaeelvsrsywd
ENSBTAP00000023673  -----.......--..........PLTPEQ........--......................................
ENSBTAP00000041488  -----.......--..........PLTPEQ........--......................................
ENSBTAP00000001452  FEKD-.......EK..........PRDQSY........QT......................................
ENSBTAP00000028498  LPHLM.......PS..........NCG---........--......................................
ENSBTAP00000001426  -----.......--..........------........--......................................
ENSBTAP00000020240  -----.......-K..........HYTQSE........--......................................
ENSBTAP00000053650  -----.......-K..........HYTQSE........--......................................
ENSBTAP00000041651  LAPGA.......SD..........SPTTNP........VI......................................
ENSBTAP00000005154  D----.......GH..........PADNLE........TE......................................
ENSBTAP00000021174  CEKN-.......--..........------........--......................................
ENSBTAP00000022068  -----.......--..........------........--......................................
ENSBTAP00000026682  -----.......--..........------........--......................................
ENSBTAP00000007636  A----.......KV..........ELSDHV........--......................................
ENSBTAP00000027954  -----.......--..........------........--......................................
ENSBTAP00000020778  TAEHF.......--..........QEAVAE........--......................................
ENSBTAP00000013601  -----.......--..........------........--......................................
ENSBTAP00000005477  -----.......GE..........HMTEEE........MT......................................
ENSBTAP00000055305  K----.......--..........QYTQSE........--......................................
ENSBTAP00000036054  K----.......--..........QYTQSE........--......................................
ENSBTAP00000004912  -----.......G-..........QVTPME........--......................................
ENSBTAP00000022292  RSHM-.......--..........------........--......................................
ENSBTAP00000002717  QQ---.......--..........------........--......................................
ENSBTAP00000036015  -----.......--..........------........--......................................
ENSBTAP00000051638  -----.......--..........------........--......................................
ENSBTAP00000026766  -----.......DG..........KVPDT-........--......................................
ENSBTAP00000053738  -----.......GC..........SLKEEE........LI......................................
ENSBTAP00000016306  YEVV-.......--..........------........--......................................
ENSBTAP00000013714  -----.......DL..........VSDPEY........--......................................
ENSBTAP00000036550  -----.......--..........------........--......................................
ENSBTAP00000053738  -----.......GM..........PMDDDQ........--......................................
ENSBTAP00000023383  -----.......--..........------........--......................................
ENSBTAP00000027030  -----.......GI..........ENSQE-........--......................................
ENSBTAP00000053270  -----.......GI..........ENSQE-........--......................................
ENSBTAP00000054640  -----.......GI..........ENSQE-........--......................................
ENSBTAP00000012770  IPTLP.......QLdglek.....SFYSFY........VC......................................
ENSBTAP00000009967  -----.......--..........------........--......................................
ENSBTAP00000015183  -----.......--..........------........--......................................
ENSBTAP00000014222  -----.......--..........------........--......................................
ENSBTAP00000026288  -----.......--..........------........--......................................
ENSBTAP00000002128  -----.......DI..........LVVPET........--......................................
ENSBTAP00000003365  -----.......--..........------........--......................................
ENSBTAP00000053738  -----.......--..........------........--......................................
ENSBTAP00000009228  K----.......--..........QFTGPE........--......................................
ENSBTAP00000026785  K----.......--..........HIPESK........--......................................
ENSBTAP00000002578  TEAM-.......GV..........SWQQEQ........--......................................
ENSBTAP00000000106  -----.......--..........------........--......................................
ENSBTAP00000028840  -----.......--..........------........--......................................
ENSBTAP00000053594  S----.......GA..........NLQ---........--......................................
ENSBTAP00000055414  -----.......KE..........GMEKES........--......................................
ENSBTAP00000026698  -----.......--..........------........--......................................
ENSBTAP00000017015  -----.......--..........------........--......................................
ENSBTAP00000049908  -----.......GL..........HLSRAQ........--......................................
ENSBTAP00000021395  -----.......--..........------........--......................................
ENSBTAP00000007194  -----.......GL..........RLSAEQ........--......................................
ENSBTAP00000025455  -----.......KE..........GMEKES........--......................................


                                                                                                    
                                                                                                    
d1dgua_               ..............................................................................
ENSBTAP00000019411  ..............................................................................
ENSBTAP00000036057  ..............................................................................
ENSBTAP00000038404  ..............................................................................
ENSBTAP00000010971  ..............................................................................
ENSBTAP00000019803  ..............................................................................
ENSBTAP00000014038  ..............................................................................
ENSBTAP00000002055  ..............................................................................
ENSBTAP00000049731  ..............................................................................
ENSBTAP00000005577  ..............................................................................
ENSBTAP00000034949  ..............................................................................
ENSBTAP00000017447  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000046644  ..............................................................................
ENSBTAP00000022814  ..............................................................................
ENSBTAP00000019758  ..............................................................................
ENSBTAP00000019321  ..............................................................................
ENSBTAP00000011677  ..............................................................................
ENSBTAP00000011680  ..............................................................................
ENSBTAP00000021742  ..............................................................................
ENSBTAP00000005348  ..............................................................................
ENSBTAP00000016609  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000018403  ..............................................................................
ENSBTAP00000026407  ..............................................................................
ENSBTAP00000052557  ..............................................................................
ENSBTAP00000054167  ..............................................................................
ENSBTAP00000010319  ..............................................................................
ENSBTAP00000041545  ..............................................................................
ENSBTAP00000055204  ..............................................................................
ENSBTAP00000003718  ..............................................................................
ENSBTAP00000011676  ..............................................................................
ENSBTAP00000049395  ..............................................................................
ENSBTAP00000054983  ..............................................................................
ENSBTAP00000052219  ..............................................................................
ENSBTAP00000025402  ..............................................................................
ENSBTAP00000011678  ..............................................................................
ENSBTAP00000000433  ..............................................................................
ENSBTAP00000021491  ..............................................................................
ENSBTAP00000044733  ..............................................................................
ENSBTAP00000010937  ..............................................................................
ENSBTAP00000056439  ..............................................................................
ENSBTAP00000055780  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000034705  ..............................................................................
ENSBTAP00000035936  ..............................................................................
ENSBTAP00000013699  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000011496  ..............................................................................
ENSBTAP00000019111  ..............................................................................
ENSBTAP00000017036  ..............................................................................
ENSBTAP00000003213  ..............................................................................
ENSBTAP00000055444  ..............................................................................
ENSBTAP00000024550  ..............................................................................
ENSBTAP00000015248  ..............................................................................
ENSBTAP00000021328  ..............................................................................
ENSBTAP00000037091  ..............................................................................
ENSBTAP00000029967  ..............................................................................
ENSBTAP00000021449  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000042361  ..............................................................................
ENSBTAP00000016509  ..............................................................................
ENSBTAP00000026714  ..............................................................................
ENSBTAP00000004690  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000013117  ..............................................................................
ENSBTAP00000017574  ..............................................................................
ENSBTAP00000004885  ..............................................................................
ENSBTAP00000008961  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000006283  ..............................................................................
ENSBTAP00000014306  ..............................................................................
ENSBTAP00000053252  ..............................................................................
ENSBTAP00000014304  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000041264  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000017358  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000055296  ..............................................................................
ENSBTAP00000016852  ..............................................................................
ENSBTAP00000036380  ..............................................................................
ENSBTAP00000041719  ..............................................................................
ENSBTAP00000049636  ..............................................................................
ENSBTAP00000024444  ..............................................................................
ENSBTAP00000004556  ..............................................................................
ENSBTAP00000038767  ..............................................................................
ENSBTAP00000031285  ..............................................................................
ENSBTAP00000011457  ..............................................................................
ENSBTAP00000011047  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000037104  ..............................................................................
ENSBTAP00000002672  ..............................................................................
ENSBTAP00000028269  ..............................................................................
ENSBTAP00000016647  ..............................................................................
ENSBTAP00000004536  ..............................................................................
ENSBTAP00000042177  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000050283  ..............................................................................
ENSBTAP00000048539  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000007972  ..............................................................................
ENSBTAP00000040815  ..............................................................................
ENSBTAP00000025661  ..............................................................................
ENSBTAP00000028350  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000021537  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000039155  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000016315  ..............................................................................
ENSBTAP00000021091  ..............................................................................
ENSBTAP00000021618  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000034078  ..............................................................................
ENSBTAP00000006645  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000015802  ..............................................................................
ENSBTAP00000032680  ..............................................................................
ENSBTAP00000055007  ..............................................................................
ENSBTAP00000020148  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000012557  ..............................................................................
ENSBTAP00000011888  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000021603  ..............................................................................
ENSBTAP00000010838  ..............................................................................
ENSBTAP00000014575  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000053698  ..............................................................................
ENSBTAP00000006806  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000044105  ..............................................................................
ENSBTAP00000026904  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000044226  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000042182  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000006275  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000004963  ..............................................................................
ENSBTAP00000023774  ..............................................................................
ENSBTAP00000020395  ..............................................................................
ENSBTAP00000020150  ..............................................................................
ENSBTAP00000025561  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000034009  ..............................................................................
ENSBTAP00000020539  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000017461  ..............................................................................
ENSBTAP00000044096  ..............................................................................
ENSBTAP00000008523  ..............................................................................
ENSBTAP00000035196  ..............................................................................
ENSBTAP00000041997  ..............................................................................
ENSBTAP00000025499  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000002174  ..............................................................................
ENSBTAP00000000589  ..............................................................................
ENSBTAP00000028239  ..............................................................................
ENSBTAP00000014894  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000041966  ..............................................................................
ENSBTAP00000008933  ..............................................................................
ENSBTAP00000056088  ..............................................................................
ENSBTAP00000033794  ..............................................................................
ENSBTAP00000012786  ..............................................................................
ENSBTAP00000030018  ..............................................................................
ENSBTAP00000040233  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000024301  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000015611  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000000847  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000054975  ..............................................................................
ENSBTAP00000046639  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000053164  ..............................................................................
ENSBTAP00000016774  ..............................................................................
ENSBTAP00000022630  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000033974  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000005979  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000053746  ..............................................................................
ENSBTAP00000023221  ..............................................................................
ENSBTAP00000019429  ..............................................................................
ENSBTAP00000052019  ..............................................................................
ENSBTAP00000042244  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000018877  ..............................................................................
ENSBTAP00000053019  ..............................................................................
ENSBTAP00000003073  ..............................................................................
ENSBTAP00000012886  ..............................................................................
ENSBTAP00000044222  ..............................................................................
ENSBTAP00000028499  ..............................................................................
ENSBTAP00000047378  ..............................................................................
ENSBTAP00000009308  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000050406  ..............................................................................
ENSBTAP00000031879  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000001250  ..............................................................................
ENSBTAP00000026035  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000053194  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000033188  ..............................................................................
ENSBTAP00000053548  ..............................................................................
ENSBTAP00000011687  ..............................................................................
ENSBTAP00000007636  lqhdvlkleferhdpvdgriterqfggmllaysgvqskkltamqkqlkkhfkegkgltfqevenfftflknindvdta
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000009115  ..............................................................................
ENSBTAP00000023873  ..............................................................................
ENSBTAP00000054471  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000025205  ..............................................................................
ENSBTAP00000047882  ..............................................................................
ENSBTAP00000001368  ..............................................................................
ENSBTAP00000029786  ..............................................................................
ENSBTAP00000028993  ..............................................................................
ENSBTAP00000023678  ..............................................................................
ENSBTAP00000034710  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000021074  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000007217  ..............................................................................
ENSBTAP00000029792  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000017319  ..............................................................................
ENSBTAP00000044100  ..............................................................................
ENSBTAP00000033594  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000055894  ..............................................................................
ENSBTAP00000015220  ..............................................................................
ENSBTAP00000033613  ..............................................................................
ENSBTAP00000056320  ..............................................................................
ENSBTAP00000025249  ..............................................................................
ENSBTAP00000029159  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000017662  ..............................................................................
ENSBTAP00000012479  ..............................................................................
ENSBTAP00000029886  ..............................................................................
ENSBTAP00000027388  ..............................................................................
ENSBTAP00000039694  tlrrntsqalfsdfaeradditnlv.....................................................
ENSBTAP00000023673  ..............................................................................
ENSBTAP00000041488  ..............................................................................
ENSBTAP00000001452  ..............................................................................
ENSBTAP00000028498  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000020240  ..............................................................................
ENSBTAP00000053650  ..............................................................................
ENSBTAP00000041651  ..............................................................................
ENSBTAP00000005154  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000022068  ..............................................................................
ENSBTAP00000026682  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000027954  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000013601  ..............................................................................
ENSBTAP00000005477  ..............................................................................
ENSBTAP00000055305  ..............................................................................
ENSBTAP00000036054  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000002717  ..............................................................................
ENSBTAP00000036015  ..............................................................................
ENSBTAP00000051638  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000016306  ..............................................................................
ENSBTAP00000013714  ..............................................................................
ENSBTAP00000036550  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000023383  ..............................................................................
ENSBTAP00000027030  ..............................................................................
ENSBTAP00000053270  ..............................................................................
ENSBTAP00000054640  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000009967  ..............................................................................
ENSBTAP00000015183  ..............................................................................
ENSBTAP00000014222  ..............................................................................
ENSBTAP00000026288  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000009228  ..............................................................................
ENSBTAP00000026785  ..............................................................................
ENSBTAP00000002578  ..............................................................................
ENSBTAP00000000106  ..............................................................................
ENSBTAP00000028840  ..............................................................................
ENSBTAP00000053594  ..............................................................................
ENSBTAP00000055414  ..............................................................................
ENSBTAP00000026698  ..............................................................................
ENSBTAP00000017015  ..............................................................................
ENSBTAP00000049908  ..............................................................................
ENSBTAP00000021395  ..............................................................................
ENSBTAP00000007194  ..............................................................................
ENSBTAP00000025455  ..............................................................................


                                                         150                             160       1
                                                           |                               |        
d1dgua_               ..............................QLIDNILEES........DI..DR....D....GT....INLSEFQHV
ENSBTAP00000019411  ..............................--VDEMIREA........DI..DG....D....GQ....VNYEEFVQM
ENSBTAP00000036057  ..............................--VDEMIREA........DI..DG....D....GQ....VNYEEFVQM
ENSBTAP00000038404  ..............................KRTEKIFRQM........DT..NR....D....GK....LSLEEFIR-
ENSBTAP00000010971  ..............................KRTEKIFRQM........DT..NN....D....GK....LSLEEFIR-
ENSBTAP00000019803  ..............................--YNMIIRRY........-S..DE....G....GN....MDFDNFISC
ENSBTAP00000014038  ..............................QIVDKTIINA........DK..DG....D....GR....ISFEEFCA-
ENSBTAP00000002055  ..............................--VDEMIREA........DI..DG....D....GQ....VNYEEFVQM
ENSBTAP00000049731  ..............................--VDEMIREA........DI..DG....D....GQ....VNYEEFVHM
ENSBTAP00000005577  ..............................KRTDKIFRQM........DT..NN....D....GK....LSLEEFIKG
ENSBTAP00000034949  ..............................KRAEKIWGFF........GK..KD....D....DK....LTEKEFIE-
ENSBTAP00000017447  ..............................KRAMQIIEMYepde....DL..KK....Q....GL....ISSDGFCRY
ENSBTAP00000010858  ..............................----------........--..--....-....--....---------
ENSBTAP00000046644  ..............................--VQVLIEKY........EP..NN....SlakkGQ....ISVDGFMRY
ENSBTAP00000022814  ..............................QRVDKIFSKM........DK..NK....D....DQ....ITLDEFKEA
ENSBTAP00000019758  ..............................----------........--..--....-....--....---------
ENSBTAP00000019321  ..............................QRVDKIFKKM........DQ..DK....D....DQ....ITLEEFKEA
ENSBTAP00000011677  ..............................--LYDIITMR........YA..DK....Y....MN....IDFDSFICC
ENSBTAP00000011680  ..............................--LYDIITMR........YA..DK....Y....MN....IDFDSFICC
ENSBTAP00000021742  ..............................EHVESFFQKM........DR..NK....D....GV....VTIEEFIES
ENSBTAP00000005348  ..............................----------........--..--....-....--....---------
ENSBTAP00000016609  ..............................----------........--..--....-....--....---------
ENSBTAP00000012740  ..............................----------........--..--....-....--....---------
ENSBTAP00000018403  ..............................--LDAMIREA........DV..DQ....D....GR....VNYEEFVRI
ENSBTAP00000026407  ..............................----------........--..--....-....--....---------
ENSBTAP00000052557  ..............................--LQEMIDEA........DR..DG....D....GE....VNEDEFLRI
ENSBTAP00000054167  ..............................QHVETFFQKM........DK..NK....D....GV....VTIDEFIES
ENSBTAP00000010319  ..............................--LQEMIDEA........DR..DG....D....GE....VNEQEFLRI
ENSBTAP00000041545  ..............................DLALELIDRY........EP..SE....S....GK....L--------
ENSBTAP00000055204  ..............................--HDILIRKF........DR..QG....R....GQ....IAFDDFIQG
ENSBTAP00000003718  ..............................QHVDIFFQKM........DK..NK....D....GI....VTLDEFLES
ENSBTAP00000011676  ..............................--VQQTIAMR........YA..CS....K....LT....MDFDSFIAC
ENSBTAP00000049395  ..............................----------........--..--....-....--....---------
ENSBTAP00000054983  ..............................----------........--..--....-....--....---------
ENSBTAP00000052219  ..............................--VNSIAKRY........--..ST....N....GK....ITFDDYIAC
ENSBTAP00000025402  ..............................----------........--..--....-....--....---------
ENSBTAP00000011678  ..............................--YELIITRY........-S..EP....D....LA....VDFDNFVCC
ENSBTAP00000000433  ..............................----------........--..--....-....--....---------
ENSBTAP00000021491  ..............................--LQEMLDEA........DH..DG....D....GE....INKEEFLKM
ENSBTAP00000044733  ..............................--HQVIVARF........-A..DD....D....LI....IDFDNFVRC
ENSBTAP00000010937  ..............................--CIDIIRKF........EV..SE....E....NKvknvLGIEGFTNF
ENSBTAP00000056439  ..............................--CIDIIRKF........EV..SE....E....NKvknvLGIEGFTNF
ENSBTAP00000055780  ..............................--IEELMKDG........DK..NN....D....GR....IDYDEFLEF
ENSBTAP00000038002  ..............................----------........--..--....-....--....---------
ENSBTAP00000034705  ..............................--AQQLIHTY........EL..NE....TakqhEL....MTLDGFMMY
ENSBTAP00000035936  ..............................EVVDRIFLLV........DE..NG....D....GQ....LSLNEFVEG
ENSBTAP00000013699  ..............................--TQLLVSRYc.......PR..SA....N....PA....MQLDRFIQV
ENSBTAP00000002564  ..............................----------........--..--....-....--....---------
ENSBTAP00000011496  ..............................KRVDRIFAMM........DK..NA....D....GK....LTLQEFQEG
ENSBTAP00000019111  ..............................--LRAMIEEF........DK..DG....D....GE....INQEEFIAI
ENSBTAP00000017036  ..............................EFTDTVFSKI........DV..NG....D....GE....LSLEEFMEG
ENSBTAP00000003213  ..............................--CRDIIEQF........EP..--....-....--....---------
ENSBTAP00000055444  ..............................--CRDIIEQF........EP..--....-....--....---------
ENSBTAP00000024550  ..............................--VTTIVKRY........--..SK....N....GR....IFFDDYVAC
ENSBTAP00000015248  ..............................--VDEMYREA........PI..DK....K....GN....FNYVEFTRI
ENSBTAP00000021328  ..............................--VDELYREA........PI..DK....K....GN....FNYIEFTRI
ENSBTAP00000037091  ..............................--VDELYREA........PI..DK....K....GN....FNYIEFTRI
ENSBTAP00000029967  ..............................--VDEILRDI........DL..NG....D....GL....VDFEEFVRM
ENSBTAP00000021449  ..............................--ISEVVQEA........DI..NG....D....GT....VDFEEFVKM
ENSBTAP00000053176  ..............................----------........--..--....-....--....---------
ENSBTAP00000042361  ..............................--IEEIIRDV........DL..NG....D....GR....VDFEEFVRM
ENSBTAP00000016509  ..............................EVVDRIFLLV........DE..NG....D....GQ....LSLNEFVEG
ENSBTAP00000026714  ..............................--IEEIIRDV........DL..NG....D....GR....VDFEEFVRM
ENSBTAP00000004690  ..............................--TQVLVARY........-A..ND....S....LI....MEFDSFISC
ENSBTAP00000010858  ..............................----------........--..--....-....--....---------
ENSBTAP00000013117  ..............................--SLEIIHKY........EP..SKegqeK....GW....LSIDGFTNY
ENSBTAP00000017574  ..............................--ASEIIQKYepie....EV..KQ....A....HQ....MSFEGFRRY
ENSBTAP00000004885  ..............................--AELILQSI........DA..DG....T....MT....VDWNEWRDY
ENSBTAP00000008961  ..............................----------........--..--....-....--....---------
ENSBTAP00000028063  ..............................----------........--..--....-....--....---------
ENSBTAP00000012740  ..............................----------........--..--....-....--....---------
ENSBTAP00000006283  ..............................--LEEMLQEV........DL..NG....D....GT....VDFNEFVMM
ENSBTAP00000014306  ..............................--VEMLVAGH........-E..DS....N....GC....INYEELVRM
ENSBTAP00000053252  ..............................--CLDIIRRY........EL..SEegrqK....GF....LAIDGFTQY
ENSBTAP00000014304  ..............................--VEMLVAGH........-E..DS....N....GC....INYEAFVRH
ENSBTAP00000045669  ..............................----------........--..--....-....--....---------
ENSBTAP00000041264  ..............................----------........--..--....-....--....---------
ENSBTAP00000006711  ..............................----------........--..--....-....--....---------
ENSBTAP00000017358  ..............................----------........--..--....-....--....---------
ENSBTAP00000053274  ..............................----------........--..--....-....--....---------
ENSBTAP00000055296  ..............................----------........--..--....-....--....---------
ENSBTAP00000016852  ..............................QVFRKFLDNF........DSpyDK....D....GV....VTPEEFMNY
ENSBTAP00000036380  ..............................--VEDLFREA........GI..EP....N....GK....VKYDEFIQ-
ENSBTAP00000041719  ..............................--VESVLAGH........-E..DS....S....GC....INYEAFLKH
ENSBTAP00000049636  ..............................--VEALMAGQ........-E..DS....N....GC....INYEAFVKH
ENSBTAP00000024444  ..............................--IDQMFAAF........PP..DV....T....GN....LDYKNLVHI
ENSBTAP00000004556  ..............................----------........--..--....-....--....---------
ENSBTAP00000038767  ..............................SIADRTIQEA........DQ..DG....D....SA....ISFTEFVKV
ENSBTAP00000031285  ..............................--IRPFFNSC........DT..YK....D....GR....VSTAEWCFC
ENSBTAP00000011457  ..............................DLVEITLKKM........DH..DH....D....GK....LSFADYEQA
ENSBTAP00000011047  ..............................--VEKLMAGQ........-E..DS....N....GC....INYEAFVKH
ENSBTAP00000002564  ..............................----------........--..--....-....--....---------
ENSBTAP00000037104  ..............................--VKQMFAAF........PP..DV....C....GN....LDYRNLCYV
ENSBTAP00000002672  ..............................--VEQMFALT........PM..DL....A....GN....IDYKSLCYI
ENSBTAP00000028269  ..............................--IKNMWAAF........PP..DV....G....GN....VDYKNICYV
ENSBTAP00000016647  ..............................SIADRTVQEA........DE..DG....D....GA....VSFLEFAKS
ENSBTAP00000004536  ..............................--AEKILHSM........DR..DG....T....MT....IDWQEWRDH
ENSBTAP00000042177  ..............................--VKKFVEYC........DV..NN....D....KS....ISLQELMGC
ENSBTAP00000028063  ..............................----------........--..--....-....--....---------
ENSBTAP00000050283  ..............................--VEQLLAGQ........-E..DA....N....GC....INYEAFVKH