SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

EF-hand alignments in Bos taurus 76_3.1

These alignments are sequences aligned to the 0043035 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1qxpa2               dqiqanlpd.....................................................................
ENSBTAP00000019411  m.............................................................................
ENSBTAP00000036057  m.............................................................................
ENSBTAP00000038404  lrp...........................................................................
ENSBTAP00000010971  lrpeml........................................................................
ENSBTAP00000019803  ggggggggtamrilggvisaiseaaaqynpep..............................................
ENSBTAP00000014038  le............................................................................
ENSBTAP00000002055  ad............................................................................
ENSBTAP00000049731  ad............................................................................
ENSBTAP00000005577  mgkqnsklrpe...................................................................
ENSBTAP00000034949  lskeileelql...................................................................
ENSBTAP00000017447  vspmtclkkhwmklafmtntngkipvrsitrtfasgktekvifqalkelglpsgkndeiepaaft.............
ENSBTAP00000010858  hpkmtelyqsladlnnvrfsayrtamklrrlqkalcldllslsaacdaldqhnlkqndqpmdilqiinclttiydrle
ENSBTAP00000046644  srdaflekaytklklqvtpegriplkniyrlfsadrkrvetaleacslpssrndsipqedftpevyrvflnnl.....
ENSBTAP00000022814  mgkqnsklapevm.................................................................
ENSBTAP00000019758  ppcldseltefplrmrdwlknvlvtlyerdednnlltekqklrvkkihenekrleagdhpvellardfeknynmyifp
ENSBTAP00000019321  mgktnsklapevle................................................................
ENSBTAP00000011677  pqlepg........................................................................
ENSBTAP00000011680  ntd...........................................................................
ENSBTAP00000021742  rpegleqlqe....................................................................
ENSBTAP00000005348  pactdfevtqfplrmrdwlknilvqlyepnpehsgylnekqrnkvkkiyldekrllagdhsidlllrdfkknyhmyvy
ENSBTAP00000016609  srntflrkaytklklqvnqdgripvknilkmfsadkkrvetalescglnfn...........................
ENSBTAP00000012740  hpkmtelfqsladlnnvrfsayrtaikirrlqkalcldllelntt.................................
ENSBTAP00000018403  a.............................................................................
ENSBTAP00000026407  ast...........................................................................
ENSBTAP00000052557  p.............................................................................
ENSBTAP00000054167  rpealellea....................................................................
ENSBTAP00000010319  anmasttqrkrm..................................................................
ENSBTAP00000041545  erld..........................................................................
ENSBTAP00000055204  sf............................................................................
ENSBTAP00000003718  leqleaq.......................................................................
ENSBTAP00000011676  q.............................................................................
ENSBTAP00000049395  qklrhw........................................................................
ENSBTAP00000054983  lsal..........................................................................
ENSBTAP00000052219  dp............................................................................
ENSBTAP00000025402  srstfldkilvklkmqlnpegkipvknfqmfpadrkrveaalsachlp..............................
ENSBTAP00000011678  anlpdeqv......................................................................
ENSBTAP00000000433  ertfqrfavfgessssgte...........................................................
ENSBTAP00000021491  srpssdqwkkna..................................................................
ENSBTAP00000044733  se............................................................................
ENSBTAP00000010937  rth...........................................................................
ENSBTAP00000056439  rth...........................................................................
ENSBTAP00000055780  av............................................................................
ENSBTAP00000038002  maker.........................................................................
ENSBTAP00000034705  erldhw........................................................................
ENSBTAP00000035936  qqfsweeveengavg...............................................................
ENSBTAP00000013699  gv............................................................................
ENSBTAP00000002564  hpkmtelyqtlaadlnnikfsayrtamklrrvqkalrldl......................................
ENSBTAP00000011496  ykgfik........................................................................
ENSBTAP00000019111  ..............................................................................
ENSBTAP00000017036  elsst.........................................................................
ENSBTAP00000003213  rt............................................................................
ENSBTAP00000055444  rt............................................................................
ENSBTAP00000024550  p.............................................................................
ENSBTAP00000015248  ..............................................................................
ENSBTAP00000021328  ..............................................................................
ENSBTAP00000037091  ..............................................................................
ENSBTAP00000029967  e.............................................................................
ENSBTAP00000021449  giaekqre......................................................................
ENSBTAP00000053176  ekwahlspsefsqlqkyaeystkklkdvleefhgngvlakynpegkqdil............................
ENSBTAP00000042361  s.............................................................................
ENSBTAP00000016509  qqfsweeveengavg...............................................................
ENSBTAP00000026714  l.............................................................................
ENSBTAP00000004690  etd...........................................................................
ENSBTAP00000010858  hledk.........................................................................
ENSBTAP00000013117  nmrtswv.......................................................................
ENSBTAP00000017574  kwfllmvr......................................................................
ENSBTAP00000004885  ptaacq........................................................................
ENSBTAP00000008961  tfritkadaaefwrkaf.............................................................
ENSBTAP00000028063  emraqnfdvirlstyrtacklrfvqkrcnlhlvdiwnmieafrdnglnt.............................
ENSBTAP00000012740  leekyrylfkevagptemcdqrqlglllhdaiqiprqlgevaafggsniepsvrscfqqn..................
ENSBTAP00000006283  r.............................................................................
ENSBTAP00000014306  ..............................................................................
ENSBTAP00000053252  tprfm.........................................................................
ENSBTAP00000014304  ..............................................................................
ENSBTAP00000045669  qlfaemraqdldrirlstyrtacklrfvqkkcnlhlvdiwnviealrenalnnv........................
ENSBTAP00000041264  tyqltkvsahtfwrercgarcv........................................................
ENSBTAP00000006711  drwvsl........................................................................
ENSBTAP00000017358  fritkadaa.....................................................................
ENSBTAP00000053274  qlfaemraqdldrirlstyrtacklrfvqkkcnlhlvdiwnviealrenalnnv........................
ENSBTAP00000055296  fritkadaa.....................................................................
ENSBTAP00000016852  i.............................................................................
ENSBTAP00000036380  ..............................................................................
ENSBTAP00000041719  ..............................................................................
ENSBTAP00000049636  ..............................................................................
ENSBTAP00000024444  f.............................................................................
ENSBTAP00000004556  ctdkelrnlasr..................................................................
ENSBTAP00000038767  mgsrastllrdeeleeikk...........................................................
ENSBTAP00000031285  tctgqdladlgdrlrdwfqllhenskqngsansgaspasgldkslgasckd...........................
ENSBTAP00000011457  knckhfskfevkclinlfynlvgevterqgviig............................................
ENSBTAP00000011047  ..............................................................................
ENSBTAP00000002564  vkeklqylfsqvansgsqcdqrhlgvllheaiqvpr..........................................
ENSBTAP00000037104  ..............................................................................
ENSBTAP00000002672  f.............................................................................
ENSBTAP00000028269  ..............................................................................
ENSBTAP00000016647  shaaripdvds...................................................................
ENSBTAP00000004536  a.............................................................................
ENSBTAP00000042177  qgcpgakkrefltsvldalstdmvhavsdpsspgrlsepdpshtle................................
ENSBTAP00000028063  ml............................................................................
ENSBTAP00000050283  tyv...........................................................................
ENSBTAP00000048539  eftkisqn......................................................................
ENSBTAP00000045669  kimdk.........................................................................
ENSBTAP00000007972  i.............................................................................
ENSBTAP00000040815  pgcpegkklefitslldalttdmvqainsaaptgggrfsepdpshtlee.............................
ENSBTAP00000025661  eftkisr.......................................................................
ENSBTAP00000028350  kellaeyqdltfltkqeillahrrfcellpqehrsveeslqarvsleqi.............................
ENSBTAP00000053274  kimdk.........................................................................
ENSBTAP00000021537  mgnkqtvftheqleayqdctfftrkeimrlfyryqdlapqlvpldytscpdvkvpyeligsmp...............
ENSBTAP00000055481  pptaewavpqs...................................................................
ENSBTAP00000039155  ..............................................................................
ENSBTAP00000029333  pptaewavpqs...................................................................
ENSBTAP00000016315  stsypd........................................................................
ENSBTAP00000021091  ef............................................................................
ENSBTAP00000021618  lsraef........................................................................
ENSBTAP00000055520  alnsienstyrtafklrsvqtlcqldligssliqhvlrhqslweag................................
ENSBTAP00000055624  alnsienstyrtafklrsvqtlcqldligssliqhvlrhqslweag................................
ENSBTAP00000016319  ddp...........................................................................
ENSBTAP00000034078  h.............................................................................
ENSBTAP00000006645  mgqclryqmhwedleeyqaltfltrneilcihdsflklcppgkyykeatltvdqvss.....................
ENSBTAP00000021909  vrde..........................................................................
ENSBTAP00000001426  qqppylhlaelt..................................................................
ENSBTAP00000015802  elksifklsvfipsqefsty..........................................................
ENSBTAP00000032680  elksifklsvfipsqefsty..........................................................
ENSBTAP00000055007  ars...........................................................................
ENSBTAP00000020148  pte...........................................................................
ENSBTAP00000052345  wivspaek......................................................................
ENSBTAP00000029334  spktgtsewavpqps...............................................................
ENSBTAP00000052345  isgtsaaelp....................................................................
ENSBTAP00000056127  e.............................................................................
ENSBTAP00000012557  kt............................................................................
ENSBTAP00000011888  kwl...........................................................................
ENSBTAP00000017060  eahwavrveekakfdgifesllpv......................................................
ENSBTAP00000031854  eeedinqitd....................................................................
ENSBTAP00000031823  ard...........................................................................
ENSBTAP00000021603  lsraef........................................................................
ENSBTAP00000010838  sqle..........................................................................
ENSBTAP00000014575  liiqmpelren...................................................................
ENSBTAP00000011215  eeedinqitd....................................................................
ENSBTAP00000053698  la............................................................................
ENSBTAP00000006806  seleta........................................................................
ENSBTAP00000029334  gpn...........................................................................
ENSBTAP00000044105  hle...........................................................................
ENSBTAP00000026904  mptqleiamni...................................................................
ENSBTAP00000017060  ptvswvvpvadkmr................................................................
ENSBTAP00000055520  pltky.........................................................................
ENSBTAP00000044226  seleta........................................................................
ENSBTAP00000055624  pltky.........................................................................
ENSBTAP00000042182  ..............................................................................
ENSBTAP00000010796  lrkkvqgcwrellr................................................................
ENSBTAP00000021174  s.............................................................................
ENSBTAP00000006275  mselekavva....................................................................
ENSBTAP00000020950  k.............................................................................
ENSBTAP00000053738  rkkvqgcwrellre................................................................
ENSBTAP00000004963  vnsfk.........................................................................
ENSBTAP00000023774  ..............................................................................
ENSBTAP00000020395  le............................................................................
ENSBTAP00000020150  mpsqmeha......................................................................
ENSBTAP00000025561  plekal........................................................................
ENSBTAP00000053738  prrlkeff......................................................................
ENSBTAP00000034009  mtkl..........................................................................
ENSBTAP00000020539  dilv..........................................................................
ENSBTAP00000020778  t.............................................................................
ENSBTAP00000017461  rpr...........................................................................
ENSBTAP00000044096  msqme.........................................................................
ENSBTAP00000008523  msqme.........................................................................
ENSBTAP00000035196  hptgplyc......................................................................
ENSBTAP00000041997  rdkpmydeifytlspvdgkitg........................................................
ENSBTAP00000025499  mtdllhaedikkavgaftavdsf.......................................................
ENSBTAP00000055481  pfggsldiwa....................................................................
ENSBTAP00000002174  kdkptydeifytlspvngkitganak....................................................
ENSBTAP00000000589  spleqalavmvat.................................................................
ENSBTAP00000028239  tkdk..........................................................................
ENSBTAP00000014894  enq...........................................................................
ENSBTAP00000026544  v.............................................................................
ENSBTAP00000029333  pfggsldiwa....................................................................
ENSBTAP00000041966  sq............................................................................
ENSBTAP00000008933  akdkpvydelfytlspingkisginakkemvts.............................................
ENSBTAP00000056088  mtkl..........................................................................
ENSBTAP00000033794  tpveeslfqii...................................................................
ENSBTAP00000012786  etqi..........................................................................
ENSBTAP00000030018  enq...........................................................................
ENSBTAP00000040233  ..............................................................................
ENSBTAP00000003365  prskkfllteeeifymncraayltvfkssl................................................
ENSBTAP00000053176  vihlkdivc.....................................................................
ENSBTAP00000024301  rda...........................................................................
ENSBTAP00000022292  dp............................................................................
ENSBTAP00000015611  mtnllrsvvtvidtfyk.............................................................
ENSBTAP00000012770  eelskesqetnwf.................................................................
ENSBTAP00000000847  etplekaltt....................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000054975  pdtfepqkffqtsglakms...........................................................
ENSBTAP00000046639  khl...........................................................................
ENSBTAP00000052345  nply..........................................................................
ENSBTAP00000053164  hhlkkvnyq.....................................................................
ENSBTAP00000016774  mltdlecai.....................................................................
ENSBTAP00000022630  ks............................................................................
ENSBTAP00000010796  als...........................................................................
ENSBTAP00000021909  sfdydhdaflgaeeaktfdql.........................................................
ENSBTAP00000033974  m.............................................................................
ENSBTAP00000006711  vylkdvvcylsllesg..............................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000004912  ll............................................................................
ENSBTAP00000005979  hptaplydpeak..................................................................
ENSBTAP00000053738  als...........................................................................
ENSBTAP00000053746  pirskivraffdnrnlrkgtsglad.....................................................
ENSBTAP00000023221  kevweeadgldpndfd..............................................................
ENSBTAP00000019429  hp............................................................................
ENSBTAP00000052019  mtellnsilt....................................................................
ENSBTAP00000042244  qspsrrvf......................................................................
ENSBTAP00000053738  lkk...........................................................................
ENSBTAP00000018877  ytelekavvvlvenfykyvskhslvk....................................................
ENSBTAP00000053019  t.............................................................................
ENSBTAP00000003073  kevweeldgldpnrfnp.............................................................
ENSBTAP00000012886  sllps.........................................................................
ENSBTAP00000044222  slleqa........................................................................
ENSBTAP00000028499  aeplteleaaietv................................................................
ENSBTAP00000047378  yv............................................................................
ENSBTAP00000009308  s.............................................................................
ENSBTAP00000017060  plye..........................................................................
ENSBTAP00000050406  at............................................................................
ENSBTAP00000031879  at............................................................................
ENSBTAP00000031854  qtlsrieaafmdiedqkadvyemgkiakacgcplywkap.......................................
ENSBTAP00000001250  rllrglglkpekleqdldrhaesarmtqgrrvtlpefaaqlgv...................................
ENSBTAP00000026035  mpqllr........................................................................
ENSBTAP00000011215  tlsrieaafmdiedqkadvyemgkiakacgcplywkap........................................
ENSBTAP00000002128  algnvcetikklq.................................................................
ENSBTAP00000053194  ..............................................................................
ENSBTAP00000056127  ivd...........................................................................
ENSBTAP00000033188  wrkkymrw......................................................................
ENSBTAP00000053548  wrkkym........................................................................
ENSBTAP00000011687  l.............................................................................
ENSBTAP00000007636  cglisfsdyiflttvlstpq..........................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000009115  rklspsqm......................................................................
ENSBTAP00000023873  qpegldqlqaq...................................................................
ENSBTAP00000054471  mlrr..........................................................................
ENSBTAP00000039694  gkaelnfedfyrfmdnl.............................................................
ENSBTAP00000025205  mlrr..........................................................................
ENSBTAP00000047882  eaemspqel.....................................................................
ENSBTAP00000001368  eewtsaakpkldqaim..............................................................
ENSBTAP00000029786  tkrnvvrtivtetsfttdeleelyalfkaehltscywggnsnaldrhdpslpyleqy.....................
ENSBTAP00000028993  ..............................................................................
ENSBTAP00000023678  dpgvrdlealidtiqkqlkdr.........................................................
ENSBTAP00000034710  pl............................................................................
ENSBTAP00000031823  t.............................................................................
ENSBTAP00000038002  scyfsllegg....................................................................
ENSBTAP00000021074  qllrdilcv.....................................................................
ENSBTAP00000026544  g.............................................................................
ENSBTAP00000007217  ql............................................................................
ENSBTAP00000029792  akrsvvraipgdigfsieeledlymvfkakhlasqywgssrpaavrrdpslpyleqy.....................
ENSBTAP00000044088  dlgdkglisyteylflltiltkp.......................................................
ENSBTAP00000017319  sdlekaiataal..................................................................
ENSBTAP00000044100  nkhir.........................................................................
ENSBTAP00000033594  gkegkgkippe...................................................................
ENSBTAP00000026766  tptf..........................................................................
ENSBTAP00000055894  lcdqkysdeenlpek...............................................................
ENSBTAP00000015220  ah............................................................................
ENSBTAP00000033613  evsa..........................................................................
ENSBTAP00000056320  k.............................................................................
ENSBTAP00000025249  sdssmsfvefvelfksfsvrsrkdlkdlfdiyavpcdragseaaplytnltidenisglqpdldlltrnvsdlglfik
ENSBTAP00000029159  vspkpdpktis...................................................................
ENSBTAP00000044088  fgkrg.........................................................................
ENSBTAP00000016319  lt............................................................................
ENSBTAP00000017662  eraeehltm.....................................................................
ENSBTAP00000012479  plss..........................................................................
ENSBTAP00000029886  kgsnysei......................................................................
ENSBTAP00000027388  flddpkyssdedlps...............................................................
ENSBTAP00000039694  s.............................................................................
ENSBTAP00000023673  l.............................................................................
ENSBTAP00000041488  l.............................................................................
ENSBTAP00000001452  v.............................................................................
ENSBTAP00000028498  sdver.........................................................................
ENSBTAP00000001426  r.............................................................................
ENSBTAP00000020240  nvemilkffdmflklkd.............................................................
ENSBTAP00000053650  nvemilkffdmflklkd.............................................................
ENSBTAP00000041651  epehm.........................................................................
ENSBTAP00000005154  al............................................................................
ENSBTAP00000021174  nfllkfqgvkmcg.................................................................
ENSBTAP00000022068  eds...........................................................................
ENSBTAP00000026682  gdinfaeieeanrvlgpiyfttfvffmffillnmflaiindtysevksdlaqqkaemelsdlirkgyhkaliklklkk
ENSBTAP00000007636  hdvl..........................................................................
ENSBTAP00000027954  q.............................................................................
ENSBTAP00000020778  v.............................................................................
ENSBTAP00000013601  idta..........................................................................
ENSBTAP00000005477  e.............................................................................
ENSBTAP00000055305  nvemilkffdmflklkdltss.........................................................
ENSBTAP00000036054  nvemilkffdmflklkdltss.........................................................
ENSBTAP00000004912  q.............................................................................
ENSBTAP00000022292  nwd...........................................................................
ENSBTAP00000002717  sislrelktil...................................................................
ENSBTAP00000036015  el............................................................................
ENSBTAP00000051638  t.............................................................................
ENSBTAP00000026766  kglhfnnlivg...................................................................
ENSBTAP00000053738  eyfnfmghftkpqqvqeelkelqqs.....................................................
ENSBTAP00000016306  kqlkfeelqcd...................................................................
ENSBTAP00000013714  malvapeap.....................................................................
ENSBTAP00000036550  kqnvlrvvipevsvlpedleelydlfkrehmmscyweqprpmaprhdpsrpyaeqyr.....................
ENSBTAP00000053738  mtkdevieklksciqqqdp...........................................................
ENSBTAP00000023383  erw...........................................................................
ENSBTAP00000027030  wieeklqevced..................................................................
ENSBTAP00000053270  wieeklqevced..................................................................
ENSBTAP00000054640  wieeklqevced..................................................................
ENSBTAP00000012770  eelqnlwflldkhqtppmigeea.......................................................
ENSBTAP00000009967  ngtlt.........................................................................
ENSBTAP00000015183  lenqltpgdfvq..................................................................
ENSBTAP00000014222  hlrkeqvsdvqkvlqa..............................................................
ENSBTAP00000026288  phlf..........................................................................
ENSBTAP00000002128  ssvirydvfinrlwdlrffdc.........................................................
ENSBTAP00000003365  st............................................................................
ENSBTAP00000053738  sldeieta......................................................................
ENSBTAP00000009228  nvemilkffdmflklkdivgs.........................................................
ENSBTAP00000026785  get...........................................................................
ENSBTAP00000002578  sl............................................................................
ENSBTAP00000000106  pvslpg........................................................................
ENSBTAP00000028840  lhcrkik.......................................................................
ENSBTAP00000053594  gees..........................................................................
ENSBTAP00000055414  dpkgmipmvviqnvlyeffqnpdlqletcclpvdiadsmkprlnktefiqlislhiagfksetfekllkhlchcaaef
ENSBTAP00000026698  qs............................................................................
ENSBTAP00000017015  l.............................................................................
ENSBTAP00000049908  d.............................................................................
ENSBTAP00000021395  islnpsv.......................................................................
ENSBTAP00000007194  semefstlqdmpkelepsavlp........................................................
ENSBTAP00000025455  srirr.........................................................................


                                                                                                    
                                                                                                    
d1qxpa2               .............................................................................-
ENSBTAP00000019411  .............................................................................-
ENSBTAP00000036057  .............................................................................-
ENSBTAP00000038404  .............................................................................-
ENSBTAP00000010971  .............................................................................-
ENSBTAP00000019803  .............................................................................-
ENSBTAP00000014038  .............................................................................-
ENSBTAP00000002055  .............................................................................-
ENSBTAP00000049731  .............................................................................-
ENSBTAP00000005577  .............................................................................-
ENSBTAP00000034949  .............................................................................-
ENSBTAP00000017447  .............................................................................-
ENSBTAP00000010858  .............................................................qehnnlvnvplcvdmc-
ENSBTAP00000046644  .............................................................................-
ENSBTAP00000022814  .............................................................................-
ENSBTAP00000019758  .........................................................................vhwq-
ENSBTAP00000019321  .............................................................................-
ENSBTAP00000011677  .............................................................................-
ENSBTAP00000011680  .............................................................................-
ENSBTAP00000021742  .............................................................................-
ENSBTAP00000005348  ..........................................................................pvh-
ENSBTAP00000016609  .............................................................................-
ENSBTAP00000012740  .............................................................................-
ENSBTAP00000018403  .............................................................................-
ENSBTAP00000026407  .............................................................................-
ENSBTAP00000052557  .............................................................................-
ENSBTAP00000054167  .............................................................................-
ENSBTAP00000010319  .............................................................................-
ENSBTAP00000041545  .............................................................................-
ENSBTAP00000055204  .............................................................................-
ENSBTAP00000003718  .............................................................................-
ENSBTAP00000011676  .............................................................................-
ENSBTAP00000049395  .............................................................................-
ENSBTAP00000054983  .............................................................................-
ENSBTAP00000052219  .............................................................................-
ENSBTAP00000025402  .............................................................................-
ENSBTAP00000011678  .............................................................................-
ENSBTAP00000000433  .............................................................................-
ENSBTAP00000021491  .............................................................................-
ENSBTAP00000044733  .............................................................................-
ENSBTAP00000010937  .............................................................................-
ENSBTAP00000056439  .............................................................................-
ENSBTAP00000055780  .............................................................................-
ENSBTAP00000038002  .............................................................................-
ENSBTAP00000034705  .............................................................................-
ENSBTAP00000035936  .............................................................................-
ENSBTAP00000013699  .............................................................................-
ENSBTAP00000002564  .............................................................................-
ENSBTAP00000011496  .............................................................................-
ENSBTAP00000019111  .............................................................................-
ENSBTAP00000017036  .............................................................................-
ENSBTAP00000003213  .............................................................................-
ENSBTAP00000055444  .............................................................................-
ENSBTAP00000024550  .............................................................................-
ENSBTAP00000015248  .............................................................................-
ENSBTAP00000021328  .............................................................................-
ENSBTAP00000037091  .............................................................................-
ENSBTAP00000029967  .............................................................................-
ENSBTAP00000021449  .............................................................................-
ENSBTAP00000053176  .............................................................................-
ENSBTAP00000042361  .............................................................................-
ENSBTAP00000016509  .............................................................................-
ENSBTAP00000026714  .............................................................................-
ENSBTAP00000004690  .............................................................................-
ENSBTAP00000010858  .............................................................................-
ENSBTAP00000013117  .............................................................................-
ENSBTAP00000017574  .............................................................................-
ENSBTAP00000004885  .............................................................................-
ENSBTAP00000008961  .............................................................................-
ENSBTAP00000028063  .............................................................................-
ENSBTAP00000012740  .............................................................................-
ENSBTAP00000006283  .............................................................................-
ENSBTAP00000014306  .............................................................................-
ENSBTAP00000053252  .............................................................................-
ENSBTAP00000014304  .............................................................................-
ENSBTAP00000045669  .............................................................................-
ENSBTAP00000041264  .............................................................................-
ENSBTAP00000006711  .............................................................................-
ENSBTAP00000017358  .............................................................................-
ENSBTAP00000053274  .............................................................................-
ENSBTAP00000055296  .............................................................................-
ENSBTAP00000016852  .............................................................................-
ENSBTAP00000036380  .............................................................................-
ENSBTAP00000041719  .............................................................................-
ENSBTAP00000049636  .............................................................................-
ENSBTAP00000024444  .............................................................................-
ENSBTAP00000004556  .............................................................................-
ENSBTAP00000038767  .............................................................................-
ENSBTAP00000031285  .............................................................................-
ENSBTAP00000011457  .............................................................................-
ENSBTAP00000011047  .............................................................................-
ENSBTAP00000002564  .............................................................................-
ENSBTAP00000037104  .............................................................................-
ENSBTAP00000002672  .............................................................................-
ENSBTAP00000028269  .............................................................................-
ENSBTAP00000016647  .............................................................................-
ENSBTAP00000004536  .............................................................................-
ENSBTAP00000042177  .............................................................................-
ENSBTAP00000028063  .............................................................................-
ENSBTAP00000050283  .............................................................................-
ENSBTAP00000048539  .............................................................................-
ENSBTAP00000045669  .............................................................................-
ENSBTAP00000007972  .............................................................................-
ENSBTAP00000040815  .............................................................................-
ENSBTAP00000025661  .............................................................................-
ENSBTAP00000028350  .............................................................................-
ENSBTAP00000053274  .............................................................................-
ENSBTAP00000021537  .............................................................................-
ENSBTAP00000055481  .............................................................................-
ENSBTAP00000039155  .............................................................................-
ENSBTAP00000029333  .............................................................................-
ENSBTAP00000016315  .............................................................................-
ENSBTAP00000021091  .............................................................................-
ENSBTAP00000021618  .............................................................................-
ENSBTAP00000055520  .............................................................................-
ENSBTAP00000055624  .............................................................................-
ENSBTAP00000016319  .............................................................................-
ENSBTAP00000034078  .............................................................................-
ENSBTAP00000006645  .............................................................................-
ENSBTAP00000021909  .............................................................................-
ENSBTAP00000001426  .............................................................................-
ENSBTAP00000015802  .............................................................................-
ENSBTAP00000032680  .............................................................................-
ENSBTAP00000055007  .............................................................................-
ENSBTAP00000020148  .............................................................................-
ENSBTAP00000052345  .............................................................................-
ENSBTAP00000029334  .............................................................................-
ENSBTAP00000052345  .............................................................................-
ENSBTAP00000056127  .............................................................................-
ENSBTAP00000012557  .............................................................................-
ENSBTAP00000011888  .............................................................................-
ENSBTAP00000017060  .............................................................................-
ENSBTAP00000031854  .............................................................................-
ENSBTAP00000031823  .............................................................................-
ENSBTAP00000021603  .............................................................................-
ENSBTAP00000010838  .............................................................................-
ENSBTAP00000014575  .............................................................................-
ENSBTAP00000011215  .............................................................................-
ENSBTAP00000053698  .............................................................................-
ENSBTAP00000006806  .............................................................................-
ENSBTAP00000029334  .............................................................................-
ENSBTAP00000044105  .............................................................................-
ENSBTAP00000026904  .............................................................................-
ENSBTAP00000017060  .............................................................................-
ENSBTAP00000055520  .............................................................................-
ENSBTAP00000044226  .............................................................................-
ENSBTAP00000055624  .............................................................................-
ENSBTAP00000042182  .............................................................................-
ENSBTAP00000010796  .............................................................................-
ENSBTAP00000021174  .............................................................................-
ENSBTAP00000006275  .............................................................................-
ENSBTAP00000020950  .............................................................................-
ENSBTAP00000053738  .............................................................................-
ENSBTAP00000004963  .............................................................................-
ENSBTAP00000023774  .............................................................................-
ENSBTAP00000020395  .............................................................................-
ENSBTAP00000020150  .............................................................................-
ENSBTAP00000025561  .............................................................................-
ENSBTAP00000053738  .............................................................................-
ENSBTAP00000034009  .............................................................................-
ENSBTAP00000020539  .............................................................................-
ENSBTAP00000020778  .............................................................................-
ENSBTAP00000017461  .............................................................................-
ENSBTAP00000044096  .............................................................................-
ENSBTAP00000008523  .............................................................................-
ENSBTAP00000035196  .............................................................................-
ENSBTAP00000041997  .............................................................................-
ENSBTAP00000025499  .............................................................................-
ENSBTAP00000055481  .............................................................................-
ENSBTAP00000002174  .............................................................................-
ENSBTAP00000000589  .............................................................................-
ENSBTAP00000028239  .............................................................................-
ENSBTAP00000014894  .............................................................................-
ENSBTAP00000026544  .............................................................................-
ENSBTAP00000029333  .............................................................................-
ENSBTAP00000041966  .............................................................................-
ENSBTAP00000008933  .............................................................................-
ENSBTAP00000056088  .............................................................................-
ENSBTAP00000033794  .............................................................................-
ENSBTAP00000012786  .............................................................................-
ENSBTAP00000030018  .............................................................................-
ENSBTAP00000040233  .............................................................................-
ENSBTAP00000003365  .............................................................................-
ENSBTAP00000053176  .............................................................................-
ENSBTAP00000024301  .............................................................................-
ENSBTAP00000022292  .............................................................................-
ENSBTAP00000015611  .............................................................................-
ENSBTAP00000012770  .............................................................................-
ENSBTAP00000000847  .............................................................................-
ENSBTAP00000053738  .............................................................................-
ENSBTAP00000054975  .............................................................................-
ENSBTAP00000046639  .............................................................................-
ENSBTAP00000052345  .............................................................................-
ENSBTAP00000053164  .............................................................................-
ENSBTAP00000016774  .............................................................................-
ENSBTAP00000022630  .............................................................................-
ENSBTAP00000010796  .............................................................................-
ENSBTAP00000021909  .............................................................................-
ENSBTAP00000033974  .............................................................................-
ENSBTAP00000006711  .............................................................................-
ENSBTAP00000010796  .............................................................................-
ENSBTAP00000004912  .............................................................................-
ENSBTAP00000005979  .............................................................................-
ENSBTAP00000053738  .............................................................................-
ENSBTAP00000053746  .............................................................................-
ENSBTAP00000023221  .............................................................................-
ENSBTAP00000019429  .............................................................................-
ENSBTAP00000052019  .............................................................................-
ENSBTAP00000042244  .............................................................................-
ENSBTAP00000053738  .............................................................................-
ENSBTAP00000018877  .............................................................................-
ENSBTAP00000053019  .............................................................................-
ENSBTAP00000003073  .............................................................................-
ENSBTAP00000012886  .............................................................................-
ENSBTAP00000044222  .............................................................................-
ENSBTAP00000028499  .............................................................................-
ENSBTAP00000047378  .............................................................................-
ENSBTAP00000009308  .............................................................................-
ENSBTAP00000017060  .............................................................................-
ENSBTAP00000050406  .............................................................................-
ENSBTAP00000031879  .............................................................................-
ENSBTAP00000031854  .............................................................................-
ENSBTAP00000001250  .............................................................................-
ENSBTAP00000026035  .............................................................................-
ENSBTAP00000011215  .............................................................................-
ENSBTAP00000002128  .............................................................................-
ENSBTAP00000053194  .............................................................................-
ENSBTAP00000056127  .............................................................................-
ENSBTAP00000033188  .............................................................................-
ENSBTAP00000053548  .............................................................................-
ENSBTAP00000011687  .............................................................................-
ENSBTAP00000007636  .............................................................................-
ENSBTAP00000020950  .............................................................................-
ENSBTAP00000009115  .............................................................................-
ENSBTAP00000023873  .............................................................................-
ENSBTAP00000054471  .............................................................................-
ENSBTAP00000039694  .............................................................................-
ENSBTAP00000025205  .............................................................................-
ENSBTAP00000047882  .............................................................................-
ENSBTAP00000001368  .............................................................................-
ENSBTAP00000029786  .............................................................................-
ENSBTAP00000028993  .............................................................................-
ENSBTAP00000023678  .............................................................................-
ENSBTAP00000034710  .............................................................................-
ENSBTAP00000031823  .............................................................................-
ENSBTAP00000038002  .............................................................................-
ENSBTAP00000021074  .............................................................................-
ENSBTAP00000026544  .............................................................................-
ENSBTAP00000007217  .............................................................................-
ENSBTAP00000029792  .............................................................................-
ENSBTAP00000044088  .............................................................................-
ENSBTAP00000017319  .............................................................................-
ENSBTAP00000044100  .............................................................................-
ENSBTAP00000033594  .............................................................................-
ENSBTAP00000026766  .............................................................................-
ENSBTAP00000055894  .............................................................................-
ENSBTAP00000015220  .............................................................................-
ENSBTAP00000033613  .............................................................................-
ENSBTAP00000056320  .............................................................................-
ENSBTAP00000025249  ........................................skqqlsdnqrqisdaiaaasivtngtgvestslgvfg-
ENSBTAP00000029159  .............................................................................-
ENSBTAP00000044088  .............................................................................-
ENSBTAP00000016319  .............................................................................-
ENSBTAP00000017662  .............................................................................-
ENSBTAP00000012479  .............................................................................-
ENSBTAP00000029886  .............................................................................-
ENSBTAP00000027388  .............................................................................-
ENSBTAP00000039694  .............................................................................-
ENSBTAP00000023673  .............................................................................-
ENSBTAP00000041488  .............................................................................-
ENSBTAP00000001452  .............................................................................-
ENSBTAP00000028498  .............................................................................-
ENSBTAP00000001426  .............................................................................-
ENSBTAP00000020240  .............................................................................-
ENSBTAP00000053650  .............................................................................-
ENSBTAP00000041651  .............................................................................-
ENSBTAP00000005154  .............................................................................-
ENSBTAP00000021174  .............................................................................-
ENSBTAP00000022068  .............................................................................-
ENSBTAP00000026682  ...................................................................ntvddisesl-
ENSBTAP00000007636  .............................................................................-
ENSBTAP00000027954  .............................................................................-
ENSBTAP00000020778  .............................................................................-
ENSBTAP00000013601  .............................................................................-
ENSBTAP00000005477  .............................................................................-
ENSBTAP00000055305  .............................................................................-
ENSBTAP00000036054  .............................................................................-
ENSBTAP00000004912  .............................................................................-
ENSBTAP00000022292  .............................................................................-
ENSBTAP00000002717  .............................................................................-
ENSBTAP00000036015  .............................................................................-
ENSBTAP00000051638  .............................................................................-
ENSBTAP00000026766  .............................................................................-
ENSBTAP00000053738  .............................................................................-
ENSBTAP00000016306  .............................................................................-
ENSBTAP00000013714  .............................................................................-
ENSBTAP00000036550  .............................................................................-
ENSBTAP00000053738  .............................................................................-
ENSBTAP00000023383  .............................................................................-
ENSBTAP00000027030  .............................................................................-
ENSBTAP00000053270  .............................................................................-
ENSBTAP00000054640  .............................................................................-
ENSBTAP00000012770  .............................................................................-
ENSBTAP00000009967  .............................................................................-
ENSBTAP00000015183  .............................................................................-
ENSBTAP00000014222  .............................................................................-
ENSBTAP00000026288  .............................................................................-
ENSBTAP00000002128  .............................................................................-
ENSBTAP00000003365  .............................................................................-
ENSBTAP00000053738  .............................................................................-
ENSBTAP00000009228  .............................................................................-
ENSBTAP00000026785  .............................................................................-
ENSBTAP00000002578  .............................................................................-
ENSBTAP00000000106  .............................................................................-
ENSBTAP00000028840  .............................................................................-
ENSBTAP00000053594  .............................................................................-
ENSBTAP00000055414  reviktdmrrqmfadlflhcdrgkvgfldrqrtlalletfydqsskvlrgtlrnprqwpfvefgeidlpefwgdmdn-
ENSBTAP00000026698  .............................................................................-
ENSBTAP00000017015  .............................................................................-
ENSBTAP00000049908  .............................................................................-
ENSBTAP00000021395  .............................................................................-
ENSBTAP00000007194  .............................................................................-
ENSBTAP00000025455  .............................................................................-


                             10         20        30                      40                        
                              |          |         |                       |                        
d1qxpa2               --------EKVLSEEEID.DNFKTLFSKLA....GDDM......EISVK....ELQ.........TIL..........
ENSBTAP00000019411  ---------ADQLTEEQI.AEFKEAFSLFDk...DGDG......TITTK....ELG.........TVM..........
ENSBTAP00000036057  ---------ADQLTEEQI.AEFKEAFSLFDk...DGDG......TITTK....ELG.........TVM..........
ENSBTAP00000038404  -EVMQDLLESTDFTEHEI.QEWYKGFLR-D....CPSG......HLSME....EFK.........KIY..........
ENSBTAP00000010971  ----QDLRENTEFSELEL.QEWYKGFLK-D....CPTG......ILNVD....EFK.........KIY..........
ENSBTAP00000019803  VPPRTHYSNIEANESEEV.RQFRRLFAQLA....GDDM......EVSAT....ELM.........NIL..........
ENSBTAP00000014038  --------MCSHFDADEI.KRLGKRFKKLDl...DNSG......SLSVE....EFM.........SL-..........
ENSBTAP00000002055  -----------QLTEEQI.AEFKEAFSLFDk...DGDG......TITTK....ELG.........TVM..........
ENSBTAP00000049731  -----------QLTEEQI.AEFQEAFSLFDk...DGDG......TITTK....ELG.........TVM..........
ENSBTAP00000005577  --VLQDLRENTEFTDHEL.QEWYKGFLK-D....CPTG......HLTVD....EFK.........KIY..........
ENSBTAP00000034949  ---------NTKFTEEEL.SSWYQSFLK-E....CPSG......RITRQ....EFQ.........TIY..........
ENSBTAP00000017447  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000010858  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000046644  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000022814  ----EDLVKSTEFNEHEL.KQWYKGFLK-D....CPSG......RLNLE....EFQ.........QLY..........
ENSBTAP00000019758  ------------------.------FGQLDqh..PIDG......YLSHT....ELA.........PLR..........
ENSBTAP00000019321  -----DLVQNTEFSEQEL.KQWYKGFLK-D....CPSG......ILNLE....EFQ.........QLY..........
ENSBTAP00000011677  ---------NTDQESEEQ.RQFRNIFRQIA....GDDM......EICAD....ELK.........NVL..........
ENSBTAP00000011680  ------------QESEEQ.RQFRNIFRQIA....GDDM......EICAD....ELK.........NVL..........
ENSBTAP00000021742  ------------QTKFTR.KELQVLYRGFKne..CPSG......IVNEE....NFK.........QIY..........
ENSBTAP00000005348  ------------------.----WQFSELDqh..PRDR......VLTHS....ELA.........PLR..........
ENSBTAP00000016609  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000012740  ------------------.---NEVFEQHKln..QNDQ......LLSVP....DVI.........NCL..........
ENSBTAP00000018403  ----------EKLSEEQV.AEFKEAFDRFDk...NKDG......TISVQ....ELG.........TVM..........
ENSBTAP00000026407  ----------------DV.AGLEESFRKFAi...HGDP......KASGH....EMNgknwaklckDCK..........
ENSBTAP00000052557  -----------ELTEEQK.QEVREAFDLFDa...DGSG......TIDVK....ELK.........VAM..........
ENSBTAP00000054167  ------------QSKFTK.KELQILYRGFKne..CPSG......VVNED....TFK.........EIY..........
ENSBTAP00000010319  -------SPKPELTEEQK.QEIREAFDLFDa...DGTG......TIDVK....ELK.........VAM..........
ENSBTAP00000041545  ------------------.QWLSDWFQRGDk...NQDG......RMSFG....EVQ.........RLL..........
ENSBTAP00000055204  ------------------.--LWNVFQRVDk...DRSG......VISDN....ELQ.........QAL..........
ENSBTAP00000003718  ----------TNFTKREL.QVLYRGFK--Ne...CPSG......VVNEE....TFK.........QIY..........
ENSBTAP00000011676  ----------------ED.GQLRSLFEKFA....GKDS......EIRAN....ELR.........TAL..........
ENSBTAP00000049395  ------------------.--IHSCLRKADk...NKDN......KMSFK....ELQ.........NFL..........
ENSBTAP00000054983  ------------------.---EEAFRKFAv...HGDA......RASGR....---.........---..........
ENSBTAP00000052219  ------------------.--LYGYFAAVA....GQDG......QIDAD....ELQ.........RCL..........
ENSBTAP00000025402  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000011678  ------------LSEEEIdENFKSLFRQLA....GEDM......EISVK....ELR.........TIL..........
ENSBTAP00000000433  ------------------.-----------....----......-MNNK....NFS.........KLC..........
ENSBTAP00000021491  --------AKIELNETQK.QEIKEAFDLFDv...DGSG......TIDVK....ELK.........IAM..........
ENSBTAP00000044733  --------------DDID.DGFRRLFAQLA....GEDA......EISAF....ELQ.........TIL..........
ENSBTAP00000010937  -----------------D.QWVKQTFEEADk...NGDG......LLNIE....EIH.........QLM..........
ENSBTAP00000056439  -----------------D.QWVKQTFEEADk...NGDG......LLNIE....EIH.........QLM..........
ENSBTAP00000055780  ----------EQLTEEQK.NEFKAAFDIFVlg..AEDG......CISTK....ELG.........KVM..........
ENSBTAP00000038002  ------------------.-----------....---G......LISPS....DFA.........QLQ..........
ENSBTAP00000034705  ------------------.--IHSYLHRADs...NQDS......KMSFK....EIK.........NLL..........
ENSBTAP00000035936  --------------AADA.AQLQEWYKKFLee..CPSG......TLFMH....EFK.........RFF..........
ENSBTAP00000013699  -------------PPNVD.PEAYSWFQSVDs...DHSG......YISIK....ELK.........QAL..........
ENSBTAP00000002564  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000011496  ------------------.----------D....CPSG......QLDAA....GFQ.........KIY..........
ENSBTAP00000019111  ------------LSEEQK.QEIKDAFELFDt...DKDE......AIDYH....ELK.........VAM..........
ENSBTAP00000017036  ------------------.-ECHQWYKKFMte..CPSG......QLTLY....EFR.........QFF..........
ENSBTAP00000003213  ----------------RD.QWLKQTFDEADk...NGDG......SLSIG....EVL.........QLL..........
ENSBTAP00000055444  ----------------RD.QWLKQTFDEADk...NGDG......SLSIG....EVL.........QLL..........
ENSBTAP00000024550  ------------------.--MWKCFLAIA....GQDG......EVDAE....ELQ.........KCL..........
ENSBTAP00000015248  ------------FDQSQI.QEFKEAFNMIDq...NRDG......FIDKE....DLH.........DML..........
ENSBTAP00000021328  ------------FDQSQI.QEFKEAFNMIDq...NRDG......FIDKE....DLH.........DML..........
ENSBTAP00000037091  ------------FDQSQI.QEFKEAFNMIDq...NRDG......FIDKE....DLH.........DML..........
ENSBTAP00000029967  ------------LRPEEI.EELQAAFQEFDr...DRDG......YIGYQ....ELG.........ACM..........
ENSBTAP00000021449  ----------RPLGPDEI.EELREAFLEFDk...DRDG......FISCK....DLG.........NLM..........
ENSBTAP00000053176  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000042361  ------------LRPEEI.EELREAFREFDk...DKDG......YINCR....DLG.........NCM..........
ENSBTAP00000016509  --------------AADA.AQLQEWYKKFLee..CPSG......TLFMH....EFK.........RFF..........
ENSBTAP00000026714  -------------RPEEI.EELREAFREFDk...DKDG......YINCR....DLG.........NCM..........
ENSBTAP00000004690  ----------------ID.QDFVRLFHIVAg...GEGK......EIGMY....ELQ.........KLL..........
ENSBTAP00000010858  ------------------.--YRYLFKQVA....SSTG......FCDQR....RLG.........LLL..........
ENSBTAP00000013117  ------------------.---SQMFSEIDv...DDLG......HITLC....SAV.........QCI..........
ENSBTAP00000017574  ------------------.----------Dd...FKGG......KITLE....KAL.........KLL..........
ENSBTAP00000004885  -------------DVEPP.TRYETLFQKLDr...NGDG......VVDIS....ELQ.........EGL..........
ENSBTAP00000008961  ------------------.-----------....GEKT......IVPWK....SFR.........QAL..........
ENSBTAP00000028063  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000012740  ------------------.-----------....NNKP......EISVK....EFI.........DWM..........
ENSBTAP00000006283  -----------ELGPEEL.DELQAAFEEFDt...DHDG......YIGYR....DLG.........ECM..........
ENSBTAP00000014306  ------------FTEDQT.AEFKEAFQLFDr...TGDG......KILYS....QCG.........DVM..........
ENSBTAP00000053252  ------------------.-WLKTVFEAADi...DGNG......IMLED....TSV.........ELI..........
ENSBTAP00000014304  ------------FTEDQT.AEFKEAFQLFDr...TGDG......KILYS....QCG.........DVM..........
ENSBTAP00000045669  ------------------.-----------....DPNM......ELNVA....RLE.........AVL..........
ENSBTAP00000041264  ------------------.-----------....----......-LPWA....EFE.........AVL..........
ENSBTAP00000006711  ------------------.-----------....----......--TPE....EFG.........QL-..........
ENSBTAP00000017358  ------------------.----EFWRKFF....GDKT......IVPWK....VFR.........QCL..........
ENSBTAP00000053274  ------------------.-----------....DPNM......ELNVA....RLE.........AVL..........
ENSBTAP00000055296  ------------------.----EFWRKFF....GDKT......IVPWK....VFR.........QCL..........
ENSBTAP00000016852  ------------------.KGLGRVFRIMDd...NNNR......TLDFK....EFV.........KGL..........
ENSBTAP00000036380  ------------LSQDQI.NEYKECFSLYDk...QQRG......KIKAT....DLL.........TVM..........
ENSBTAP00000041719  ------------FNKDQL.EEFKEAFELYDr...VGDG......KIQFS....QCG.........DVM..........
ENSBTAP00000049636  ------------FSKQQQ.DEFKEAFLLFDr...TGEC......KITLS....QVG.........DVL..........
ENSBTAP00000024444  -------------EQTQI.QEFKEAFTIMDq...NRDG......FIDKN....DLR.........DTF..........
ENSBTAP00000004556  ------------------.--LKDWFGALHe...DANR......VINPT....SSE.........TAQ..........
ENSBTAP00000038767  ---------ETGFSHSQI.TRLYSRFTSLDk...GENG......TLSRE....DFQ.........RI-..........
ENSBTAP00000031285  ------------------.-SIGWMFSKLDt...SADL......FLDQT....ELA.........AI-..........
ENSBTAP00000011457  ------------------.-----------....----......-LDRN....AFR.........NIL..........
ENSBTAP00000011047  ------------FTPEQI.EEFKEAFTLFDrtp.KCEM......KITYG....QCG.........DVL..........
ENSBTAP00000002564  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000037104  ------------FDQSQI.QEFKEAFTIMDq...NRDG......FIDKE....DLR.........DTF..........
ENSBTAP00000002672  -------------EQAQI.QEFKEAFSCIDq...NRDG......IICKS....DLR.........ETY..........
ENSBTAP00000028269  ------------FDQTQI.QEFKEAFTVIDq...NRDG......IIDKE....DLR.........DTF..........
ENSBTAP00000016647  ------LRQETGFSQASL.RRLYDRFNALDr...TGKG......YLSRM....DLQ.........QIG..........
ENSBTAP00000004536  ---------------ERR.QRWGRLFEELDs...NKDG......RVDIR....ELR.........QGL..........
ENSBTAP00000042177  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000028063  ------------------.DKLRYVFSQMS....DSNG......LMIFS....KFD.........QFL..........
ENSBTAP00000050283  ------------------.TEFKEAFSLFDr...TPTGel....KIAYG....QCG.........DVL..........
ENSBTAP00000048539  ----------LKLDWDNI.HQCLDKYAEIAva..SKGG......KIGIE....EFA.........NYL..........
ENSBTAP00000045669  ------------------.--LRYIFSMIS....DSSG......VMVYG....RYD.........QFL..........
ENSBTAP00000007972  ------------------.QGVARFFRRLDq...DGSR......SLDVR....ELQ.........RGL..........
ENSBTAP00000040815  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000025661  ---------KLKLDWDGI.RKHLDEYAAIAss..SKGG......RIGIE....EFA.........EYL..........
ENSBTAP00000028350  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000053274  ------------------.--LRYIFSMIS....DSSG......VMVYG....RYD.........QFL..........
ENSBTAP00000021537  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000055481  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000039155  ------------------.----EAFSLFHs...DSNS......TIPMQ....ELG.........TVL..........
ENSBTAP00000029333  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000016315  --------EPWRITEEQR.EYYVNQFRSLQp...DPSS......FISGS....VAK.........NFF..........
ENSBTAP00000021091  ------------------.------FTKLF....EKYP......EINAI....QLQ.........NIL..........
ENSBTAP00000021618  ------------------.-----------....----......-----....---.........--A..........
ENSBTAP00000055520  ------------------.-----------....--ES......TLSVQ....QLF.........QAL..........
ENSBTAP00000055624  ------------------.-----------....--ES......TLSVQ....QLF.........QAL..........
ENSBTAP00000016319  ----------WKITDEQR.QYYVNQFKTIQp...DLNG......FIPGS....AAK.........EFF..........
ENSBTAP00000034078  ------------------.KKIKEAFEVFDh...ESNN......TVDVR....EVG.........TII..........
ENSBTAP00000006645  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000021909  ------------------.----RRFKMADk...DGDL......IATKE....EFT.........AFL..........
ENSBTAP00000001426  -----------------A.TQFLEIWKHFDa...DGNG......YIEGK....ELE.........NFF..........
ENSBTAP00000015802  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000032680  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000055007  -----------YLSEEMI.AEFKAAFDMFDa...DGGG......DISVK....ELG.........TVM..........
ENSBTAP00000020148  -------------TERCI.ESLIAVFQKHAgrd.GNNS......KLSKA....EFL.........IFM..........
ENSBTAP00000052345  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000029334  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000052345  ----------WAVKPEDK.AKYDAIFDSLC....PVNG......FLSGD....KVK.........PVL..........
ENSBTAP00000056127  ------------------.----RRFKAADl...DSDQ......TATRE....EFT.........AFL..........
ENSBTAP00000012557  ------------------.-DLIRAFQLQDr...NKSG......KLSMG....QWA.........FSM..........
ENSBTAP00000011888  ------------------.QWVTHQFKTIA....GEDG......EINLQ....DFK.........KAL..........
ENSBTAP00000017060  ------------------.-----------....--NG......LLSGD....KVK.........PVL..........
ENSBTAP00000031854  -----------YFSYEHF.YVIYCKFWELDs...DHDL......YISQA....DLS.........RYN..........
ENSBTAP00000031823  ------------------.---ERRFRVADq...DGDS......MATRE....ELT.........AFL..........
ENSBTAP00000021603  ------------------.-----------....----......-----....---.........--A..........
ENSBTAP00000010838  ---------------QAI.TDLINLFHKYS....GSDD......TIEKE....DLL.........RLM..........
ENSBTAP00000014575  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000011215  -----------YFSYEHF.YVIYCKFWELDs...DHDL......YISQA....DLS.........RYN..........
ENSBTAP00000053698  -----------NISVEEL.DEIREAFRVLDr...DGNG......FISKQ....ELG.........MAM..........
ENSBTAP00000006806  -----------------M.ETLINVFHAHSgk..EGDKy.....KLSKK....ELK.........ELL..........
ENSBTAP00000029334  ---------MWAITSEER.TKHDKQFDNLK....PSGG......YITGD....QAR.........TFF..........
ENSBTAP00000044105  ---------------QAI.TDLINLFHKYS....GSDD......TIEKE....DLL.........RLM..........
ENSBTAP00000026904  ------------------.--MIRTFHRYScr..EGDRf.....KLNKG....ELK.........MLL..........
ENSBTAP00000017060  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000055520  ------------------.---TALFQLYAe...NNRGghdlgaRMTRR....VLR.........N--..........
ENSBTAP00000044226  -----------------M.ETLINVFHAHSgk..EGDKy.....KLSKK....ELK.........ELL..........
ENSBTAP00000055624  ------------------.---TALFQLYAe...NNRGghdlgaRMTRR....VLR.........N--..........
ENSBTAP00000042182  ------------------.-ELQQLFQELA....GEEE......ELGAP....QLQ.........ILL..........
ENSBTAP00000010796  ------------------.-----ECKERDf...NKQG......EIPGP....EFL.........ALV..........
ENSBTAP00000021174  ------------------.-QFFEIWLHFDa...DGSG......YLEGK....ELQ.........NLI..........
ENSBTAP00000006275  ------------------.--LIDVFHQYSgre.GDKH......KLKKS....ELK.........ELI..........
ENSBTAP00000020950  ------------------.----KRFEKANq...DSGP......GLNLE....EFI.........AFE..........
ENSBTAP00000053738  ------------------.------CKERDf...NKQG......EIPGP....EFL.........ALV..........
ENSBTAP00000004963  --------------KSEI.ECLIRIFHNVVg...RGDVklanv.GLDRN....TFR.........VIL..........
ENSBTAP00000023774  ------------------.-EIREAFKVFDr...DGNG......FISKQ....ELG.........TAM..........
ENSBTAP00000020395  --QQIQARNTTGVTEEAL.KEFSMMFKHFDk...DKSG......RLNHQ....EFK.........SCL..........
ENSBTAP00000020150  -----------------M.ETMMFTFHKFA....GDKG......YLTKE....DLR.........VLM..........
ENSBTAP00000025561  ------------------.DVMVSTFHKYSgk..EGDKf.....KLNKS....ELK.........ELL..........
ENSBTAP00000053738  ------------------.RDPYAAFFKMDt...DRDG......ILTMH....DLH.........RLL..........
ENSBTAP00000034009  --------------EDHL.EGIINIFHQYSvrv.GHFD......TLNKR....ELK.........QLI..........
ENSBTAP00000020539  ------------------.-----EFKKHDk...DETG......LIALS....DWA.........AAV..........
ENSBTAP00000020778  --------------QEVL.ENLKDRWYQADnp..PPDL......LLTES....EFL.........SFL..........
ENSBTAP00000017461  ---------TWEASPPEH.KKWVEVFKACDe...DNKG......YLSRE....DFK.........VAV..........
ENSBTAP00000044096  ---------------SSI.ETIINIFHQYSvrl.GHYD......TLIQK....EFK.........QLV..........
ENSBTAP00000008523  ---------------SSI.ETIINIFHQYSvrl.GHYD......TLIQK....EFK.........QLV..........
ENSBTAP00000035196  -------PEEKEMKPACI.KALTRIFKISDq...DNDG......TLNDA....ELN.........FFQ..........
ENSBTAP00000041997  ------------------.-----------....----......----A....NAK.........KEM..........
ENSBTAP00000025499  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000055481  ------------ITVEER.AKHDQQFHSLK....PISG......FITGN....WIE.........KLF..........
ENSBTAP00000002174  ------------------.-----------....----......-----....---.........KEM..........
ENSBTAP00000000589  ------------------.------FHKYSgq..EGDKf.....KLSKG....EMK.........ELL..........
ENSBTAP00000028239  ------------------.SKYDEIFYNLA....PADG......KLSGT....KAK.........TWM..........
ENSBTAP00000014894  ----ILTRDAKGISQEQM.QEFRASFNHFDk...DHGG......ALGPE....EFK.........ACL..........
ENSBTAP00000026544  ------------------.-EFMRIWRKYDa...DSSG......FISAA....ELC.........NFL..........
ENSBTAP00000029333  ------------ITVEER.AKHDQQFHSLK....PISG......FITGN....WIE.........KLF..........
ENSBTAP00000041966  ------------------.---QSIFYKYA....QQGL......DIDAT....QLQ.........SLL..........
ENSBTAP00000008933  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000056088  --------------EDHL.EGIINIFHQYSvrv.GHFD......TLNKR....ELK.........QLI..........
ENSBTAP00000033794  ------------------.----HCYHEYAare.GDAE......TLSLE....ELK.........ALL..........
ENSBTAP00000012786  -----LTRDAKGITQEQM.NEFRASFNHFDr...RKNG......LMDHE....DFR.........ACL..........
ENSBTAP00000030018  ----VLTRDAKGLSQEQL.NEFRASFNHFDr...KRNG......MMEPD....DFR.........ACL..........
ENSBTAP00000040233  ------------------.DELKRAFHLLDt...ANNM......TVTKS....ELR.........RVI..........
ENSBTAP00000003365  ------------------.-----------....--DN......IISKD....QLY.........LAL..........
ENSBTAP00000053176  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000024301  ----------KGISQEQM.NEFRASFNHFDr...DHSG......TLGPE....EFK.........ACL..........
ENSBTAP00000022292  ------------------.QELRNIFLQYAstevDGEH......YMTPE....DFV.........QRY..........
ENSBTAP00000015611  ------------------.------YTKQD....GECG......TLSKD....ELK.........ELL..........
ENSBTAP00000012770  -------------SAPSA.LRVYGQYLNLDk...DHNG......MLSKE....ELS.........RYG..........
ENSBTAP00000000847  ------------------.--MVTTFHKYSgr..EGSKl.....TLSRK....ELK.........ELI..........
ENSBTAP00000053738  ------------------.DELKRAFHLLDt...ANNM......TVTKS....ELR.........RVI..........
ENSBTAP00000054975  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000046639  ------------------.-------QQLDk...EGNG......LLDKA....DFK.........QAL..........
ENSBTAP00000052345  ------------------.---EKYYRQVDt...GNTG......RVLAS....DAA.........VFL..........
ENSBTAP00000053164  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000016774  ------------------.NSLIDVYHKYSlkk.GNYH......AVYRD....DLK.........QLL..........
ENSBTAP00000022630  -----------------P.EELKGIFEKYAake.GDPN......QLSKE....ELK.........LLL..........
ENSBTAP00000010796  ------------------.----TAFSALDk...EDTG......FVKAS....DFG.........QVL..........
ENSBTAP00000021909  ------------TPEESK.ERLGMIVDKIDa...DKDG......FVTEG....ELK.........SWI..........
ENSBTAP00000033974  ------------------.---------FSe...EGKG......QVKTD....ELE.........WLV..........
ENSBTAP00000006711  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000010796  ------------------.------FIETDs...EGNG......ILRRR....DMK.........NAL..........
ENSBTAP00000004912  ------------------.------FKQYAsi..EKNGef....FMSPN....DFV.........TRY..........
ENSBTAP00000005979  -----------QLRPACA.QALTRIFRLSDq...DMDQ......ALSDQ....ELN.........AFQ..........
ENSBTAP00000053738  ------------------.----TAFSALDk...EDTG......FVKAS....DFG.........QVL..........
ENSBTAP00000053746  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000023221  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000019429  ------YSEFPEFSRRLI.KDLESMFKLYDa...GRDG......FIDLM....ELK.........LMM..........
ENSBTAP00000052019  ------------------.--VIRVFQKYAke..NGDSt.....SLCKE....ELK.........QLL..........
ENSBTAP00000042244  ----NPYTEFKEFSRKQI.KDMEKMFKEYDa...GRDG......FIDLM....ELK.........LMM..........
ENSBTAP00000053738  ------------------.-----ALLLIKs...KPDG......QITGQ....ELQ.........RIL..........
ENSBTAP00000018877  ------------------.-----------....---N......KISKS....SFR.........KML..........
ENSBTAP00000053019  ----------TTISREEL.EELQEAFNKIDi...DNSG......YVSDY....ELQ.........DLF..........
ENSBTAP00000003073  ------------------.---KTFFILHDi...NSDG......VLDEQ....ELE.........ALF..........
ENSBTAP00000012886  ----------------DI.D----------....----......-----....---.........---..........
ENSBTAP00000044222  -----------------L.ATLVRTFQEYSq...FSGN......PLCQA....KFK.........ELL..........
ENSBTAP00000028499  ------------------.---VTTFFTFAgre.GRKG......SLSVN....EFK.........ELV..........
ENSBTAP00000047378  ------------------.SQLRDVYSSCDt...TGTG......FLDRE....ELT.........QLC..........
ENSBTAP00000009308  ------------VSDEEM.LELREAFAKVDt...DGNG......YISCS....ELN.........DLF..........
ENSBTAP00000017060  ------------------.----SYYKQVDp...AYTG......RVGAS....EAA.........LFL..........
ENSBTAP00000050406  ----------TQISKDEL.DELKEAFAKVDl...NSNG......FICDY....ELH.........ELF..........
ENSBTAP00000031879  ----------TQISKDEL.DELKEAFAKVDl...NSNG......FICDY....ELH.........ELF..........
ENSBTAP00000031854  ------------------.-----MFRAAGg...ERTG......FVSAQ....SFI.........TIW..........
ENSBTAP00000001250  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000026035  ----------------NI.NGIIEAFRRYArm..EGDCa.....VLERG....ELK.........RLL..........
ENSBTAP00000011215  ------------------.-----MFRAAGg...ERTG......FVSAQ....SFI.........TIW..........
ENSBTAP00000002128  ------------------.-----------....--EN......YIDAE....ELQ.........SIL..........
ENSBTAP00000053194  ----------TGLSEETR.QEFETTFRHFDe...NLTG......RLSHK....DFR.........SCL..........
ENSBTAP00000056127  ------------------.--------RIDs...DGDG......FVTTE....ELK.........TWI..........
ENSBTAP00000033188  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000053548  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000011687  -------------SVRNV.KALVEYFHLLDv...HHKK......TLNDV....LFY.........HFL..........
ENSBTAP00000007636  ------------------.RNFEIAFKMFDl...NGDG......EVDME....EFE.........QVQsiirsqtsmg
ENSBTAP00000020950  -------------PEEQH.KRLKSIIKKIDl...DSDG......FLTES....ELS.........SWI..........
ENSBTAP00000009115  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000023873  ----------TKFTKKEL.QSLYRGF---Kne..CPTG......LVDED....TFK.........LIY..........
ENSBTAP00000054471  ------------------.--AQEFFQTCDk...EGKG......FIARA....DMQ.........RL-..........
ENSBTAP00000039694  ----------------QT.EVLEIEFLSYS....NGMN......TISEE....DFA.........HIL..........
ENSBTAP00000025205  ------------------.--AQEFFQTCDk...EGKG......FIARA....DMQ.........RL-..........
ENSBTAP00000047882  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000001368  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000029786  ------------------.-----------....----......RIDLE....QFK.........GMF..........
ENSBTAP00000028993  ---------------EEL.ARLRSVFAACDa...NRSG......RLERE....EFR.........ALC..........
ENSBTAP00000023678  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000034710  -------------TARQL.AAFQDVFKLFSs...SPTG......SVDMR....SMK.........AAL..........
ENSBTAP00000031823  -------------PEESQ.ARLGRIVDRMDrag.DGDG......WVSLA....ELR.........SWI..........
ENSBTAP00000038002  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000021074  ------------------.---IETFHKYAr...EDAA......TLTCT....ELK.........QLI..........
ENSBTAP00000026544  ------------------.--FWQVWQRFDv...EEKG......YIEEK....ELD.........AFF..........
ENSBTAP00000007217  ------------------.---------VA....DRDH......FIRTL....SLK.........PLL..........
ENSBTAP00000029792  ------------------.-----------....----......RIDAH....QFR.........ELF..........
ENSBTAP00000044088  -----------------H.SGFHVAFKMLDa...DGDE......MVEKK....EFF.........KLQkiiskqddlk
ENSBTAP00000017319  ------------------.-----VFRNSS....DPDG......KLRKA....TAK.........NLL..........
ENSBTAP00000044100  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000033594  ---STLIFNIDLLEIRNG.PRSHESFQEMDl...NDDW......KLSKN....EVK.........VYL..........
ENSBTAP00000026766  ---YQTLAGVTHLEESDI.IDLEKRYWLLKaq..SRTG......RFDLE....TFG.........PL-..........
ENSBTAP00000055894  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000015220  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000033613  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000056320  ------------------.------FWELDt...DHDL......LIDAQ....DLA.........R--..........
ENSBTAP00000025249  ------------------.-----------....----......-V---....---.........---..........
ENSBTAP00000029159  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000044088  ------------------.-----------....--ER......KLHYK....EFR.........RFM..........
ENSBTAP00000016319  ------------LSDAEQ.KYYSDLFSYCDi...ESTK......KVSANgrvlEL-.........---..........
ENSBTAP00000017662  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000012479  ---------------GLL.DKLQKELKVLDp...VSSG......FLLQS....QLS.........HLF..........
ENSBTAP00000029886  ------------------.--LDKYFKNFD....NGDS......RLDSS....EFL.........KFV..........
ENSBTAP00000027388  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000039694  ------------------.-----------....----......-LSKQ....ELN.........QML..........
ENSBTAP00000023673  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000041488  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000001452  ------------------.----ETFKQIDt...DNDR......QLSKT....EIS.........HYL..........
ENSBTAP00000028498  ----------------AI.ETLIKNFHQYSve..GGKE......TLTPS....ELR.........DLV..........
ENSBTAP00000001426  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000020240  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000053650  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000041651  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000005154  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000021174  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000022068  ------------------.PRLRAVFDALDg...DGDG......FVRIE....DFV.........QFA..........
ENSBTAP00000026682  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000007636  ------------------.---KLEFERHD....PVDG......RITER....QFG.........GML..........
ENSBTAP00000027954  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000020778  ------------------.----------Dl...NTDR......RISAK....EMQ.........KWI..........
ENSBTAP00000013601  ------------------.-----------....----......-----....KLY.........PIL..........
ENSBTAP00000005477  ------------------.-----------....----......HICLS....ELP.........FVM..........
ENSBTAP00000055305  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000036054  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000004912  -----------------L.EHAKQAFVQRDs...ARTG......KVTAI....DFR.........DIM..........
ENSBTAP00000022292  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000002717  --------PLVNFKVSSA.KFLKDKFLEIG....AHKD......ELSFE....QFH.........LFY..........
ENSBTAP00000036015  -----------------L.KSIWYAFTALDv...EKSG......KVSKS....QLK.........VLS..........
ENSBTAP00000051638  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000026766  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000053738  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000016306  ------------VSVEED.SRQEWTFTLYDf...DNNG......KVTRE....DIT.........SLL..........
ENSBTAP00000013714  -----------------S.EQARRVFQTYDp...EDNG......FIPDS....LLE.........DVM..........
ENSBTAP00000036550  ------------------.-----------....----......-IDAQ....QFA.........RLF..........
ENSBTAP00000053738  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000023383  ------------------.--LRKQFYSVDr...NRED......RISAK....DLK.........NML..........
ENSBTAP00000027030  ------------------.---------LGi...TRDG......HLNRK....KLV.........SIC..........
ENSBTAP00000053270  ------------------.---------LGi...TRDG......HLNRK....KLV.........SIC..........
ENSBTAP00000054640  ------------------.---------LGi...TRDG......HLNRK....KLV.........SIC..........
ENSBTAP00000012770  ------------------.-----------....----......MINYE....NFL.........KVG..........
ENSBTAP00000009967  --------------IEQL.DNLRDQF--LDi...APKG......IIGNK....AFA.........DLLldlvt.....
ENSBTAP00000015183  ------------------.--IQRAFEPSEp...SQTI......C----....---.........---..........
ENSBTAP00000014222  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000026288  -------LRLHDWSVEHE.TFLREAFSFVD....RGDG......TVTKE....DFV.........LTL..........
ENSBTAP00000002128  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000003365  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000053738  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000009228  ------------------.----EAFQDYVt...DPRG......LISKK....DFK.........KAM..........
ENSBTAP00000026785  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000002578  -------------KDELL.KGIWHAFTALDl...DHSG......KVSKS....QLK.........VLS..........
ENSBTAP00000000106  --------------ISSI.EDLQGLFHKTGq...DVDG......KLTYQ....QIE.........DTL..........
ENSBTAP00000028840  ------------------.--ILELFHKVD....QGKH......QISRE....EFI.........VAL..........
ENSBTAP00000053594  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000055414  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000026698  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000017015  -------------TEEEM.YSLTETFQQCKv...IPDC......SLTLE....DFL.........RYR..........
ENSBTAP00000049908  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000021395  ------------------.-----------....----......RVKVE....KLE.........MAL..........
ENSBTAP00000007194  ------------------.-----------....----......-----....---.........---..........
ENSBTAP00000025455  ------------------.-----------....----......-----....---.........---..........


                                                                                                    
                                                                                                    
d1qxpa2               ..............................................................................
ENSBTAP00000019411  ..............................................................................
ENSBTAP00000036057  ..............................................................................
ENSBTAP00000038404  ..............................................................................
ENSBTAP00000010971  ..............................................................................
ENSBTAP00000019803  ..............................................................................
ENSBTAP00000014038  ..............................................................................
ENSBTAP00000002055  ..............................................................................
ENSBTAP00000049731  ..............................................................................
ENSBTAP00000005577  ..............................................................................
ENSBTAP00000034949  ..............................................................................
ENSBTAP00000017447  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000046644  ..............................................................................
ENSBTAP00000022814  ..............................................................................
ENSBTAP00000019758  ..............................................................................
ENSBTAP00000019321  ..............................................................................
ENSBTAP00000011677  ..............................................................................
ENSBTAP00000011680  ..............................................................................
ENSBTAP00000021742  ..............................................................................
ENSBTAP00000005348  ..............................................................................
ENSBTAP00000016609  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000018403  ..............................................................................
ENSBTAP00000026407  ..............................................................................
ENSBTAP00000052557  ..............................................................................
ENSBTAP00000054167  ..............................................................................
ENSBTAP00000010319  ..............................................................................
ENSBTAP00000041545  ..............................................................................
ENSBTAP00000055204  ..............................................................................
ENSBTAP00000003718  ..............................................................................
ENSBTAP00000011676  ..............................................................................
ENSBTAP00000049395  ..............................................................................
ENSBTAP00000054983  ..............................................................................
ENSBTAP00000052219  ..............................................................................
ENSBTAP00000025402  ..............................................................................
ENSBTAP00000011678  ..............................................................................
ENSBTAP00000000433  ..............................................................................
ENSBTAP00000021491  ..............................................................................
ENSBTAP00000044733  ..............................................................................
ENSBTAP00000010937  ..............................................................................
ENSBTAP00000056439  ..............................................................................
ENSBTAP00000055780  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000034705  ..............................................................................
ENSBTAP00000035936  ..............................................................................
ENSBTAP00000013699  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000011496  ..............................................................................
ENSBTAP00000019111  ..............................................................................
ENSBTAP00000017036  ..............................................................................
ENSBTAP00000003213  ..............................................................................
ENSBTAP00000055444  ..............................................................................
ENSBTAP00000024550  ..............................................................................
ENSBTAP00000015248  ..............................................................................
ENSBTAP00000021328  ..............................................................................
ENSBTAP00000037091  ..............................................................................
ENSBTAP00000029967  ..............................................................................
ENSBTAP00000021449  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000042361  ..............................................................................
ENSBTAP00000016509  ..............................................................................
ENSBTAP00000026714  ..............................................................................
ENSBTAP00000004690  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000013117  ..............................................................................
ENSBTAP00000017574  ..............................................................................
ENSBTAP00000004885  ..............................................................................
ENSBTAP00000008961  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000006283  ..............................................................................
ENSBTAP00000014306  ..............................................................................
ENSBTAP00000053252  ..............................................................................
ENSBTAP00000014304  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000041264  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000017358  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000055296  ..............................................................................
ENSBTAP00000016852  ..............................................................................
ENSBTAP00000036380  ..............................................................................
ENSBTAP00000041719  ..............................................................................
ENSBTAP00000049636  ..............................................................................
ENSBTAP00000024444  ..............................................................................
ENSBTAP00000004556  ..............................................................................
ENSBTAP00000038767  ..............................................................................
ENSBTAP00000031285  ..............................................................................
ENSBTAP00000011457  ..............................................................................
ENSBTAP00000011047  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000037104  ..............................................................................
ENSBTAP00000002672  ..............................................................................
ENSBTAP00000028269  ..............................................................................
ENSBTAP00000016647  ..............................................................................
ENSBTAP00000004536  ..............................................................................
ENSBTAP00000042177  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000050283  ..............................................................................
ENSBTAP00000048539  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000007972  ..............................................................................
ENSBTAP00000040815  ..............................................................................
ENSBTAP00000025661  ..............................................................................
ENSBTAP00000028350  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000021537  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000039155  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000016315  ..............................................................................
ENSBTAP00000021091  ..............................................................................
ENSBTAP00000021618  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000034078  ..............................................................................
ENSBTAP00000006645  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000015802  ..............................................................................
ENSBTAP00000032680  ..............................................................................
ENSBTAP00000055007  ..............................................................................
ENSBTAP00000020148  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000012557  ..............................................................................
ENSBTAP00000011888  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000021603  ..............................................................................
ENSBTAP00000010838  ..............................................................................
ENSBTAP00000014575  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000053698  ..............................................................................
ENSBTAP00000006806  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000044105  ..............................................................................
ENSBTAP00000026904  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000044226  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000042182  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000006275  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000004963  ..............................................................................
ENSBTAP00000023774  ..............................................................................
ENSBTAP00000020395  ..............................................................................
ENSBTAP00000020150  ..............................................................................
ENSBTAP00000025561  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000034009  ..............................................................................
ENSBTAP00000020539  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000017461  ..............................................................................
ENSBTAP00000044096  ..............................................................................
ENSBTAP00000008523  ..............................................................................
ENSBTAP00000035196  ..............................................................................
ENSBTAP00000041997  ..............................................................................
ENSBTAP00000025499  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000002174  ..............................................................................
ENSBTAP00000000589  ..............................................................................
ENSBTAP00000028239  ..............................................................................
ENSBTAP00000014894  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000041966  ..............................................................................
ENSBTAP00000008933  ..............................................................................
ENSBTAP00000056088  ..............................................................................
ENSBTAP00000033794  ..............................................................................
ENSBTAP00000012786  ..............................................................................
ENSBTAP00000030018  ..............................................................................
ENSBTAP00000040233  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000024301  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000015611  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000000847  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000054975  ..............................................................................
ENSBTAP00000046639  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000053164  ..............................................................................
ENSBTAP00000016774  ..............................................................................
ENSBTAP00000022630  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000033974  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000005979  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000053746  ..............................................................................
ENSBTAP00000023221  ..............................................................................
ENSBTAP00000019429  ..............................................................................
ENSBTAP00000052019  ..............................................................................
ENSBTAP00000042244  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000018877  ..............................................................................
ENSBTAP00000053019  ..............................................................................
ENSBTAP00000003073  ..............................................................................
ENSBTAP00000012886  ..............................................................................
ENSBTAP00000044222  ..............................................................................
ENSBTAP00000028499  ..............................................................................
ENSBTAP00000047378  ..............................................................................
ENSBTAP00000009308  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000050406  ..............................................................................
ENSBTAP00000031879  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000001250  ..............................................................................
ENSBTAP00000026035  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000053194  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000033188  ..............................................................................
ENSBTAP00000053548  ..............................................................................
ENSBTAP00000011687  ..............................................................................
ENSBTAP00000007636  mrhrdrsttgntlksglcsalttyffgadlkgkltiknflefqrklqhdvlkleferhdpvdgriterqfggmllays
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000009115  ..............................................................................
ENSBTAP00000023873  ..............................................................................
ENSBTAP00000054471  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000025205  ..............................................................................
ENSBTAP00000047882  ..............................................................................
ENSBTAP00000001368  ..............................................................................
ENSBTAP00000029786  ..............................................................................
ENSBTAP00000028993  ..............................................................................
ENSBTAP00000023678  ..............................................................................
ENSBTAP00000034710  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000021074  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000007217  ..............................................................................
ENSBTAP00000029792  ..............................................................................
ENSBTAP00000044088  taitdetecqeqtvqepeinttlqirffgkrgerklhykefrrfmenlqaevqemeflqfskglsfmrkedfaewllf
ENSBTAP00000017319  ..............................................................................
ENSBTAP00000044100  ..............................................................................
ENSBTAP00000033594  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000055894  ..............................................................................
ENSBTAP00000015220  ..............................................................................
ENSBTAP00000033613  ..............................................................................
ENSBTAP00000056320  ..............................................................................
ENSBTAP00000025249  ..............................................................................
ENSBTAP00000029159  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000017662  ..............................................................................
ENSBTAP00000012479  ..............................................................................
ENSBTAP00000029886  ..............................................................................
ENSBTAP00000027388  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000023673  ..............................................................................
ENSBTAP00000041488  ..............................................................................
ENSBTAP00000001452  ..............................................................................
ENSBTAP00000028498  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000020240  ..............................................................................
ENSBTAP00000053650  ..............................................................................
ENSBTAP00000041651  ..............................................................................
ENSBTAP00000005154  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000022068  ..............................................................................
ENSBTAP00000026682  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000027954  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000013601  ..............................................................................
ENSBTAP00000005477  ..............................................................................
ENSBTAP00000055305  ..............................................................................
ENSBTAP00000036054  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000002717  ..............................................................................
ENSBTAP00000036015  ..............................................................................
ENSBTAP00000051638  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000016306  ..............................................................................
ENSBTAP00000013714  ..............................................................................
ENSBTAP00000036550  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000023383  ..............................................................................
ENSBTAP00000027030  ..............................................................................
ENSBTAP00000053270  ..............................................................................
ENSBTAP00000054640  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000009967  ..............................................................................
ENSBTAP00000015183  ..............................................................................
ENSBTAP00000014222  ..............................................................................
ENSBTAP00000026288  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000009228  ..............................................................................
ENSBTAP00000026785  ..............................................................................
ENSBTAP00000002578  ..............................................................................
ENSBTAP00000000106  ..............................................................................
ENSBTAP00000028840  ..............................................................................
ENSBTAP00000053594  ..............................................................................
ENSBTAP00000055414  ..............................................................................
ENSBTAP00000026698  ..............................................................................
ENSBTAP00000017015  ..............................................................................
ENSBTAP00000049908  ..............................................................................
ENSBTAP00000021395  ..............................................................................
ENSBTAP00000007194  ..............................................................................
ENSBTAP00000025455  ..............................................................................


                                         50                  60           70                        
                                          |                   |            |                        
d1qxpa2               ...........NR...II..SKH..KDLRTNG........FSL...ESCRSMVNLM.....D................
ENSBTAP00000019411  ...........RS...LG..QNP..TE-----........---...AELQDMINEV.....D................
ENSBTAP00000036057  ...........RS...LG..QNP..TE-----........---...AELQDMINEV.....D................
ENSBTAP00000038404  ...........GN...FF..PYG..DA-----........--S...KFAEHVFRTF.....D................
ENSBTAP00000010971  ...........AN...FF..PYG..DA-----........--S...KFAEHVFRTF.....D................
ENSBTAP00000019803  ...........NK...VV..TRH..PDLKTDG........FGI...DTCRSMVAVM.....D................
ENSBTAP00000014038  ...........--...--..---..PELQQN-........---...PLVQRVIDIF.....D................
ENSBTAP00000002055  ...........RS...LG..QNP..TE-----........---...AELQDMINEV.....D................
ENSBTAP00000049731  ...........RS...LG..QNP..TE-----........---...AELQDMINEV.....D................
ENSBTAP00000005577  ...........AN...FF..PYG..DA-----........--S...KFAEHVFRTF.....D................
ENSBTAP00000034949  ...........SK...FF..PEA..DP-----........--K...AYAQHVFRSF.....D................
ENSBTAP00000017447  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000010858  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000046644  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000022814  ...........VK...FF..PYG..DA-----........--S...KFAQHAFRTF.....D................
ENSBTAP00000019758  ...........AP...LI..PME..-------........---...HCTTRFFETC.....D................
ENSBTAP00000019321  ...........IK...FF..PYG..DA-----........--S...KFAQHAFRTF.....D................
ENSBTAP00000011677  ...........NR...VV..NKH..KDLKTQG........FTL...ESCRSMIALM.....D................
ENSBTAP00000011680  ...........NR...VV..NKH..KDLKTQG........FTL...ESCRSMIALM.....D................
ENSBTAP00000021742  ...........SQ...FF..PQG..DS-----........--S...TYATFLFNAF.....D................
ENSBTAP00000005348  ...........AS...LV..PME..-------........---...HCITRFFEEC.....D................
ENSBTAP00000016609  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000012740  ...........TT...TY..DGL..EQMHKNL........VNV...PL--------.....-................
ENSBTAP00000018403  ...........QE...VG..LKL..SE-----........---...AELKKLISQL.....D................
ENSBTAP00000026407  ...........VA...DG..KAV..TG-----........---...TDVDIVFSKV.....K................
ENSBTAP00000052557  ...........RA...LG..FEP..RK-----........---...EEMKRMIADV.....D................
ENSBTAP00000054167  ...........SQ...FF..PQG..DS-----........--T...TYAHFLFNAF.....D................
ENSBTAP00000010319  ...........RA...LG..FEP..KK-----........---...EEIKKMISEI.....D................
ENSBTAP00000041545  ...........HL...MN..VEM..DQ-----........---...EYAFQLFQTA.....D................
ENSBTAP00000055204  ...........SN...--..---..--GTWTP........FNP...VTVRSIISMF.....D................
ENSBTAP00000003718  ...........AQ...FF..PHG..DA-----........--S...MYAHYLFHAF.....D................
ENSBTAP00000011676  ...........NE...VF..SKR..TDIKFDG........FDI...NTCREMISLM.....D................
ENSBTAP00000049395  ...........KE...LN..IQV..DD-----........---...SYARKIFKEC.....D................
ENSBTAP00000054983  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000052219  ...........TQ...SG..IA-..--GGYKP........FNL...ETCRLMVSML.....D................
ENSBTAP00000025402  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000011678  ...........NR...II..SKH..KDLRTTG........FSL...ESCRSMVNLM.....D................
ENSBTAP00000000433  ...........KD...CG..IMD..GKTVTS-........---...TDVDIVFSKV.....K................
ENSBTAP00000021491  ...........RA...LG..FEP..KK-----........---...EEIKKMIAET.....D................
ENSBTAP00000044733  ...........RR...VL..AKR..QDIKSDG........FSI...ETCKIMVDML.....D................
ENSBTAP00000010937  ...........HK...LN..VNL..PR-----........---...RKVRQMFQEA.....D................
ENSBTAP00000056439  ...........HK...LN..VNL..PR-----........---...RKVRQMFQEA.....D................
ENSBTAP00000055780  ...........RM...LG..QNP..TP-----........---...EELQEMIDEV.....D................
ENSBTAP00000038002  ...........KY...ME..YST..KK-VSDV........LKL...FEDGEMAEYL.....Q................
ENSBTAP00000034705  ...........RM...VN..LDM..ND-----........---...MYAYGLFKEC.....D................
ENSBTAP00000035936  ...........KV...--..---..---PDNE........EAT...QYVEAMFRAF.....D................
ENSBTAP00000013699  ...........VN...--..---..--SNWSS........FND...ETCLMMINMF.....D................
ENSBTAP00000002564  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000011496  ...........KQ...FF..PFG..DP-----........--T...KFATFVFNVF.....D................
ENSBTAP00000019111  ...........RA...LG..FDV..KK-----........---...ADVLKILKDY.....D................
ENSBTAP00000017036  ...........GL...--..---..--KNLSP........WAS...QYVEQMFETF.....D................
ENSBTAP00000003213  ...........HK...LN..VNL..PR-----........---...QRVKQMFKEA.....D................
ENSBTAP00000055444  ...........HK...LN..VNL..PR-----........---...QRVKQMFKEA.....D................
ENSBTAP00000024550  ...........TQ...SG..ISG..TY---SP........FSL...ETCRIMIAML.....D................
ENSBTAP00000015248  ...........AS...MG..KNP..TD-----........---...EYLEGMMSEA.....P................
ENSBTAP00000021328  ...........AS...LG..KNP..TD-----........---...EYLDAMMNEA.....P................
ENSBTAP00000037091  ...........AS...LG..KNP..TD-----........---...AYLEAMMNEA.....P................
ENSBTAP00000029967  ...........RT...LG..YMP..TE-----........---...MELIEISQQI.....-................
ENSBTAP00000021449  ...........RT...MG..YMP..TE-----........---...MELIELGQQI.....R................
ENSBTAP00000053176  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000042361  ...........RT...MG..YMP..TE-----........---...MELIELSQQI.....N................
ENSBTAP00000016509  ...........KV...--..---..---PDNE........EAT...QYVEAMFRAF.....D................
ENSBTAP00000026714  ...........RT...MG..YMP..TE-----........---...MELIELSQQI.....N................
ENSBTAP00000004690  ...........NK...VV..SRF..KNFKTKG........FSL...DVCRCMVNLL.....D................
ENSBTAP00000010858  ...........HD...SI..Q--..-------........---...----------.....-................
ENSBTAP00000013117  ...........RN...LN..PGL..KT-----........---...SKIELKFKEL.....H................
ENSBTAP00000017574  ...........EK...LD..IQC..NT-----........---...IHVKYIFKDN.....D................
ENSBTAP00000004885  ...........KS...LG..IPL..GQ-----........---...DAEEKIFTTG.....D................
ENSBTAP00000008961  ...........HE...VH..PIS..SG-----........---...LEAMALKSTI.....D................
ENSBTAP00000028063  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000012740  ...........R-...--..---..-------........---...----------.....-................
ENSBTAP00000006283  ...........RT...LG..YMP..TE-----........---...MELIEVSQHV.....K................
ENSBTAP00000014306  ...........RA...LG..QNP..TN-----........---...AEVLKVLGNP.....K................
ENSBTAP00000053252  ...........KQ...LN..PTL..KE-----........---...SKIRLKFKEI.....Q................
ENSBTAP00000014304  ...........RA...LG..QNP..TN-----........---...AEVLKVLGNP.....K................
ENSBTAP00000045669  ...........ST...IF..YQL..NKRMPTT........HQ-...IQVEQSIS--.....-................
ENSBTAP00000041264  ...........CI...CH..PVE..PG-----........---...STALALRSTI.....D................
ENSBTAP00000006711  ...........--...--..---..--QKYAE........YSS...KKIKYVLAEF.....N................
ENSBTAP00000017358  ...........HE...VH..QIS..SG-----........---...LEAMALKSTI.....D................
ENSBTAP00000053274  ...........ST...IF..YQL..NKRMPTT........HQ-...IQVEQSIS--.....-................
ENSBTAP00000055296  ...........HE...VH..QIS..SG-----........---...LEAMALKSTI.....D................
ENSBTAP00000016852  ...........ND...YA..VVM..EK-----........---...EEAEELFRRF.....D................
ENSBTAP00000036380  ...........RC...LG..ASP..TP-----........---...GEAQRHLQTH.....R................
ENSBTAP00000041719  ...........RA...LG..QNP..TN-----........---...AEVLRVLGYP.....K................
ENSBTAP00000049636  ...........RA...LG..TNP..TN-----........---...AEVKKVLGNP.....S................
ENSBTAP00000024444  ...........AA...LGr.VNV..KN-----........---...EEIDEMLKEA.....P................
ENSBTAP00000004556  ...........GR...FD..---..--TSILP........ICK...DSLGWMFNKL.....D................
ENSBTAP00000038767  ...........--...--..---..PELAINP........LGD...----RIINAF.....F................
ENSBTAP00000031285  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000011457  ...........HM...TF..GMT..DD-----........---...MIMDRVFRGF.....D................
ENSBTAP00000011047  ...........RA...LG..QNP..TQ-----........---...AEVLRVLGKP.....K................
ENSBTAP00000002564  ...........--...--..---..-Q-----........---...----------.....-................
ENSBTAP00000037104  ...........AA...PGcrINV..KN-----........---...EELEAMVKEA.....P................
ENSBTAP00000002672  ...........SQ...LGk.VNV..PE-----........---...EELDAMLQE-.....-................
ENSBTAP00000028269  ...........AA...MGr.LNV..KN-----........---...EELDAMMKE-.....-................
ENSBTAP00000016647  ...........AL...AV..NPL..GD-----........---...----RIIDSF.....F................
ENSBTAP00000004536  ...........AR...LG..GGD..PD-----........--R...GAQQGISPEG.....D................
ENSBTAP00000042177  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000028063  ...........KE...VL..KLP..TA-----........---...----------.....-................
ENSBTAP00000050283  ...........RA...LG..QNP..TN-----........---...AEVLRVLGKP.....K................
ENSBTAP00000048539  ...........KL...PI..SKP..-------........---...--LQQLFALF.....D................
ENSBTAP00000045669  ...........RE...VL..KLP..-------........---...----------.....-................
ENSBTAP00000007972  ...........AE...LG..LVL..DT-----........---...AEMEGVCRRW.....D................
ENSBTAP00000040815  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000025661  ...........KL...--..--P..VS-----........---...DVLRQLFALF.....D................
ENSBTAP00000028350  ...........--...--..LSL..PELKANP........FKE...RICKVFSTSP.....S................
ENSBTAP00000053274  ...........RE...VL..KLP..-------........---...----------.....-................
ENSBTAP00000021537  ...........--...--..---..-ELKDN-........---...PFRQRIAQVF.....S................
ENSBTAP00000055481  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000039155  ...........WP...LG..PNP..TK-----........---...AELQKVVGEL.....D................
ENSBTAP00000029333  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000016315  ...........TK...--..---..-----SK........LSI...PELSYIWELS.....D................
ENSBTAP00000021091  ...........NH...MP..WSG..LGSKQPL........FSL...EACQGILALL.....D................
ENSBTAP00000021618  ...........ES...LG..LKP..QD-----........---...MFVQSMFSLA.....D................
ENSBTAP00000055520  ...........QE...MF..QKV..RVEKPGQmhpr....ASE...LTLSLLTTMY.....D................
ENSBTAP00000055624  ...........QE...MF..QKV..RVEKPGQmhpr....ASE...LTLSLLTTMY.....D................
ENSBTAP00000016319  ...........TK...SK..LPI..-------........---...LELSHIWELS.....D................
ENSBTAP00000034078  ...........RS...LG..CCP..SE-----........---...GELHDLIAEV.....E................
ENSBTAP00000006645  ...........--...--..--L..PALRVNP........FRD...RICRV-----.....-................
ENSBTAP00000021909  ...........HP...--..---..--EEYDY........MKD...IVVQETMEDI.....D................
ENSBTAP00000001426  ...........QE...LE..KAR..KGSGMVS........KSDnlgEKMKEFMQKY.....D................
ENSBTAP00000015802  ...........--...--..---..-------........--R...QWKQKIVQAG.....D................
ENSBTAP00000032680  ...........--...--..---..-------........--R...QWKQKIVQAG.....D................
ENSBTAP00000055007  ...........RM...LG..QTP..TK-----........---...EELDAIIEEV.....D................
ENSBTAP00000020148  ...........NT...EL..GAF..TK---NQ........KDP...GVLDRMMKKL.....D................
ENSBTAP00000052345  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000029334  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000052345  ...........LN...SK..LPV..-------........---...DILGRVWELS.....D................
ENSBTAP00000056127  ...........HPe..EF..EHM..KE-----........---...IVVLETLEDI.....D................
ENSBTAP00000012557  ...........ENv..LG..LNL..PW-----........---...RSLSSHLVT-.....-................
ENSBTAP00000011888  ...........KV...--..---..KE-----........--S...FFAERFFVLF.....D................
ENSBTAP00000017060  ...........MN...SK..LPL..-------........---...DVLGRVWDLS.....D................
ENSBTAP00000031854  ...........DQ...--..---..------A........SSN...RIIERIFSGAvtrgkT................
ENSBTAP00000031823  ...........HP...--..---..--EEFPH........MRD...IVIAETLEDL.....D................
ENSBTAP00000021603  ...........ES...LG..LKP..QD-----........---...MFVESMFSLA.....D................
ENSBTAP00000010838  ...........KD...NF..PNF..LG-ACEK........RGR...DYLSNIFEKQ.....D................
ENSBTAP00000014575  ...........--...--..---..-------........---...PFKERIVEAF.....S................
ENSBTAP00000011215  ...........DQ...--..---..------A........SSN...RIIERIFSGAvtrgkT................
ENSBTAP00000053698  ...........RS...LG..YMP..SE-----........---...VELAIIMQRL.....D................
ENSBTAP00000006806  ...........QT...EL..SGF..LD---AQ........KDA...DAVDKVMKEL.....D................
ENSBTAP00000029334  ...........LQ...SG..LPA..-------........---...PVLAEIWALS.....D................
ENSBTAP00000044105  ...........KE...NF..PNF..LS-ACEK........RGR...QYLSDIFEKK.....D................
ENSBTAP00000026904  ...........QR...--..-EL..TEFLSCQ........KDP...ELVDKIMQDL.....D................
ENSBTAP00000017060  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000055520  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000044226  ...........QT...EL..SGF..LD---AQ........KDA...DAVDKVMKEL.....D................
ENSBTAP00000055624  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000042182  ...........SI...AL..EPA..RAHAQTPre......IGL...RTCEQLLQCF.....G................
ENSBTAP00000010796  ...........EK...FN..LDI..SR-----........---...DECQQLLIKY.....D................
ENSBTAP00000021174  ...........QE...LQ..QAR..KK--AGL........ELS...PEMKTFVDQY.....G................
ENSBTAP00000006275  ...........NN...EL..SHF..LE---EI........KEQ...EVVDKVMETL.....D................
ENSBTAP00000020950  ...........HP...--..---..--EEVDY........MTE...FVIQEALEEH.....D................
ENSBTAP00000053738  ...........EK...FN..LDI..SR-----........---...DECQQLLIKY.....D................
ENSBTAP00000004963  ...........HS...IF..GMT..DD-----........---...VLMNRVFFAF.....D................
ENSBTAP00000023774  ...........RS...LG..YMP..NE-----........---...VELEVIIQRL.....D................
ENSBTAP00000020395  ...........RS...LG..YDL..PM-VEEG........EPD...PEFEAILDTV.....D................
ENSBTAP00000020150  ...........EK...EF..PGF..LE---NQ........KDP...LAVDKIMKDL.....D................
ENSBTAP00000025561  ...........TR...EL..PSF..LG---KR........TDE...TAFQKLMSNL.....D................
ENSBTAP00000053738  ...........QH...LL..FNL..KD-----........---...EEFERLLGLL.....G................
ENSBTAP00000034009  ...........TK...EL..PK-..--TLQNT........KDQ...PTIDKIFQDL.....D................
ENSBTAP00000020539  ...........ES...VLh.LGL..PW---RM........LRP...Q----LVS--.....-................
ENSBTAP00000020778  ...........HP...--..---..--EHSRG........MLQ...FMVKEIIRDL.....D................
ENSBTAP00000017461  ...........VMl..FG..YKP..SK-----........---...IEADSVMSSV.....D................
ENSBTAP00000044096  ...........QK...EL..PNF..--LKKQK........KNE...AAINEIMEDL.....D................
ENSBTAP00000008523  ...........QK...EL..PNF..--LKKQK........KNE...AAINEIMEDL.....D................
ENSBTAP00000035196  ...........RI...CF..NTP..LA----P........QAL...EDVKNVVRKH.....I................
ENSBTAP00000041997  ...........VR...--..SKL..PN-----........---...SVLGKIWKLA.....D................
ENSBTAP00000025499  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000055481  ...........FQ...SG..LPQ..-------........---...PVLAQIWALA.....D................
ENSBTAP00000002174  ...........VK...--..SKL..PN-----........---...TVLGKIWKLA.....D................
ENSBTAP00000000589  ...........HK...--..---..-------........---...----------.....-................
ENSBTAP00000028239  ...........--...VG..TKL..PN-----........---...SVLGRIWKLS.....D................
ENSBTAP00000014894  ...........IS...LG..YDV..EN---DR........QGD...AEFNRIMSVV.....D................
ENSBTAP00000026544  ...........RD...LF..LHH..KKAISEA........KLE...EYTGTMMKIF.....D................
ENSBTAP00000029333  ...........FQ...SG..LPQ..-------........---...PVLAQIWALA.....D................
ENSBTAP00000041966  ...........NR...EF..LRG..PP--GDP........FSL...DECRSLVALM.....D................
ENSBTAP00000008933  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000056088  ...........TK...EL..PKT..--LQQNT........KDQ...PTIDKIFQDL.....D................
ENSBTAP00000033794  ...........MD...NV..PRF..ME-TLGR........KEP...YYITQLFRAA.....D................
ENSBTAP00000012786  ...........IS...MG..YDL..GE-----........---...AEFARIMTLV.....D................
ENSBTAP00000030018  ...........IS...MG..YDL..GE-----........---...VEFARIMTMV.....D................
ENSBTAP00000040233  ...........TT...FL..LPL..TR-----........---...EQFQDVLAQI.....P................
ENSBTAP00000003365  ...........QH...AG..RNP..SQ-----........---...----KTINKY.....W................
ENSBTAP00000053176  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000024301  ...........IS...LG..YDI..GN---DP........QGE...AEFARIMSIV.....D................
ENSBTAP00000022292  ...........LG...LY..NDP..NS-----........-NP...KIVQLLAGVA.....D................
ENSBTAP00000015611  ...........EK...EF..RPI..LK---NP........DDP...DTVDVIMHIL.....D................
ENSBTAP00000012770  ...........TA...T-..--M..TN-----........---...VFLDRVFQEC.....-................
ENSBTAP00000000847  ...........KKelcLG..EKM..RE-----........---...SSIDDLMKSL.....D................
ENSBTAP00000053738  ...........TT...FL..LPL..TR-----........---...EQFQDVLAQI.....P................
ENSBTAP00000054975  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000046639  ...........KL...FR..LEV..SE-----........---...NDFESFWLIL.....N................
ENSBTAP00000052345  ...........KK...SG..LPD..-------........---...LVLGKIWDLA.....D................
ENSBTAP00000053164  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000016774  ...........ET...EC..PKF..MK-----........--K...KDADTWFKEL.....D................
ENSBTAP00000022630  ...........QT...EF..PSL..LK-----........-GP...STLDELFEEL.....D................
ENSBTAP00000010796  ...........KD...FC..YKL..TD-----........---...NQYHYFLRKL.....R................
ENSBTAP00000021909  ...........KH...AQ..KKY..IY-----........---...DNVENQWQEF.....D................
ENSBTAP00000033974  ...........SL...LG..INS..TK-----........---...SELASTAKDV.....D................
ENSBTAP00000006711  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000010796  ...........YG...FD..IPL..TP-----........---...REFEKLWMRY.....D................
ENSBTAP00000004912  ...........LN...IF..---..---GESQ........PNP...KTVELLSGVV.....D................
ENSBTAP00000005979  ...........TSc..FG..HPL..AP-----........---...QALEDVKMVV.....S................
ENSBTAP00000053738  ...........KD...FC..YKL..TD-----........---...NQYHYFLRKL.....R................
ENSBTAP00000053746  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000023221  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000019429  ...........EK...LG..APQ..TH-----........---...LGLKSMIKEV.....D................
ENSBTAP00000052019  ...........LA...EF..GD-..--ILRRP........NDP...ETVETILSLL.....D................
ENSBTAP00000042244  ...........EK...LG..APQ..TH-----........---...LGLKNMIKEV.....D................
ENSBTAP00000053738  ...........NC...MV..VKI..SD-----........---...SEFRELMRIL.....D................
ENSBTAP00000018877  ...........QK...EL..NH-..--MLTDT........GNR...KAADKLIQNL.....D................
ENSBTAP00000053019  ...........KE...AS..LPL..PGYKVR-........---...EIVEKILAVA.....D................
ENSBTAP00000003073  ...........TK...EL..EKV..YDPKNEDddmremeeERL...RMREHVMKNV.....D................
ENSBTAP00000012886  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000044222  ...........EK...EL..PTW..AP---TT........LRE...CDYKQFISVL.....D................
ENSBTAP00000028499  ...........TQ...QL..PHL..LK-----........-DV...GSLDEKMKSL.....D................
ENSBTAP00000047378  ...........LK...LH..LEK..-------........---...QLPVLLHTLL.....G................
ENSBTAP00000009308  ...........KA...AC..LPL..PGYRVR-........---...EITENLMTTG.....D................
ENSBTAP00000017060  ...........KK...SG..LSD..-------........---...IILGKIWDLA.....D................
ENSBTAP00000050406  ...........KE...AN..MPL..PGYKVR-........---...EIIQKLMLDG.....D................
ENSBTAP00000031879  ...........KE...AN..MPL..PGYKVR-........---...EIIQKLMLDG.....D................
ENSBTAP00000031854  ...........RK...LL..SNH..HD-----........---...DASK-FICLL.....A................
ENSBTAP00000001250  ...........--...--..---..PE-----........--S...ESLEDLFSLF.....D................
ENSBTAP00000026035  ...........EK...EF..AD-..--VIVKP........HDP...ATVDEVLRLL.....D................
ENSBTAP00000011215  ...........RK...LL..SNH..HD-----........---...DASK-FICLL.....A................
ENSBTAP00000002128  ...........PS...IG..ITL..SD-----........---...KEFKKIVTDT.....A................
ENSBTAP00000053194  ...........RG...LN..YYL..PM-VEEG........EPE...PKFEKFLDAV.....D................
ENSBTAP00000056127  ...........KR...VQ..KRY..IY-----........---...DNVAKVWKDY.....D................
ENSBTAP00000033188  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000053548  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000011687  ...........HH...-V..TDL..TR-----........---...NQITVVFNML.....D................
ENSBTAP00000007636  gvqskkltamqK-...--..---..-------........---...--------QL.....K................
ENSBTAP00000020950  ...........QM...SF..KHY..AM-----........---...QEAKQQFIEY.....D................
ENSBTAP00000009115  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000023873  ...........SQ...FF..PQG..DA-----........--T...TYAHFLFNAF.....D................
ENSBTAP00000054471  ...........--...--..---..--HKELP........LSL...EDLEDVFDTL.....D................
ENSBTAP00000039694  ...........LR...Y-..---..TNVEN--........---...TSVFLENVRY.....S................
ENSBTAP00000025205  ...........--...--..---..--HKELP........LSL...EDLEDVFDTL.....D................
ENSBTAP00000047882  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000001368  ...........--...--..VEH..IE-----........---...KMVESVFRNF.....D................
ENSBTAP00000029786  ...........AL...LF..P--..--WACGT........HSD...VLASRLFQLL.....D................
ENSBTAP00000028993  ...........AE...LR..VRP..-------........---...ADAEAVFQRL.....D................
ENSBTAP00000023678  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000034710  ...........SN...VG..VQL..SP-----........---...QEMCEALRQA.....D................
ENSBTAP00000031823  ...........AH...TQ..QRH..IR-----........---...DSVSAAWNTY.....D................
ENSBTAP00000038002  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000021074  ...........QS...EF..ED-..---IFQP........CAI...HAVERNLNLL.....N................
ENSBTAP00000026544  ...........YH...ML..TKLgvDDAVKEE........NVQ...KMKQQFMAPH.....N................
ENSBTAP00000007217  ...........FE...IP..GFL..SD-----........---...EECRLVIHLA.....Q................
ENSBTAP00000029792  ...........AS...--..--L..TPWACGA........HTP...VLAGRMFRLL.....D................
ENSBTAP00000044088  ftdtenkdvywKN...VR..EK-..-------........---...----------.....-................
ENSBTAP00000017319  ...........QT...QF..KNF..AE---GQ........ETK...ARYKDLLSEL.....D................
ENSBTAP00000044100  ...........--...--..---..-------........---...KLVESVFRNY.....D................
ENSBTAP00000033594  ...........KK...EF..EKH..GAVVNES........HHD...VLVEDIFDKE.....D................
ENSBTAP00000026766  ...........--...--..---..---VSPP........IRP...SLSEGLFNAF.....D................
ENSBTAP00000055894  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000015220  ...........--...--..---..-------........---...-----LFEHM.....D................
ENSBTAP00000033613  ...........--...--..---..-------........---...----NLFEEI.....D................
ENSBTAP00000056320  ...........--...--..---..--HNDHA........IST...KMIDRIFSGAvtrgkK................
ENSBTAP00000025249  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000029159  ...........--...--..---..------K........HVQ...RMVDSVFKNY.....D................
ENSBTAP00000044088  ...........EN...LQ..AEV..QEMEFLQ........FSK...--------GL.....Sfmrkedfaewllfftd
ENSBTAP00000016319  ...........--...--..---..--FRAAQ........LPN...DVVLQIMELC.....G................
ENSBTAP00000017662  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000012479  ...........LR...LE..VPL..QL-----........---...PTVKILCQRF.....S................
ENSBTAP00000029886  ...........EQ...N-..---..-------........---...ETAINITTYA.....D................
ENSBTAP00000027388  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000039694  ...........SE...TP..PVW..KG-----........---...--SSKLFRN-.....-................
ENSBTAP00000023673  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000041488  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000001452  ...........KK...EF..EKD..EKPRDQS........YQT...AVLEDFFKKN.....D................
ENSBTAP00000028498  ...........TQ...QL..PHL..MP-----........-SN...CGLEEKIANL.....G................
ENSBTAP00000001426  ...........--...--..---..-------........---...--------MF.....D................
ENSBTAP00000020240  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000053650  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000041651  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000005154  ...........--...--..---..-------........---...--FQDVFRRA.....D................
ENSBTAP00000021174  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000022068  ...........TV...YG..A--..-------........---...EQVTDLTRYL.....D................
ENSBTAP00000026682  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000007636  ...........--...--..---..--LAYSG........VQS...KKLTAMQKQL.....K................
ENSBTAP00000027954  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000020778  ...........MQ...--..---..KTAEHFQ........EAV...AESRAHFRAV.....D................
ENSBTAP00000013601  ...........MS...SG..LPR..-------........---...ETLGQIWALA.....N................
ENSBTAP00000005477  ...........RA...IG..FYP..SE-----........---...GEIEDMFNEI.....R................
ENSBTAP00000055305  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000036054  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000004912  ...........VT...IR..P--..-----HV........LTP...FVEECLVAAA.....G................
ENSBTAP00000022292  ...........--...--..---..-------........---...--CEFIRLHF.....G................
ENSBTAP00000002717  ...........KK...LM..FEQ..QKSILDE........FKK...DSSVFLLGNT.....D................
ENSBTAP00000036015  ...........HN...LY..TVL..HI-----........--P...HDPVALEEHF.....R................
ENSBTAP00000051638  ...........--...--..---..-------........---...------FRLL.....D................
ENSBTAP00000026766  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000053738  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000016306  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000013714  ...........KA...LD..LVS..DP-----........---...EYINLMKNKL.....D................
ENSBTAP00000036550  ...........QL...--..--V..SPWTCGA........HTE...ILAERTFRLL.....D................
ENSBTAP00000053738  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000023383  ...........SQ...VN..YRV..PNMRFLR........ERL...TDLEQ-----.....-................
ENSBTAP00000027030  ...........EQ...YGl.QNV..DG-----........---...EMLEEVFHNL.....D................
ENSBTAP00000053270  ...........EQ...YGl.QNV..DG-----........---...EMLEEVFHNL.....D................
ENSBTAP00000054640  ...........EQ...YGl.QNV..DG-----........---...EMLEEVFHNL.....D................
ENSBTAP00000012770  ...........EK...AG..PKC..KQ-----........--F...FTAKVFAKLL.....H................
ENSBTAP00000009967  ...........LN...LG..TNN..FPSSWMN........LTQ...PELQELASLL.....-................
ENSBTAP00000015183  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000014222  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000026288  ...........EE...RQ..DFV..NS-----........---...EQLAAIAQLH.....E................
ENSBTAP00000002128  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000003365  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000053738  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000009228  ...........--...--..---..--DSQKQ........FTG...PEIQFLLSCS.....E................
ENSBTAP00000026785  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000002578  ...........HN...LC..TVL..KV-----........--P...HDPVALEEHF.....R................
ENSBTAP00000000106  ...........ES...VG..PEP..ER-----........---...------LREF.....D................
ENSBTAP00000028840  ...........KA...IG..VPL..KN-----........---...QEVEDIVVY-.....-................
ENSBTAP00000053594  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000055414  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000026698  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000017015  ...........HQ...TAk.RGN..SDRALSE........EQE...EQAARQFAAL.....D................
ENSBTAP00000049908  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000021395  ...........NY...LG..IQP..TK-----........---...EQHQALRQQV.....Q................
ENSBTAP00000007194  ...........--...--..---..-------........---...----------.....-................
ENSBTAP00000025455  ...........--...--..---..-------........---...----------.....-................


                                                       80                                           
                                                        |                                           
d1qxpa2               ..............RD.......GNGK.......LG...L.VEFNILW..............................
ENSBTAP00000019411  ..............AD.......GNGT.......ID...F.PEFLTMMarkmkdt.......................
ENSBTAP00000036057  ..............AD.......GNGT.......ID...F.PEFLTMMarkmkdt.......................
ENSBTAP00000038404  ..............AN.......GDGT.......ID...F.REFIIALsvtsrg........................
ENSBTAP00000010971  ..............TN.......SDGT.......ID...F.REFIIALsvtsrg........................
ENSBTAP00000019803  ..............SD.......TTGK.......LG...F.EEFKYLW..............................
ENSBTAP00000014038  ..............TD.......GNGE.......VD...F.KEFIEGVsqfsvkg.......................
ENSBTAP00000002055  ..............AD.......GNGT.......ID...F.PEFLTMMarkmkdt.......................
ENSBTAP00000049731  ..............AD.......GNGT.......ID...F.PEFLTMMarkmkdt.......................
ENSBTAP00000005577  ..............TN.......GDGT.......ID...F.REFIIALsvtsrg........................
ENSBTAP00000034949  ..............AN.......SDGT.......LD...F.KEYVIALhmtsag........................
ENSBTAP00000017447  ..............--.......----.......--...Y.EKFYELTqki...........................
ENSBTAP00000010858  ..............--.......----.......--...-.-------..............................
ENSBTAP00000046644  ..............--.......----.......--...-.-------..............................
ENSBTAP00000022814  ..............KN.......GDGT.......ID...F.REFICALsitsrg........................
ENSBTAP00000019758  ..............LD.......NDKY.......IA...L.DEWAGCF..............................
ENSBTAP00000019321  ..............KN.......GDGT.......ID...F.REFICALsvtsrg........................
ENSBTAP00000011677  ..............TD.......GSGR.......LN...L.QEFHHLW..............................
ENSBTAP00000011680  ..............TD.......GSGR.......LN...L.QEFHHLW..............................
ENSBTAP00000021742  ..............TN.......HDGS.......VS...F.EDFVAGLsvilrg........................
ENSBTAP00000005348  ..............PN.......KDKH.......IT...L.QEWGHCFe.............................
ENSBTAP00000016609  ..............--.......RSES.......IR...P.DEFSL--..............................
ENSBTAP00000012740  ..............--.......----.......--...-.-------..............................
ENSBTAP00000018403  ..............TD.......KNGS.......IS...F.QEFLEAMaaglqt........................
ENSBTAP00000026407  ..............AK.......SARV.......IN...Y.EEFKKALeelapkr.......................
ENSBTAP00000052557  ..............KE.......GTGK.......IS...F.NDFLAVMtqkmaek.......................
ENSBTAP00000054167  ..............TD.......HNGA.......VS...F.EDFIKGLsillrg........................
ENSBTAP00000010319  ..............KE.......GTGK.......MN...F.SDFLTVMtqkmsek.......................
ENSBTAP00000041545  ..............TS.......QSGT.......LE...G.EEFVEFYksl...........................
ENSBTAP00000055204  ..............RE.......NKAG.......VN...F.SEFTGVW..............................
ENSBTAP00000003718  ..............TT.......QTGS.......VK...F.EDFVTALsillrg........................
ENSBTAP00000011676  ..............SN.......GTGS.......LE...L.VEFKTLW..............................
ENSBTAP00000049395  ..............HS.......QTDS.......LE...D.EEIETFYkil...........................
ENSBTAP00000054983  ..............--.......----.......--...-.-------..............................
ENSBTAP00000052219  ..............RD.......MSGT.......MG...F.NEFKELW..............................
ENSBTAP00000025402  ..............KG.......KNDA.......IN...P.EDFPESVyksflmsl......................
ENSBTAP00000011678  ..............RD.......GNGK.......LG...L.VEFNILW..............................
ENSBTAP00000000433  ..............AK.......NART.......IT...F.QQFQEAMkelgqkrfkgk...................
ENSBTAP00000021491  ..............KE.......GIGT.......IS...F.EKFFAIMsvkmsek.......................
ENSBTAP00000044733  ..............SD.......GSGK.......LG...L.KEFYILW..............................
ENSBTAP00000010937  ..............TDe......NQGT.......LT...F.EEFCVFYkmm...........................
ENSBTAP00000056439  ..............TDe......NQGT.......LT...F.EEFCVFYkmm...........................
ENSBTAP00000055780  ..............ED.......GSGT.......VD...F.DEFLVMMvrcmkddskg....................
ENSBTAP00000038002  ..............GD.......AIGY.......EG...F.QQFLKIYlevdn.........................
ENSBTAP00000034705  ..............RS.......KNER.......LEgpeI.EEFLRRL..............................
ENSBTAP00000035936  ..............TN.......GDNT.......ID...F.LEYVAALnlvlrg........................
ENSBTAP00000013699  ..............KT.......KSGR.......ID...V.YGFSALW..............................
ENSBTAP00000002564  ..............--.......----.......--...-.-------..............................
ENSBTAP00000011496  ..............EN.......KDGR.......IE...F.SEFIQALsvtsrg........................
ENSBTAP00000019111  ..............RE.......ATGK.......IT...F.EDFNEVVtdwiler.......................
ENSBTAP00000017036  ..............FN.......KDGY.......ID...F.MEYVAALslvlkg........................
ENSBTAP00000003213  ..............TDd......HQGT.......LG...F.EEFCAFYkmm...........................
ENSBTAP00000055444  ..............TDd......HQGT.......LG...F.EEFCAFYkmm...........................
ENSBTAP00000024550  ..............RD.......YSGK.......MG...F.NEFKELW..............................
ENSBTAP00000015248  ..............--.......--GP.......IN...F.TMFLTMFgeklngt.......................
ENSBTAP00000021328  ..............--.......--GP.......IN...F.TMFLTMFgeklngt.......................
ENSBTAP00000037091  ..............--.......--GP.......IN...F.TMFLTMFgeklngt.......................
ENSBTAP00000029967  ..............--.......SGGK.......VD...F.EDFVELMgpkllaetadm...................
ENSBTAP00000021449  ..............MN.......LGGR.......VD...F.DDFVELMtpkllaetagm...................
ENSBTAP00000053176  ..............--.......-NQT.......ID...F.EGFKLFMktfleae.......................
ENSBTAP00000042361  ..............MN.......LGGH.......VD...F.DDFVELMgpkllaetadm...................
ENSBTAP00000016509  ..............TN.......GDNT.......ID...F.LEYVAALnlvlrg........................
ENSBTAP00000026714  ..............MN.......LGGH.......VD...F.DDFVELMgpkllaetadm...................
ENSBTAP00000004690  ..............KD.......GSGK.......LG...L.REFQVLW..............................
ENSBTAP00000010858  ..............--.......----.......--...-.-------..............................
ENSBTAP00000013117  ..............KS.......RDKTgtd....VI...K.EEFVEVFhel...........................
ENSBTAP00000017574  ..............RL.......KQGR.......IT...I.EEFRTIYrii...........................
ENSBTAP00000004885  ..............VN.......KDGK.......LD...F.EEFMKYLk.............................
ENSBTAP00000008961  ..............LT.......CNDY.......IS...V.FEFDIFT..............................
ENSBTAP00000028063  ..............--.......----.......--...-.-------..............................
ENSBTAP00000012740  ..............--.......----.......--...-.-------..............................
ENSBTAP00000006283  ..............MR.......MGGR.......VD...F.EEFVEMMgpklreetahm...................
ENSBTAP00000014306  ..............SD.......EMNVkv.....LD...F.EHFLPMLqtvaknkdq.....................
ENSBTAP00000053252  ..............KS.......KEKLttr....VT...E.EEFCEAFcel...........................
ENSBTAP00000014304  ..............SD.......EMNVkv.....LD...F.EHFLPMLqtvaknkdq.....................
ENSBTAP00000045669  ..............--.......----.......--...-.-------..............................
ENSBTAP00000041264  ..............LT.......CSGH.......VS...I.FEFDIFTrlf...........................
ENSBTAP00000006711  ..............EG.......GSLKqygphepIS...Y.DVFKLFM..............................
ENSBTAP00000017358  ..............LT.......CNDY.......IS...V.FEFDIFT..............................
ENSBTAP00000053274  ..............--.......----.......--...-.-------..............................
ENSBTAP00000055296  ..............LT.......CNDY.......IS...V.FEFDIFT..............................
ENSBTAP00000016852  ..............KD.......GNGT.......ID...F.NEFLLTLrppmsr........................
ENSBTAP00000036380  ..............ID.......RNGE.......LD...F.STFLTIMhmqikqe.......................
ENSBTAP00000041719  ..............SDel.....KSRR.......VD...F.ETFLPMLqavaklpdr.....................
ENSBTAP00000049636  ..............NEem.....NAKK.......IE...F.EQFLPMLqaisnnkdq.....................
ENSBTAP00000024444  ..............--.......--GP.......IN...F.TVFLQMFgeklkga.......................
ENSBTAP00000004556  ..............MN.......YDLL.......LD...H.SEINAIYld............................
ENSBTAP00000038767  ..............PE.......GEDQ.......VN...F.RGFMRTLahfrpiednekskdvngpepln........
ENSBTAP00000031285  ..............--.......----.......--...-.------Nld............................
ENSBTAP00000011457  ..............KD.......NDGC.......IS...V.TEWVYGLsvflrg........................
ENSBTAP00000011047  ..............QEel.....NSKM.......MD...F.DTFLPMLqhisknkdt.....................
ENSBTAP00000002564  ..............--.......----.......--...-.-------..............................
ENSBTAP00000037104  ..............--.......--GP.......IN...F.TVFLTMFgeklkgt.......................
ENSBTAP00000002672  ..............--.......GKGP.......IN...F.TVFLTLFgeklngt.......................
ENSBTAP00000028269  ..............--.......ASGP.......IN...F.TVFLNMFgeklkga.......................
ENSBTAP00000016647  ..............PD.......GSLR.......LD...F.PGFVRVLahfrpvdeeddgnrdpkepepln.......
ENSBTAP00000004536  ..............TD.......PDGG.......LD...L.EEFILYLq.............................
ENSBTAP00000042177  ..............--.......----.......--...-.-------..............................
ENSBTAP00000028063  ..............--.......----.......--...-.-------..............................
ENSBTAP00000050283  ..............PEem.....NSKM.......LD...F.ETFLPILqhisrnkeq.....................
ENSBTAP00000048539  ..............RN.......NDGT.......ID...F.REYVIGLtvlcnpv.......................
ENSBTAP00000045669  ..............--.......----.......--...-.-------..............................
ENSBTAP00000007972  ..............RD.......GSGT.......LD...L.EEFLRALrppmsq........................
ENSBTAP00000040815  ..............--.......----.......--...-.-------..............................
ENSBTAP00000025661  ..............RN.......HDGS.......ID...F.REYVIGLavlcnpa.......................
ENSBTAP00000028350  ..............RD.......---S.......LS...F.EDFLDLLsvfsdta.......................
ENSBTAP00000053274  ..............--.......----.......--...-.-------..............................
ENSBTAP00000021537  ..............ED.......GDGH.......MT...L.DNFLDMFsvmsema.......................
ENSBTAP00000055481  ..............--.......----.......--...-.-------..............................
ENSBTAP00000039155  ..............CD.......GRGP.......VG...F.PELLGLMawkvkag.......................
ENSBTAP00000029333  ..............--.......----.......--...-.-------..............................
ENSBTAP00000016315  ..............AD.......CDGA.......LT...L.PEFCAAF..............................
ENSBTAP00000021091  ..............LN.......ASGT.......VS...I.QEFRDLW..............................
ENSBTAP00000021618  ..............KD.......GNGY.......LS...F.REFLDILvvfmkg........................
ENSBTAP00000055520  ..............ST.......GTGF.......IK...-.-------..............................
ENSBTAP00000055624  ..............ST.......GTGF.......IK...-.-------..............................
ENSBTAP00000016319  ..............FD.......KDGA.......LT...L.DEFCAAFhlvv..........................
ENSBTAP00000034078  ..............EEe......PTGY.......IR...F.EKFLPVMtevllerryrp...................
ENSBTAP00000006645  ..............FS.......HNNV.......FS...F.EDVLGMAsvfseqa.......................
ENSBTAP00000021909  ..............KN.......ADGF.......ID...L.EEYIGDMyshdgnadep....................
ENSBTAP00000001426  ..............KN.......SDGK.......IE...M.AELAQILpteenfllcfrqhv................
ENSBTAP00000015802  ..............KD.......LDGQ.......LD...F.EEFVHYLq.............................
ENSBTAP00000032680  ..............KD.......LDGQ.......LD...F.EEFVHYLq.............................
ENSBTAP00000055007  ..............ED.......GSGT.......ID...F.EEFLVMMvrqmkedakg....................
ENSBTAP00000020148  ..............LN.......SDGQ.......LD...F.QEFLNLIgglai.........................
ENSBTAP00000052345  ..............--.......----.......--...-.-------..............................
ENSBTAP00000029334  ..............--.......----.......--...-.-------..............................
ENSBTAP00000052345  ..............ID.......HDGM.......LD...R.DEFAVAM..............................
ENSBTAP00000056127  ..............KN.......GDGF.......VD...Q.DEYIADMfsheesgpep....................
ENSBTAP00000012557  ..............TD.......KDGN.......ID...YmSGFQDVHiqkpvkevqsslietvy.............
ENSBTAP00000011888  ..............SD.......GSGT.......IT...L.QELQKALtllihg........................
ENSBTAP00000017060  ..............ID.......KDGH.......LD...R.DEFAVAM..............................
ENSBTAP00000031854  ..............VQ.......KEGR.......MS...Y.ADFVWFLiseedk........................
ENSBTAP00000031823  ..............RN.......KDGY.......VQ...V.EEYIADLytaepgeeep....................
ENSBTAP00000021603  ..............KD.......GNGY.......LS...F.REFLDVLvvfmkg........................
ENSBTAP00000010838  ..............KN.......KDRK.......ID...F.SEFLSLL..............................
ENSBTAP00000014575  ..............ED.......GEGN.......LT...F.NDFVDMFsvlcesa.......................
ENSBTAP00000011215  ..............VQ.......KEGR.......MS...Y.ADFVWFLiseedk........................
ENSBTAP00000053698  ..............MD.......GDGQ.......VD...F.DEFMTILgpklvssegrdgflg...............
ENSBTAP00000006806  ..............EN.......GDGE.......VD...F.QEYVVLV..............................
ENSBTAP00000029334  ..............LN.......KDGK.......MD...Q.QEFSIAM..............................
ENSBTAP00000044105  ..............KN.......KDKK.......ID...F.SEFLSLL..............................
ENSBTAP00000026904  ..............AN.......KDNE.......VD...F.NEFVVMV..............................
ENSBTAP00000017060  ..............--.......----.......--...-.-------..............................
ENSBTAP00000055520  ..............--.......----.......--...-.-------..............................
ENSBTAP00000044226  ..............EN.......GDGE.......VD...F.QEYVVLV..............................
ENSBTAP00000055624  ..............--.......----.......--...-.-------..............................
ENSBTAP00000042182  ..............--.......HGGS.......LD...L.YHFQQLW..............................
ENSBTAP00000010796  ..............LK.......NNGK.......FA...Y.CSFIQSCvlllkaketslmqrmkiqnankmkeagaet
ENSBTAP00000021174  ..............QR.......DDGK.......IG...I.VELAHVLpteenflllfrcqql...............
ENSBTAP00000006275  ..............SD.......GDGE.......CD...F.QEFMAFV..............................
ENSBTAP00000020950  ..............KD.......GDGF.......VS...L.EEFLGDYrrdptasedpe...................
ENSBTAP00000053738  ..............LK.......NNGK.......FA...Y.CSFIQSCvlllkaketslmqrmkiqnankmkeagaet
ENSBTAP00000004963  ..............KD.......NDNY.......IN...V.KEWVKGLsvflrg........................
ENSBTAP00000023774  ..............MD.......GDGQ.......VD...F.EEFVTLLgpklstsgipek..................
ENSBTAP00000020395  ..............PN.......RDGH.......VS...L.QEYMAFMisretenv......................
ENSBTAP00000020150  ..............QC.......RDGK.......VG...F.QSFFSLI..............................
ENSBTAP00000025561  ..............CN.......KDNE.......VD...F.QEYCVFL..............................
ENSBTAP00000053738  ..............LR.......LSIT.......LN...F.REFRNLCekrsfsadddapqrlprpkqkvadselace
ENSBTAP00000034009  ..............AD.......KDGA.......VS...F.EEFVVLV..............................
ENSBTAP00000020539  ..............SL.......TDNK.......LA...Y.KSWLENLakeklsqqniqsslletly...........
ENSBTAP00000020778  ..............QD.......GDKK.......LS...L.SEFISLPvgtvenqqgqdvdd................
ENSBTAP00000017461  ..............PN.......TSG-.......IR...L.KEFLDIVrkkkeaq.......................
ENSBTAP00000044096  ..............TN.......VDKQ.......LS...F.EEFIMLVarltv.........................
ENSBTAP00000008523  ..............TN.......VDKQ.......LS...F.EEFIMLVarltv.........................
ENSBTAP00000035196  ..............SDgv.....ADGG.......LT...L.KGFLFLHtlfiqrgrhettwtvlrrfgydddldltpe
ENSBTAP00000041997  ..............ID.......KDGM.......LD...D.EEFALA-..............................
ENSBTAP00000025499  ..............--.......----.......-D...H.KKFFQMVglkk..........................
ENSBTAP00000055481  ..............MN.......NDGR.......MD...Q.VEFSIAM..............................
ENSBTAP00000002174  ..............VD.......RDGL.......LD...D.EEFALA-..............................
ENSBTAP00000000589  ..............--.......----.......--...-.-------..............................
ENSBTAP00000028239  ..............VD.......RDGM.......LD...D.EEFALAS..............................
ENSBTAP00000014894  ..............PN.......HSGL.......VT...F.QAFIDFMsrettdt.......................
ENSBTAP00000026544  ..............KN.......KDGR.......LD...L.NDLARILalqenfllqfkmdacsse............
ENSBTAP00000029333  ..............MN.......NDGR.......MD...Q.VEFSIAM..............................
ENSBTAP00000041966  ..............LK.......VNGR.......LD...Q.EEFSRLW..............................
ENSBTAP00000008933  ..............--.......----.......--...-.-------..............................
ENSBTAP00000056088  ..............AD.......KDGA.......VS...F.EEFVVLV..............................
ENSBTAP00000033794  ..............KN.......QDNQ.......IC...F.EEFLYILgklvk.........................
ENSBTAP00000012786  ..............PN.......GQGT.......VT...F.QSFIDFMtretadt.......................
ENSBTAP00000030018  ..............PN.......AAGV.......VT...F.QAFIDFMtretaet.......................
ENSBTAP00000040233  ..............LT.......SSGA.......VP...Y.LVFLSRFggidlninvikrggenemngcrtlkdleaq
ENSBTAP00000003365  ..............TS.......QTAK.......LN...F.DDFCIILrkekp.........................
ENSBTAP00000053176  ..............--.......----.......--...-.-----YLsllerg........................
ENSBTAP00000024301  ..............PN.......RLGV.......VT...F.QAFIDFMsretadt.......................
ENSBTAP00000022292  ..............QT.......KDGL.......IS...Y.QEFLAFEsvlc..........................
ENSBTAP00000015611  ..............RD.......HDRR.......LD...F.TEFLLMV..............................
ENSBTAP00000012770  ..............LT.......YDGE.......MD...Y.KTYLDFVlalenr........................
ENSBTAP00000000847  ..............KN.......SDQE.......ID...F.KEYSVFL..............................
ENSBTAP00000053738  ..............LT.......SSGA.......VP...Y.LVFLSRFggidlninvikrggenemngcrtlkdleaq
ENSBTAP00000054975  ..............--.......----.......--...-.-------..............................
ENSBTAP00000046639  ..............SS.......GNGR.......AD...Y.GEFKRAIigemne........................
ENSBTAP00000052345  ..............TD.......GKGI.......LN...K.QEFFVAL..............................
ENSBTAP00000053164  ..............--.......----.......--...-.-------..............................
ENSBTAP00000016774  ..............IN.......QDGG.......IN...F.EEFLVLV..............................
ENSBTAP00000022630  ..............KN.......GDGE.......VS...F.EEFQVLV..............................
ENSBTAP00000010796  ..............LH.......LTPY.......IN...W.KYFLQNFssyveetavewaekmprgprplspkemanq
ENSBTAP00000021909  ..............LN.......QDGL.......IS...W.DEYRNVTygtylddpdpddgfnyk.............
ENSBTAP00000033974  ..............RV.......KKGF.......FN...C.SNLLALMglywekaq......................
ENSBTAP00000006711  ..............--.......----.......--...-.-------..............................
ENSBTAP00000010796  ..............SE.......GRGH.......IT...Y.QEFLQKLginysadihrpyaeeyfnfmghftkpqqvq
ENSBTAP00000004912  ..............QT.......KDGL.......IS...F.QEFVAFEsvlc..........................
ENSBTAP00000005979  ..............KNvvggv..RDDQ.......LT...L.DGFLFLNtlfiqrgrhettwtilrrfgygdsleltad
ENSBTAP00000053738  ..............LH.......LTPY.......IN...W.KYFLQNFssyveetavewaekmprgprplspkemanq
ENSBTAP00000053746  ..............--.......---E.......IN...F.EDFLTIMsyfrpidttmdeeqvql.............
ENSBTAP00000023221  ..............--.......----.......--...-.-------..............................
ENSBTAP00000019429  ..............ED.......FDGK.......LS...F.REFLLIF..............................
ENSBTAP00000052019  ..............RN.......RNEH.......VD...F.HEYLLMV..............................
ENSBTAP00000042244  ..............ED.......FDSK.......LS...F.REFLLIF..............................
ENSBTAP00000053738  ..............PG.......CTGC.......VN...V.SRFIELIeespklhkipaykdtkmplflawdsveeii
ENSBTAP00000018877  ..............AN.......HDGR.......IS...F.DEYWTLI..............................
ENSBTAP00000053019  ..............NN.......KDSR.......IS...F.EEFVSLMqe............................
ENSBTAP00000003073  ..............TN.......QDRL.......VT...L.EEFLA--..............................
ENSBTAP00000012886  ..............--.......----.......--...-.-------..............................
ENSBTAP00000044222  ..............TN.......KDCQ.......VD...F.VEYMRLLa.............................
ENSBTAP00000028499  ..............VN.......QDSE.......LK...F.SEYWRLI..............................
ENSBTAP00000047378  ..............NN.......QFAR.......VN...F.EEFKDGFiavls.........................
ENSBTAP00000009308  ..............LD.......QDGK.......IS...F.DEFIKVFhg............................
ENSBTAP00000017060  ..............PE.......GKGY.......LD...K.QGFYVAL..............................
ENSBTAP00000050406  ..............RN.......KDGK.......IS...F.DEFVYIFqe............................
ENSBTAP00000031879  ..............RN.......KDGK.......IS...F.DEFVYIFqe............................
ENSBTAP00000031854  ..............KP.......SCSS.......LE...Q.DDFIPLLqdvvdthpgltflkdapefhsr........
ENSBTAP00000001250  ..............EG.......GGGE.......VD...L.REYVVALsvvcrpa.......................
ENSBTAP00000026035  ..............ED.......DTGT.......VE...F.KEFLVLV..............................
ENSBTAP00000011215  ..............KP.......SCSS.......LE...Q.DDFIPLLqdvvdthpgltflkdapefhsr........
ENSBTAP00000002128  ..............RN.......ENGM.......VK...L.DDFVSAVskeqnl........................
ENSBTAP00000053194  ..............PE.......RKGY.......IS...K.DEYIDFLtdkeseni......................
ENSBTAP00000056127  ..............RD.......KDDK.......IS...W.EEYKQATygyylgnptefqdtsdhhtfk.........
ENSBTAP00000033188  ..............--.......----.......--...-.------Mn.............................
ENSBTAP00000053548  ..............--.......----.......--...-.----RWMn.............................
ENSBTAP00000011687  ..............WN.......AVGE.......IG...F.DQFYMLVcillaqenhleeq.................
ENSBTAP00000007636  ..............KHfk.....EGKG.......LT...F.QEVENFFtfl...........................
ENSBTAP00000020950  ..............KN.......SDGS.......VS...W.DEYNIQMydrvidfventald................
ENSBTAP00000009115  ..............--.......----.......--...-.-------..............................
ENSBTAP00000023873  ..............AD.......GNGA.......IR...F.E------..............................
ENSBTAP00000054471  ..............AD.......GNGF.......LT...P.EEFTTGF..............................
ENSBTAP00000039694  ..............IP.......EEKG.......IT...F.DEFRSFFqfl...........................
ENSBTAP00000025205  ..............AD.......GNGF.......LT...P.EEFTTGF..............................
ENSBTAP00000047882  ..............--.......----.......--...-.-------..............................
ENSBTAP00000001368  ..............VD.......GDGH.......IS...Q.EEFQIIR..............................
ENSBTAP00000029786  ..............EN.......GDSL.......IN...F.REFVSGLsaachg........................
ENSBTAP00000028993  ..............AD.......RDGA.......IT...F.QEFAR--..............................
ENSBTAP00000023678  ..............--.......----.......--...-.-------..............................
ENSBTAP00000034710  ..............LD.......GDGT.......VS...F.KDFLGVLtds...........................
ENSBTAP00000031823  ..............TD.......RDGR.......VG...W.EELRNATyghyepgeefhdvedaetyk..........
ENSBTAP00000038002  ..............--.......----.......--...-.-------..............................
ENSBTAP00000021074  ..............ID.......SNGA.......IS...F.DEFVLAI..............................
ENSBTAP00000026544  ..............VS.......KDGC.......IQ...M.KELAGMFlsedenflllfrqetpl.............
ENSBTAP00000007217  ..............MKglq....RSQI.......LP...T.EEYEEAMg.............................
ENSBTAP00000029792  ..............EN.......KDSL.......IN...F.KEFVTGMsgmyhg........................
ENSBTAP00000044088  ..............LS.......AGEN.......IS...L.EEFKSFChfa...........................
ENSBTAP00000017319  ..............EH.......TENK.......LD...F.EDFMVLL..............................
ENSBTAP00000044100  ..............HD.......HDGY.......IS...Q.EDFESIA..............................
ENSBTAP00000033594  ..............ED.......KDGF.......IS...A.REF----..............................
ENSBTAP00000026766  ..............EN.......RDNH.......ID...F.KEISCGL..............................
ENSBTAP00000055894  ..............--.......----.......--...-.-------..............................
ENSBTAP00000015220  ..............LN.......KDGE.......VP...V.EEFSTFIkaqvsegkgrllpgq...............
ENSBTAP00000033613  ..............KD.......GDGE.......VL...L.EEFSEYIhaqvasgkgklapgf...............
ENSBTAP00000056320  ..............VQ.......KEGK.......IS...Y.ADFVWFLiseed.........................
ENSBTAP00000025249  ..............--.......----.......--...-.-------..............................
ENSBTAP00000029159  ..............HD.......QDGY.......IS...Q.EEFEKIA..............................
ENSBTAP00000044088  tenkdvywknvrekLS.......AGEN.......IS...L.EEFKSFChfa...........................
ENSBTAP00000016319  ..............AT.......RLGY.......FG...R.SQFYIAL..............................
ENSBTAP00000017662  ..............--.......----.......--...-.-------..............................
ENSBTAP00000012479  ..............RG.......SSPEm......VN...Y.EKLLWFLkvaasedteqnkgvedsnvketqssshqss
ENSBTAP00000029886  ..............QE.......NNKL.......--...-.-------..............................
ENSBTAP00000027388  ..............--.......----.......--...-.-------..............................
ENSBTAP00000039694  ..............LK.......EKGV.......IS...Y.TEYLFLLcilt..........................
ENSBTAP00000023673  ..............--.......----.......--...-.-------..............................
ENSBTAP00000041488  ..............--.......----.......--...-.-------..............................
ENSBTAP00000001452  ..............HD.......GDGF.......IS...S.KEYN---..............................
ENSBTAP00000028498  ..............NC.......NDSK.......LE...F.GSFWEL-..............................
ENSBTAP00000001426  ..............LN.......GDGK.......LG...L.SEMSRLLpvqenfllkfqgmk................
ENSBTAP00000020240  ..............--.......----.......--...-.-------..............................
ENSBTAP00000053650  ..............--.......----.......--...-.-------..............................
ENSBTAP00000041651  ..............--.......----.......--...-.-------..............................
ENSBTAP00000005154  ..............KN.......DDGK.......LS...F.EEFQNYF..............................
ENSBTAP00000021174  ..............--.......----.......--...-.-------..............................
ENSBTAP00000022068  ..............PS.......GLGV.......IS...F.EDFYRGI..............................
ENSBTAP00000026682  ..............RQ.......GGGK.......LN...F.DELRQDLkgkg..........................
ENSBTAP00000007636  ..............KHfk.....EGKG.......LT...F.QEVENFFtfl...........................
ENSBTAP00000027954  ..............--.......----.......--...-.-------..............................
ENSBTAP00000020778  ..............PD.......GDGH.......VS...W.DEYK---..............................
ENSBTAP00000013601  ..............RT.......TPGK.......LT...K.EELYAVL..............................
ENSBTAP00000005477  ..............FSeyvdtgkLTDK.......IN...L.PDFFKVYlnhrppfg......................
ENSBTAP00000055305  ..............--.......----.......--...-.-------..............................
ENSBTAP00000036054  ..............--.......----.......--...-.-------..............................
ENSBTAP00000004912  ..............GT.......TSHQ.......VS...F.SYFNGFNsll...........................
ENSBTAP00000022292  ..............HN.......RKKH.......LN...Y.TEFTQFLqe............................
ENSBTAP00000002717  ..............RP.......DASA.......VH...L.HDFQRFLlheqqelwa.....................
ENSBTAP00000036015  ..............DD.......DDGP.......VS...S.QGYMPYLnkyildkveegafvk...............
ENSBTAP00000051638  ..............EN.......SDCL.......IN...F.KEFSSAIdimyng........................
ENSBTAP00000026766  ..............--.......----.......--...-.------Lvlltrg........................
ENSBTAP00000053738  ..............--.......----.......--...-.------Tekampardklk...................
ENSBTAP00000016306  ..............--.......----.......--...-.-------..............................
ENSBTAP00000013714  ..............PE.......GLGI.......IL...L.GPF----..............................
ENSBTAP00000036550  ..............EN.......MDHL.......IE...F.KAFVSCLdimyng........................
ENSBTAP00000053738  ..............--.......----.......--...-.-------..............................
ENSBTAP00000023383  ..............--.......RTSD.......IT...Y.GQFAQLY..............................
ENSBTAP00000027030  ..............--.......PDGM.......MS...V.EDFFYGLfkngkpltpsas..................
ENSBTAP00000053270  ..............--.......PDGM.......MS...V.EDFFYGLfkngkpltpsas..................
ENSBTAP00000054640  ..............--.......PDGM.......MS...V.EDFFYGLfkngkpltpsas..................
ENSBTAP00000012770  ..............TD.......SYGR.......IS...I.MQFFNYVmrk...........................
ENSBTAP00000009967  ..............VT.......NSES.......VD...W.RKFLLVValpwpiple.....................
ENSBTAP00000015183  ..............--.......----.......MS...R.EEFVQRMteivgw........................
ENSBTAP00000014222  ..............--.......GEQE.......IQ...F.EDFTNTLrelehte.......................
ENSBTAP00000026288  ..............KV.......RGGG.......VN...I.NEFFKG-..............................
ENSBTAP00000002128  ..............--.......----.......--...-.------Lkiflyi........................
ENSBTAP00000003365  ..............--.......----.......--...-.-------..............................
ENSBTAP00000053738  ..............--.......----.......--...-.------Fclels.........................
ENSBTAP00000009228  ..............AD.......ENEM.......IN...C.EEFAN--..............................
ENSBTAP00000026785  ..............--.......----.......--...-.-------..............................
ENSBTAP00000002578  ..............DD.......DEGP.......VS...N.QGYMPYLnk............................
ENSBTAP00000000106  ..............SD.......GDGR.......YS...F.LELRAA-..............................
ENSBTAP00000028840  ..............--.......----.......--...-.-------..............................
ENSBTAP00000053594  ..............--.......----.......VT...L.EQFGELLeargag........................
ENSBTAP00000055414  ..............--.......----.......--...-.-------..............................
ENSBTAP00000026698  ..............--.......--RR.......IS...Q.EEFAKQLql............................
ENSBTAP00000017015  ..............PE.......HRGH.......VE...W.PDFLS--..............................
ENSBTAP00000049908  ..............--.......----.......--...-.-------..............................
ENSBTAP00000021395  ..............VD.......TKGT.......VS...F.GDFVHV-..............................
ENSBTAP00000007194  ..............--.......----.......--...-.-------..............................
ENSBTAP00000025455  ..............--.......----.......--...-.-------..............................


                                                   90                                               
                                                    |                                               
d1qxpa2               ..............................NRI.............................................
ENSBTAP00000019411  ..............................DSE.............................................
ENSBTAP00000036057  ..............................DSE.............................................
ENSBTAP00000038404  ..............................KLE.............................................
ENSBTAP00000010971  ..............................RLE.............................................
ENSBTAP00000019803  ..............................NNI.............................................
ENSBTAP00000014038  ..............................DKE.............................................
ENSBTAP00000002055  ..............................DSE.............................................
ENSBTAP00000049731  ..............................DSE.............................................
ENSBTAP00000005577  ..............................KLE.............................................
ENSBTAP00000034949  ..............................KTN.............................................
ENSBTAP00000017447  ..............................CPR.............................................
ENSBTAP00000010858  ..............................---.............................................
ENSBTAP00000046644  ..............................CPR.............................................
ENSBTAP00000022814  ..............................SFE.............................................
ENSBTAP00000019758  ..............................---.............................................
ENSBTAP00000019321  ..............................SFE.............................................
ENSBTAP00000011677  ..............................KKI.............................................
ENSBTAP00000011680  ..............................KKI.............................................
ENSBTAP00000021742  ..............................TTD.............................................
ENSBTAP00000005348  ..............................I--.............................................
ENSBTAP00000016609  ..............................---.............................................
ENSBTAP00000012740  ..............................CVD.............................................
ENSBTAP00000018403  ..............................SDT.............................................
ENSBTAP00000026407  ..............................F--.............................................
ENSBTAP00000052557  ..............................DTK.............................................
ENSBTAP00000054167  ..............................TVQ.............................................
ENSBTAP00000010319  ..............................DTK.............................................
ENSBTAP00000041545  ..............................TQR.............................................
ENSBTAP00000055204  ..............................KYI.............................................
ENSBTAP00000003718  ..............................TVH.............................................
ENSBTAP00000011676  ..............................LKI.............................................
ENSBTAP00000049395  ..............................TQR.............................................
ENSBTAP00000054983  ..............................---.............................................
ENSBTAP00000052219  ..............................AVL.............................................
ENSBTAP00000025402  ..............................CPR.............................................
ENSBTAP00000011678  ..............................NRI.............................................
ENSBTAP00000000433  ..............................SPD.............................................
ENSBTAP00000021491  ..............................DEK.............................................
ENSBTAP00000044733  ..............................TKI.............................................
ENSBTAP00000010937  ..............................SLR.............................................
ENSBTAP00000056439  ..............................SLR.............................................
ENSBTAP00000055780  ..............................KSE.............................................
ENSBTAP00000038002  ..............................VPD.............................................
ENSBTAP00000034705  ..............................LKR.............................................
ENSBTAP00000035936  ..............................TLE.............................................
ENSBTAP00000013699  ..............................KFI.............................................
ENSBTAP00000002564  ..............................VTL.............................................
ENSBTAP00000011496  ..............................TLD.............................................
ENSBTAP00000019111  ..............................DPH.............................................
ENSBTAP00000017036  ..............................KVE.............................................
ENSBTAP00000003213  ..............................STR.............................................
ENSBTAP00000055444  ..............................STR.............................................
ENSBTAP00000024550  ..............................AAL.............................................
ENSBTAP00000015248  ..............................DPE.............................................
ENSBTAP00000021328  ..............................DPE.............................................
ENSBTAP00000037091  ..............................DPE.............................................
ENSBTAP00000029967  ..............................IGV.............................................
ENSBTAP00000021449  ..............................IGV.............................................
ENSBTAP00000053176  ..............................L--.............................................
ENSBTAP00000042361  ..............................IGV.............................................
ENSBTAP00000016509  ..............................TLE.............................................
ENSBTAP00000026714  ..............................IGV.............................................
ENSBTAP00000004690  ..............................RKI.............................................
ENSBTAP00000010858  ..............................---.............................................
ENSBTAP00000013117  ..............................CTR.............................................
ENSBTAP00000017574  ..............................TYR.............................................
ENSBTAP00000004885  ..............................DHE.............................................
ENSBTAP00000008961  ..............................RLF.............................................
ENSBTAP00000028063  ..............................---.............................................
ENSBTAP00000012740  ..............................---.............................................
ENSBTAP00000006283  ..............................LGL.............................................
ENSBTAP00000014306  ..............................GTY.............................................
ENSBTAP00000053252  ..............................CTR.............................................
ENSBTAP00000014304  ..............................GTY.............................................
ENSBTAP00000045669  ..............................---.............................................
ENSBTAP00000041264  ..............................Q--.............................................
ENSBTAP00000006711  ..............................---.............................................
ENSBTAP00000017358  ..............................R--.............................................
ENSBTAP00000053274  ..............................---.............................................
ENSBTAP00000055296  ..............................R--.............................................
ENSBTAP00000016852  ..............................ARK.............................................
ENSBTAP00000036380  ..............................DPK.............................................
ENSBTAP00000041719  ..............................GSY.............................................
ENSBTAP00000049636  ..............................GTY.............................................
ENSBTAP00000024444  ..............................DPE.............................................
ENSBTAP00000004556  ..............................KYE.............................................
ENSBTAP00000038767  ..............................SRS.............................................
ENSBTAP00000031285  ..............................KYE.............................................
ENSBTAP00000011457  ..............................TLE.............................................
ENSBTAP00000011047  ..............................GTY.............................................
ENSBTAP00000002564  ..............................---.............................................
ENSBTAP00000037104  ..............................DPE.............................................
ENSBTAP00000002672  ..............................DPE.............................................
ENSBTAP00000028269  ..............................DPE.............................................
ENSBTAP00000016647  ..............................SRM.............................................
ENSBTAP00000004536  ..............................ERE.............................................
ENSBTAP00000042177  ..............................--E.............................................
ENSBTAP00000028063  ..............................---.............................................
ENSBTAP00000050283  ..............................GTY.............................................
ENSBTAP00000048539  ..............................NTE.............................................
ENSBTAP00000045669  ..............................---.............................................
ENSBTAP00000007972  ..............................ARE.............................................
ENSBTAP00000040815  ..............................---.............................................
ENSBTAP00000025661  ..............................NTE.............................................
ENSBTAP00000028350  ..............................TPD.............................................
ENSBTAP00000053274  ..............................---.............................................
ENSBTAP00000021537  ..............................PRD.............................................
ENSBTAP00000055481  ..............................-SR.............................................
ENSBTAP00000039155  ..............................DSE.............................................
ENSBTAP00000029333  ..............................-SR.............................................
ENSBTAP00000016315  ..............................---.............................................
ENSBTAP00000021091  ..............................KQL.............................................
ENSBTAP00000021618  ..............................SPE.............................................
ENSBTAP00000055520  ..............................---.............................................
ENSBTAP00000055624  ..............................---.............................................
ENSBTAP00000016319  ..............................A--.............................................
ENSBTAP00000034078  ..............................IPE.............................................
ENSBTAP00000006645  ..............................CPS.............................................
ENSBTAP00000021909  ..............................EWV.............................................
ENSBTAP00000001426  ..............................GSS.............................................
ENSBTAP00000015802  ..............................DHE.............................................
ENSBTAP00000032680  ..............................DHE.............................................
ENSBTAP00000055007  ..............................KTE.............................................
ENSBTAP00000020148  ..............................A--.............................................
ENSBTAP00000052345  ..............................---.............................................
ENSBTAP00000029334  ..............................--R.............................................
ENSBTAP00000052345  ..............................---.............................................
ENSBTAP00000056127  ..............................DWV.............................................
ENSBTAP00000012557  ..............................RYR.............................................
ENSBTAP00000011888  ..............................SPM.............................................
ENSBTAP00000017060  ..............................---.............................................
ENSBTAP00000031854  ..............................RNP.............................................
ENSBTAP00000031823  ..............................AWV.............................................
ENSBTAP00000021603  ..............................SPE.............................................
ENSBTAP00000010838  ..............................---.............................................
ENSBTAP00000014575  ..............................PRE.............................................
ENSBTAP00000011215  ..............................RNP.............................................
ENSBTAP00000053698  ..............................NTI.............................................
ENSBTAP00000006806  ..............................---.............................................
ENSBTAP00000029334  ..............................KLI.............................................
ENSBTAP00000044105  ..............................---.............................................
ENSBTAP00000026904  ..............................---.............................................
ENSBTAP00000017060  ..............................---.............................................
ENSBTAP00000055520  ..............................---.............................................
ENSBTAP00000044226  ..............................---.............................................
ENSBTAP00000055624  ..............................---.............................................
ENSBTAP00000042182  ..............................GHL.............................................
ENSBTAP00000010796  ...............csfysallriqpkivHCW.............................................
ENSBTAP00000021174  ..............................KSC.............................................
ENSBTAP00000006275  ..............................AM-.............................................
ENSBTAP00000020950  ..............................WIL.............................................
ENSBTAP00000053738  ...............csfysallriqpkivHCW.............................................
ENSBTAP00000004963  ..............................TFE.............................................
ENSBTAP00000023774  ..............................FHG.............................................
ENSBTAP00000020395  ..............................KSS.............................................
ENSBTAP00000020150  ..............................---.............................................
ENSBTAP00000025561  ..............................SCI.............................................
ENSBTAP00000053738  ...................qahqylvtkakTRW.............................................
ENSBTAP00000034009  ..............................S--.............................................
ENSBTAP00000020539  ..............................RNR.............................................
ENSBTAP00000020778  ..............................SWV.............................................
ENSBTAP00000017461  ..............................LYR.............................................
ENSBTAP00000044096  ..............................A--.............................................
ENSBTAP00000008523  ..............................A--.............................................
ENSBTAP00000035196  ............ylfpllkippdcttelnhHAY.............................................
ENSBTAP00000041997  ..............................---.............................................
ENSBTAP00000025499  ..............................KSP.............................................
ENSBTAP00000055481  ..............................KLI.............................................
ENSBTAP00000002174  ..............................---.............................................
ENSBTAP00000000589  ..............................---.............................................
ENSBTAP00000028239  ..............................---.............................................
ENSBTAP00000014894  ..............................DTA.............................................
ENSBTAP00000026544  ..............................ERK.............................................
ENSBTAP00000029333  ..............................KLI.............................................
ENSBTAP00000041966  ..............................SRL.............................................
ENSBTAP00000008933  ..............................---.............................................
ENSBTAP00000056088  ..............................---.............................................
ENSBTAP00000033794  ..............................D--.............................................
ENSBTAP00000012786  ..............................DTA.............................................
ENSBTAP00000030018  ..............................DTA.............................................
ENSBTAP00000040233  ........................vgekifKNI.............................................
ENSBTAP00000003365  ..............................TSK.............................................
ENSBTAP00000053176  ..............................RPE.............................................
ENSBTAP00000024301  ..............................DTA.............................................
ENSBTAP00000022292  ..............................APD.............................................
ENSBTAP00000015611  ..............................---.............................................
ENSBTAP00000012770  ..............................KEP.............................................
ENSBTAP00000000847  ..............................TTL.............................................
ENSBTAP00000053738  ........................vgekifKNI.............................................
ENSBTAP00000054975  ..............................--A.............................................
ENSBTAP00000046639  ..............................YRK.............................................
ENSBTAP00000052345  ..............................---.............................................
ENSBTAP00000053164  ..............................-NF.............................................
ENSBTAP00000016774  ..............................---.............................................
ENSBTAP00000022630  ..............................---.............................................
ENSBTAP00000010796  ...................ellarlhkavtSHY.............................................
ENSBTAP00000021909  ..............................QMM.............................................
ENSBTAP00000033974  ..............................NQE.............................................
ENSBTAP00000006711  ..............................RPQ.............................................
ENSBTAP00000010796  .........eelkelqqstekampardklkDHD.............................................
ENSBTAP00000004912  ..............................APD.............................................
ENSBTAP00000005979  ............ylcpplrvppgcsaelnhRGY.............................................
ENSBTAP00000053738  ...................ellarlhkavtSHY.............................................
ENSBTAP00000053746  ..............................CRK.............................................
ENSBTAP00000023221  ..............................---.............................................
ENSBTAP00000019429  ..............................---.............................................
ENSBTAP00000052019  ..............................---.............................................
ENSBTAP00000042244  ..............................---.............................................
ENSBTAP00000053738  .........................hdsiaKNL.............................................
ENSBTAP00000018877  ..............................---.............................................
ENSBTAP00000053019  ..............................LKS.............................................
ENSBTAP00000003073  ..............................---.............................................
ENSBTAP00000012886  ..............................---.............................................
ENSBTAP00000044222  ..............................C--.............................................
ENSBTAP00000028499  ..............................---.............................................
ENSBTAP00000047378  ..............................S-Qsglassdedsgslesvasravppkyvsgskwygrrshpepcgaag
ENSBTAP00000009308  ..............................LKS.............................................
ENSBTAP00000017060  ..............................---.............................................
ENSBTAP00000050406  ..............................VKS.............................................
ENSBTAP00000031879  ..............................VKS.............................................
ENSBTAP00000031854  ..............................YIT.............................................
ENSBTAP00000001250  ..............................RTL.............................................
ENSBTAP00000026035  ..............................---.............................................
ENSBTAP00000011215  ..............................YIT.............................................
ENSBTAP00000002128  ..............................PEY.............................................
ENSBTAP00000053194  ..............................RSS.............................................
ENSBTAP00000056127  ..............................KML.............................................
ENSBTAP00000033188  ..............................HKK.............................................
ENSBTAP00000053548  ..............................HKK.............................................
ENSBTAP00000011687  ..............................FIF.............................................
ENSBTAP00000007636  ..............................KNI.............................................
ENSBTAP00000020950  ..............................DAE.............................................
ENSBTAP00000009115  ..............................---.............................................
ENSBTAP00000023873  ..............................---.............................................
ENSBTAP00000054471  ..............................---.............................................
ENSBTAP00000039694  ..............................NNL.............................................
ENSBTAP00000025205  ..............................---.............................................
ENSBTAP00000047882  ..............................---.............................................
ENSBTAP00000001368  ..............................GNF.............................................
ENSBTAP00000029786  ..............................DLT.............................................
ENSBTAP00000028993  ..............................---.............................................
ENSBTAP00000023678  ..............................PCR.............................................
ENSBTAP00000034710  ..............................H--.............................................
ENSBTAP00000031823  ..............................KML.............................................
ENSBTAP00000038002  ..............................RPE.............................................
ENSBTAP00000021074  ..............................---.............................................
ENSBTAP00000026544  ..............................DSS.............................................
ENSBTAP00000007217  ..............................TMQ.............................................
ENSBTAP00000029792  ..............................DLT.............................................
ENSBTAP00000044088  ..............................THL.............................................
ENSBTAP00000017319  ..............................---.............................................
ENSBTAP00000044100  ..............................ANF.............................................
ENSBTAP00000033594  ..............................---.............................................
ENSBTAP00000026766  ..............................---.............................................
ENSBTAP00000055894  ..............................--L.............................................
ENSBTAP00000015220  ..............................DPE.............................................
ENSBTAP00000033613  ..............................DAE.............................................
ENSBTAP00000056320  ..............................KKT.............................................
ENSBTAP00000025249  ..............................---.............................................
ENSBTAP00000029159  ..............................---.............................................
ENSBTAP00000044088  ..............................THL.............................................
ENSBTAP00000016319  ..............................KLV.............................................
ENSBTAP00000017662  ..............................KQE.............................................
ENSBTAP00000012479  iapqdynsqsevnesllevlkmalratkakLNI.............................................
ENSBTAP00000029886  ..............................---.............................................
ENSBTAP00000027388  ..............................-KL.............................................
ENSBTAP00000039694  ..............................KPH.............................................
ENSBTAP00000023673  ..............................---.............................................
ENSBTAP00000041488  ..............................---.............................................
ENSBTAP00000001452  ..............................---.............................................
ENSBTAP00000028498  ..............................---.............................................
ENSBTAP00000001426  ..............................LTS.............................................
ENSBTAP00000020240  ..............................---.............................................
ENSBTAP00000053650  ..............................---.............................................
ENSBTAP00000041651  ..............................SRE.............................................
ENSBTAP00000005154  ..............................---.............................................
ENSBTAP00000021174  ..............................---.............................................
ENSBTAP00000022068  ..............................---.............................................
ENSBTAP00000026682  ..............................HTD.............................................
ENSBTAP00000007636  ..............................KNI.............................................
ENSBTAP00000027954  ..............................---.............................................
ENSBTAP00000020778  ..............................---.............................................
ENSBTAP00000013601  ..............................---.............................................
ENSBTAP00000005477  ..............................NTM.............................................
ENSBTAP00000055305  ..............................---.............................................
ENSBTAP00000036054  ..............................---.............................................
ENSBTAP00000004912  ..............................NNM.............................................
ENSBTAP00000022292  ..............................LQL.............................................
ENSBTAP00000002717  ..............................Q--.............................................
ENSBTAP00000036015  ..............................E--.............................................
ENSBTAP00000051638  ..............................SFT.............................................
ENSBTAP00000026766  ..............................RDE.............................................
ENSBTAP00000053738  ..............................DHD.............................................
ENSBTAP00000016306  ..............................---.............................................
ENSBTAP00000013714  ..............................---.............................................
ENSBTAP00000036550  ..............................EMN.............................................
ENSBTAP00000053738  ..............................---.............................................
ENSBTAP00000023383  ..............................---.............................................
ENSBTAP00000027030  ..............................T-Pyrqlkrhismqsfdesgrrttapsammstigfrvfsclddgmgya
ENSBTAP00000053270  ..............................T-Pyrqlkrhismqsfdesgrrttapsammstigfrvfsclddgmgya
ENSBTAP00000054640  ..............................T-Pyrqlkrhismqsfdesgrrttapsammstigfrvfsclddgmgya
ENSBTAP00000012770  ..............................VWL.............................................
ENSBTAP00000009967  ..............................EEL.............................................
ENSBTAP00000015183  ..............................GTE.............................................
ENSBTAP00000014222  ..............................HET.............................................
ENSBTAP00000026288  ..............................---.............................................
ENSBTAP00000002128  ..............................LYF.............................................
ENSBTAP00000003365  ..............................---.............................................
ENSBTAP00000053738  ..............................KCY.............................................
ENSBTAP00000009228  ..............................---.............................................
ENSBTAP00000026785  ..............................---.............................................
ENSBTAP00000002578  ..............................FIL.............................................
ENSBTAP00000000106  ..............................---.............................................
ENSBTAP00000028840  ..............................---.............................................
ENSBTAP00000053594  ..............................FSG.............................................
ENSBTAP00000055414  ..............................--Qkhiyedfdnvllemntlpsekhfsktqskllaspedqhehyrest
ENSBTAP00000026698  ..............................SDS.............................................
ENSBTAP00000017015  ..............................---.............................................
ENSBTAP00000049908  ..............................---.............................................
ENSBTAP00000021395  ..............................---.............................................
ENSBTAP00000007194  ..............................---.............................................
ENSBTAP00000025455  ..............................--E.............................................


                                                                                                    
                                                                                                    
d1qxpa2               ..............................................................................
ENSBTAP00000019411  ..............................................................................
ENSBTAP00000036057  ..............................................................................
ENSBTAP00000038404  ..............................................................................
ENSBTAP00000010971  ..............................................................................
ENSBTAP00000019803  ..............................................................................
ENSBTAP00000014038  ..............................................................................
ENSBTAP00000002055  ..............................................................................
ENSBTAP00000049731  ..............................................................................
ENSBTAP00000005577  ..............................................................................
ENSBTAP00000034949  ..............................................................................
ENSBTAP00000017447  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000046644  ..............................................................................
ENSBTAP00000022814  ..............................................................................
ENSBTAP00000019758  ..............................................................................
ENSBTAP00000019321  ..............................................................................
ENSBTAP00000011677  ..............................................................................
ENSBTAP00000011680  ..............................................................................
ENSBTAP00000021742  ..............................................................................
ENSBTAP00000005348  ..............................................................................
ENSBTAP00000016609  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000018403  ..............................................................................
ENSBTAP00000026407  ..............................................................................
ENSBTAP00000052557  ..............................................................................
ENSBTAP00000054167  ..............................................................................
ENSBTAP00000010319  ..............................................................................
ENSBTAP00000041545  ..............................................................................
ENSBTAP00000055204  ..............................................................................
ENSBTAP00000003718  ..............................................................................
ENSBTAP00000011676  ..............................................................................
ENSBTAP00000049395  ..............................................................................
ENSBTAP00000054983  ..............................................................................
ENSBTAP00000052219  ..............................................................................
ENSBTAP00000025402  ..............................................................................
ENSBTAP00000011678  ..............................................................................
ENSBTAP00000000433  ..............................................................................
ENSBTAP00000021491  ..............................................................................
ENSBTAP00000044733  ..............................................................................
ENSBTAP00000010937  ..............................................................................
ENSBTAP00000056439  ..............................................................................
ENSBTAP00000055780  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000034705  ..............................................................................
ENSBTAP00000035936  ..............................................................................
ENSBTAP00000013699  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000011496  ..............................................................................
ENSBTAP00000019111  ..............................................................................
ENSBTAP00000017036  ..............................................................................
ENSBTAP00000003213  ..............................................................................
ENSBTAP00000055444  ..............................................................................
ENSBTAP00000024550  ..............................................................................
ENSBTAP00000015248  ..............................................................................
ENSBTAP00000021328  ..............................................................................
ENSBTAP00000037091  ..............................................................................
ENSBTAP00000029967  ..............................................................................
ENSBTAP00000021449  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000042361  ..............................................................................
ENSBTAP00000016509  ..............................................................................
ENSBTAP00000026714  ..............................................................................
ENSBTAP00000004690  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000013117  ..............................................................................
ENSBTAP00000017574  ..............................................................................
ENSBTAP00000004885  ..............................................................................
ENSBTAP00000008961  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000006283  ..............................................................................
ENSBTAP00000014306  ..............................................................................
ENSBTAP00000053252  ..............................................................................
ENSBTAP00000014304  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000041264  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000017358  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000055296  ..............................................................................
ENSBTAP00000016852  ..............................................................................
ENSBTAP00000036380  ..............................................................................
ENSBTAP00000041719  ..............................................................................
ENSBTAP00000049636  ..............................................................................
ENSBTAP00000024444  ..............................................................................
ENSBTAP00000004556  ..............................................................................
ENSBTAP00000038767  ..............................................................................
ENSBTAP00000031285  ..............................................................................
ENSBTAP00000011457  ..............................................................................
ENSBTAP00000011047  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000037104  ..............................................................................
ENSBTAP00000002672  ..............................................................................
ENSBTAP00000028269  ..............................................................................
ENSBTAP00000016647  ..............................................................................
ENSBTAP00000004536  ..............................................................................
ENSBTAP00000042177  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000050283  ..............................................................................
ENSBTAP00000048539  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000007972  ..............................................................................
ENSBTAP00000040815  ..............................................................................
ENSBTAP00000025661  ..............................................................................
ENSBTAP00000028350  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000021537  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000039155  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000016315  ..............................................................................
ENSBTAP00000021091  ..............................................................................
ENSBTAP00000021618  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000034078  ..............................................................................
ENSBTAP00000006645  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000015802  ..............................................................................
ENSBTAP00000032680  ..............................................................................
ENSBTAP00000055007  ..............................................................................
ENSBTAP00000020148  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000012557  ..............................................................................
ENSBTAP00000011888  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000021603  ..............................................................................
ENSBTAP00000010838  ..............................................................................
ENSBTAP00000014575  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000053698  ..............................................................................
ENSBTAP00000006806  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000044105  ..............................................................................
ENSBTAP00000026904  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000044226  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000042182  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000006275  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000004963  ..............................................................................
ENSBTAP00000023774  ..............................................................................
ENSBTAP00000020395  ..............................................................................
ENSBTAP00000020150  ..............................................................................
ENSBTAP00000025561  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000034009  ..............................................................................
ENSBTAP00000020539  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000017461  ..............................................................................
ENSBTAP00000044096  ..............................................................................
ENSBTAP00000008523  ..............................................................................
ENSBTAP00000035196  ..............................................................................
ENSBTAP00000041997  ..............................................................................
ENSBTAP00000025499  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000002174  ..............................................................................
ENSBTAP00000000589  ..............................................................................
ENSBTAP00000028239  ..............................................................................
ENSBTAP00000014894  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000041966  ..............................................................................
ENSBTAP00000008933  ..............................................................................
ENSBTAP00000056088  ..............................................................................
ENSBTAP00000033794  ..............................................................................
ENSBTAP00000012786  ..............................................................................
ENSBTAP00000030018  ..............................................................................
ENSBTAP00000040233  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000024301  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000015611  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000000847  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000054975  ..............................................................................
ENSBTAP00000046639  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000053164  ..............................................................................
ENSBTAP00000016774  ..............................................................................
ENSBTAP00000022630  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000033974  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000005979  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000053746  ..............................................................................
ENSBTAP00000023221  ..............................................................................
ENSBTAP00000019429  ..............................................................................
ENSBTAP00000052019  ..............................................................................
ENSBTAP00000042244  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000018877  ..............................................................................
ENSBTAP00000053019  ..............................................................................
ENSBTAP00000003073  ..............................................................................
ENSBTAP00000012886  ..............................................................................
ENSBTAP00000044222  ..............................................................................
ENSBTAP00000028499  ..............................................................................
ENSBTAP00000047378  gapglleqparpsarsklrrsaslesveslksdeeadsakepqnelfeaqgqlptwgsevfgsarkprshsfdtpe..
ENSBTAP00000009308  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000050406  ..............................................................................
ENSBTAP00000031879  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000001250  ..............................................................................
ENSBTAP00000026035  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000053194  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000033188  ..............................................................................
ENSBTAP00000053548  ..............................................................................
ENSBTAP00000011687  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000009115  ..............................................................................
ENSBTAP00000023873  ..............................................................................
ENSBTAP00000054471  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000025205  ..............................................................................
ENSBTAP00000047882  ..............................................................................
ENSBTAP00000001368  ..............................................................................
ENSBTAP00000029786  ..............................................................................
ENSBTAP00000028993  ..............................................................................
ENSBTAP00000023678  ..............................................................................
ENSBTAP00000034710  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000021074  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000007217  ..............................................................................
ENSBTAP00000029792  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000017319  ..............................................................................
ENSBTAP00000044100  ..............................................................................
ENSBTAP00000033594  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000055894  ..............................................................................
ENSBTAP00000015220  ..............................................................................
ENSBTAP00000033613  ..............................................................................
ENSBTAP00000056320  ..............................................................................
ENSBTAP00000025249  ..............................................................................
ENSBTAP00000029159  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000017662  ..............................................................................
ENSBTAP00000012479  ..............................................................................
ENSBTAP00000029886  ..............................................................................
ENSBTAP00000027388  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000023673  ..............................................................................
ENSBTAP00000041488  ..............................................................................
ENSBTAP00000001452  ..............................................................................
ENSBTAP00000028498  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000020240  ..............................................................................
ENSBTAP00000053650  ..............................................................................
ENSBTAP00000041651  ..............................................................................
ENSBTAP00000005154  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000022068  ..............................................................................
ENSBTAP00000026682  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000027954  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000013601  ..............................................................................
ENSBTAP00000005477  ..............................................................................
ENSBTAP00000055305  ..............................................................................
ENSBTAP00000036054  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000002717  ..............................................................................
ENSBTAP00000036015  ..............................................................................
ENSBTAP00000051638  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000016306  ..............................................................................
ENSBTAP00000013714  ..............................................................................
ENSBTAP00000036550  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000023383  ..............................................................................
ENSBTAP00000027030  sverildtwqeegi................................................................
ENSBTAP00000053270  sverildtwqeegi................................................................
ENSBTAP00000054640  sverildtwqeegi................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000009967  ..............................................................................
ENSBTAP00000015183  ..............................................................................
ENSBTAP00000014222  ..............................................................................
ENSBTAP00000026288  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000009228  ..............................................................................
ENSBTAP00000026785  ..............................................................................
ENSBTAP00000002578  ..............................................................................
ENSBTAP00000000106  ..............................................................................
ENSBTAP00000028840  ..............................................................................
ENSBTAP00000053594  ..............................................................................
ENSBTAP00000055414  lpqsppeqqrgatveqgpngistreqeqpeestgeqelneesvskegtytgstpeqrssreliteqrphhepiteqgv
ENSBTAP00000026698  ..............................................................................
ENSBTAP00000017015  ..............................................................................
ENSBTAP00000049908  ..............................................................................
ENSBTAP00000021395  ..............................................................................
ENSBTAP00000007194  ..............................................................................
ENSBTAP00000025455  ..............................................................................


                                                                                                    
                                                                                                    
d1qxpa2               ..............................................................................
ENSBTAP00000019411  ..............................................................................
ENSBTAP00000036057  ..............................................................................
ENSBTAP00000038404  ..............................................................................
ENSBTAP00000010971  ..............................................................................
ENSBTAP00000019803  ..............................................................................
ENSBTAP00000014038  ..............................................................................
ENSBTAP00000002055  ..............................................................................
ENSBTAP00000049731  ..............................................................................
ENSBTAP00000005577  ..............................................................................
ENSBTAP00000034949  ..............................................................................
ENSBTAP00000017447  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000046644  ..............................................................................
ENSBTAP00000022814  ..............................................................................
ENSBTAP00000019758  ..............................................................................
ENSBTAP00000019321  ..............................................................................
ENSBTAP00000011677  ..............................................................................
ENSBTAP00000011680  ..............................................................................
ENSBTAP00000021742  ..............................................................................
ENSBTAP00000005348  ..............................................................................
ENSBTAP00000016609  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000018403  ..............................................................................
ENSBTAP00000026407  ..............................................................................
ENSBTAP00000052557  ..............................................................................
ENSBTAP00000054167  ..............................................................................
ENSBTAP00000010319  ..............................................................................
ENSBTAP00000041545  ..............................................................................
ENSBTAP00000055204  ..............................................................................
ENSBTAP00000003718  ..............................................................................
ENSBTAP00000011676  ..............................................................................
ENSBTAP00000049395  ..............................................................................
ENSBTAP00000054983  ..............................................................................
ENSBTAP00000052219  ..............................................................................
ENSBTAP00000025402  ..............................................................................
ENSBTAP00000011678  ..............................................................................
ENSBTAP00000000433  ..............................................................................
ENSBTAP00000021491  ..............................................................................
ENSBTAP00000044733  ..............................................................................
ENSBTAP00000010937  ..............................................................................
ENSBTAP00000056439  ..............................................................................
ENSBTAP00000055780  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000034705  ..............................................................................
ENSBTAP00000035936  ..............................................................................
ENSBTAP00000013699  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000011496  ..............................................................................
ENSBTAP00000019111  ..............................................................................
ENSBTAP00000017036  ..............................................................................
ENSBTAP00000003213  ..............................................................................
ENSBTAP00000055444  ..............................................................................
ENSBTAP00000024550  ..............................................................................
ENSBTAP00000015248  ..............................................................................
ENSBTAP00000021328  ..............................................................................
ENSBTAP00000037091  ..............................................................................
ENSBTAP00000029967  ..............................................................................
ENSBTAP00000021449  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000042361  ..............................................................................
ENSBTAP00000016509  ..............................................................................
ENSBTAP00000026714  ..............................................................................
ENSBTAP00000004690  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000013117  ..............................................................................
ENSBTAP00000017574  ..............................................................................
ENSBTAP00000004885  ..............................................................................
ENSBTAP00000008961  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000006283  ..............................................................................
ENSBTAP00000014306  ..............................................................................
ENSBTAP00000053252  ..............................................................................
ENSBTAP00000014304  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000041264  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000017358  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000055296  ..............................................................................
ENSBTAP00000016852  ..............................................................................
ENSBTAP00000036380  ..............................................................................
ENSBTAP00000041719  ..............................................................................
ENSBTAP00000049636  ..............................................................................
ENSBTAP00000024444  ..............................................................................
ENSBTAP00000004556  ..............................................................................
ENSBTAP00000038767  ..............................................................................
ENSBTAP00000031285  ..............................................................................
ENSBTAP00000011457  ..............................................................................
ENSBTAP00000011047  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000037104  ..............................................................................
ENSBTAP00000002672  ..............................................................................
ENSBTAP00000028269  ..............................................................................
ENSBTAP00000016647  ..............................................................................
ENSBTAP00000004536  ..............................................................................
ENSBTAP00000042177  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000050283  ..............................................................................
ENSBTAP00000048539  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000007972  ..............................................................................
ENSBTAP00000040815  ..............................................................................
ENSBTAP00000025661  ..............................................................................
ENSBTAP00000028350  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000021537  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000039155  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000016315  ..............................................................................
ENSBTAP00000021091  ..............................................................................
ENSBTAP00000021618  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000034078  ..............................................................................
ENSBTAP00000006645  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000015802  ..............................................................................
ENSBTAP00000032680  ..............................................................................
ENSBTAP00000055007  ..............................................................................
ENSBTAP00000020148  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000012557  ..............................................................................
ENSBTAP00000011888  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000021603  ..............................................................................
ENSBTAP00000010838  ..............................................................................
ENSBTAP00000014575  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000053698  ..............................................................................
ENSBTAP00000006806  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000044105  ..............................................................................
ENSBTAP00000026904  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000044226  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000042182  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000006275  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000004963  ..............................................................................
ENSBTAP00000023774  ..............................................................................
ENSBTAP00000020395  ..............................................................................
ENSBTAP00000020150  ..............................................................................
ENSBTAP00000025561  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000034009  ..............................................................................
ENSBTAP00000020539  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000017461  ..............................................................................
ENSBTAP00000044096  ..............................................................................
ENSBTAP00000008523  ..............................................................................
ENSBTAP00000035196  ..............................................................................
ENSBTAP00000041997  ..............................................................................
ENSBTAP00000025499  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000002174  ..............................................................................
ENSBTAP00000000589  ..............................................................................
ENSBTAP00000028239  ..............................................................................
ENSBTAP00000014894  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000041966  ..............................................................................
ENSBTAP00000008933  ..............................................................................
ENSBTAP00000056088  ..............................................................................
ENSBTAP00000033794  ..............................................................................
ENSBTAP00000012786  ..............................................................................
ENSBTAP00000030018  ..............................................................................
ENSBTAP00000040233  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000024301  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000015611  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000000847  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000054975  ..............................................................................
ENSBTAP00000046639  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000053164  ..............................................................................
ENSBTAP00000016774  ..............................................................................
ENSBTAP00000022630  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000033974  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000005979  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000053746  ..............................................................................
ENSBTAP00000023221  ..............................................................................
ENSBTAP00000019429  ..............................................................................
ENSBTAP00000052019  ..............................................................................
ENSBTAP00000042244  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000018877  ..............................................................................
ENSBTAP00000053019  ..............................................................................
ENSBTAP00000003073  ..............................................................................
ENSBTAP00000012886  ..............................................................................
ENSBTAP00000044222  ..............................................................................
ENSBTAP00000028499  ..............................................................................
ENSBTAP00000047378  ..............................................................................
ENSBTAP00000009308  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000050406  ..............................................................................
ENSBTAP00000031879  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000001250  ..............................................................................
ENSBTAP00000026035  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000053194  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000033188  ..............................................................................
ENSBTAP00000053548  ..............................................................................
ENSBTAP00000011687  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000009115  ..............................................................................
ENSBTAP00000023873  ..............................................................................
ENSBTAP00000054471  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000025205  ..............................................................................
ENSBTAP00000047882  ..............................................................................
ENSBTAP00000001368  ..............................................................................
ENSBTAP00000029786  ..............................................................................
ENSBTAP00000028993  ..............................................................................
ENSBTAP00000023678  ..............................................................................
ENSBTAP00000034710  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000021074  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000007217  ..............................................................................
ENSBTAP00000029792  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000017319  ..............................................................................
ENSBTAP00000044100  ..............................................................................
ENSBTAP00000033594  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000055894  ..............................................................................
ENSBTAP00000015220  ..............................................................................
ENSBTAP00000033613  ..............................................................................
ENSBTAP00000056320  ..............................................................................
ENSBTAP00000025249  ..............................................................................
ENSBTAP00000029159  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000017662  ..............................................................................
ENSBTAP00000012479  ..............................................................................
ENSBTAP00000029886  ..............................................................................
ENSBTAP00000027388  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000023673  ..............................................................................
ENSBTAP00000041488  ..............................................................................
ENSBTAP00000001452  ..............................................................................
ENSBTAP00000028498  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000020240  ..............................................................................
ENSBTAP00000053650  ..............................................................................
ENSBTAP00000041651  ..............................................................................
ENSBTAP00000005154  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000022068  ..............................................................................
ENSBTAP00000026682  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000027954  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000013601  ..............................................................................
ENSBTAP00000005477  ..............................................................................
ENSBTAP00000055305  ..............................................................................
ENSBTAP00000036054  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000002717  ..............................................................................
ENSBTAP00000036015  ..............................................................................
ENSBTAP00000051638  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000016306  ..............................................................................
ENSBTAP00000013714  ..............................................................................
ENSBTAP00000036550  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000023383  ..............................................................................
ENSBTAP00000027030  ..............................................................................
ENSBTAP00000053270  ..............................................................................
ENSBTAP00000054640  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000009967  ..............................................................................
ENSBTAP00000015183  ..............................................................................
ENSBTAP00000014222  ..............................................................................
ENSBTAP00000026288  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000009228  ..............................................................................
ENSBTAP00000026785  ..............................................................................
ENSBTAP00000002578  ..............................................................................
ENSBTAP00000000106  ..............................................................................
ENSBTAP00000028840  ..............................................................................
ENSBTAP00000053594  ..............................................................................
ENSBTAP00000055414  pqgthiestaeqglseesittegqhegsttgqgshgksteeqgsrresqsdqgqpretmaeqeahresqsdqgphgge
ENSBTAP00000026698  ..............................................................................
ENSBTAP00000017015  ..............................................................................
ENSBTAP00000049908  ..............................................................................
ENSBTAP00000021395  ..............................................................................
ENSBTAP00000007194  ..............................................................................
ENSBTAP00000025455  ..............................................................................


                                                                                                    
                                                                                                    
d1qxpa2               ..............................................................................
ENSBTAP00000019411  ..............................................................................
ENSBTAP00000036057  ..............................................................................
ENSBTAP00000038404  ..............................................................................
ENSBTAP00000010971  ..............................................................................
ENSBTAP00000019803  ..............................................................................
ENSBTAP00000014038  ..............................................................................
ENSBTAP00000002055  ..............................................................................
ENSBTAP00000049731  ..............................................................................
ENSBTAP00000005577  ..............................................................................
ENSBTAP00000034949  ..............................................................................
ENSBTAP00000017447  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000046644  ..............................................................................
ENSBTAP00000022814  ..............................................................................
ENSBTAP00000019758  ..............................................................................
ENSBTAP00000019321  ..............................................................................
ENSBTAP00000011677  ..............................................................................
ENSBTAP00000011680  ..............................................................................
ENSBTAP00000021742  ..............................................................................
ENSBTAP00000005348  ..............................................................................
ENSBTAP00000016609  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000018403  ..............................................................................
ENSBTAP00000026407  ..............................................................................
ENSBTAP00000052557  ..............................................................................
ENSBTAP00000054167  ..............................................................................
ENSBTAP00000010319  ..............................................................................
ENSBTAP00000041545  ..............................................................................
ENSBTAP00000055204  ..............................................................................
ENSBTAP00000003718  ..............................................................................
ENSBTAP00000011676  ..............................................................................
ENSBTAP00000049395  ..............................................................................
ENSBTAP00000054983  ..............................................................................
ENSBTAP00000052219  ..............................................................................
ENSBTAP00000025402  ..............................................................................
ENSBTAP00000011678  ..............................................................................
ENSBTAP00000000433  ..............................................................................
ENSBTAP00000021491  ..............................................................................
ENSBTAP00000044733  ..............................................................................
ENSBTAP00000010937  ..............................................................................
ENSBTAP00000056439  ..............................................................................
ENSBTAP00000055780  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000034705  ..............................................................................
ENSBTAP00000035936  ..............................................................................
ENSBTAP00000013699  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000011496  ..............................................................................
ENSBTAP00000019111  ..............................................................................
ENSBTAP00000017036  ..............................................................................
ENSBTAP00000003213  ..............................................................................
ENSBTAP00000055444  ..............................................................................
ENSBTAP00000024550  ..............................................................................
ENSBTAP00000015248  ..............................................................................
ENSBTAP00000021328  ..............................................................................
ENSBTAP00000037091  ..............................................................................
ENSBTAP00000029967  ..............................................................................
ENSBTAP00000021449  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000042361  ..............................................................................
ENSBTAP00000016509  ..............................................................................
ENSBTAP00000026714  ..............................................................................
ENSBTAP00000004690  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000013117  ..............................................................................
ENSBTAP00000017574  ..............................................................................
ENSBTAP00000004885  ..............................................................................
ENSBTAP00000008961  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000006283  ..............................................................................
ENSBTAP00000014306  ..............................................................................
ENSBTAP00000053252  ..............................................................................
ENSBTAP00000014304  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000041264  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000017358  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000055296  ..............................................................................
ENSBTAP00000016852  ..............................................................................
ENSBTAP00000036380  ..............................................................................
ENSBTAP00000041719  ..............................................................................
ENSBTAP00000049636  ..............................................................................
ENSBTAP00000024444  ..............................................................................
ENSBTAP00000004556  ..............................................................................
ENSBTAP00000038767  ..............................................................................
ENSBTAP00000031285  ..............................................................................
ENSBTAP00000011457  ..............................................................................
ENSBTAP00000011047  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000037104  ..............................................................................
ENSBTAP00000002672  ..............................................................................
ENSBTAP00000028269  ..............................................................................
ENSBTAP00000016647  ..............................................................................
ENSBTAP00000004536  ..............................................................................
ENSBTAP00000042177  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000050283  ..............................................................................
ENSBTAP00000048539  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000007972  ..............................................................................
ENSBTAP00000040815  ..............................................................................
ENSBTAP00000025661  ..............................................................................
ENSBTAP00000028350  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000021537  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000039155  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000016315  ..............................................................................
ENSBTAP00000021091  ..............................................................................
ENSBTAP00000021618  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000034078  ..............................................................................
ENSBTAP00000006645  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000015802  ..............................................................................
ENSBTAP00000032680  ..............................................................................
ENSBTAP00000055007  ..............................................................................
ENSBTAP00000020148  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000012557  ..............................................................................
ENSBTAP00000011888  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000021603  ..............................................................................
ENSBTAP00000010838  ..............................................................................
ENSBTAP00000014575  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000053698  ..............................................................................
ENSBTAP00000006806  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000044105  ..............................................................................
ENSBTAP00000026904  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000044226  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000042182  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000006275  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000004963  ..............................................................................
ENSBTAP00000023774  ..............................................................................
ENSBTAP00000020395  ..............................................................................
ENSBTAP00000020150  ..............................................................................
ENSBTAP00000025561  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000034009  ..............................................................................
ENSBTAP00000020539  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000017461  ..............................................................................
ENSBTAP00000044096  ..............................................................................
ENSBTAP00000008523  ..............................................................................
ENSBTAP00000035196  ..............................................................................
ENSBTAP00000041997  ..............................................................................
ENSBTAP00000025499  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000002174  ..............................................................................
ENSBTAP00000000589  ..............................................................................
ENSBTAP00000028239  ..............................................................................
ENSBTAP00000014894  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000041966  ..............................................................................
ENSBTAP00000008933  ..............................................................................
ENSBTAP00000056088  ..............................................................................
ENSBTAP00000033794  ..............................................................................
ENSBTAP00000012786  ..............................................................................
ENSBTAP00000030018  ..............................................................................
ENSBTAP00000040233  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000024301  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000015611  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000000847  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000054975  ..............................................................................
ENSBTAP00000046639  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000053164  ..............................................................................
ENSBTAP00000016774  ..............................................................................
ENSBTAP00000022630  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000033974  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000005979  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000053746  ..............................................................................
ENSBTAP00000023221  ..............................................................................
ENSBTAP00000019429  ..............................................................................
ENSBTAP00000052019  ..............................................................................
ENSBTAP00000042244  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000018877  ..............................................................................
ENSBTAP00000053019  ..............................................................................
ENSBTAP00000003073  ..............................................................................
ENSBTAP00000012886  ..............................................................................
ENSBTAP00000044222  ..............................................................................
ENSBTAP00000028499  ..............................................................................
ENSBTAP00000047378  ..............................................................................
ENSBTAP00000009308  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000050406  ..............................................................................
ENSBTAP00000031879  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000001250  ..............................................................................
ENSBTAP00000026035  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000053194  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000033188  ..............................................................................
ENSBTAP00000053548  ..............................................................................
ENSBTAP00000011687  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000009115  ..............................................................................
ENSBTAP00000023873  ..............................................................................
ENSBTAP00000054471  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000025205  ..............................................................................
ENSBTAP00000047882  ..............................................................................
ENSBTAP00000001368  ..............................................................................
ENSBTAP00000029786  ..............................................................................
ENSBTAP00000028993  ..............................................................................
ENSBTAP00000023678  ..............................................................................
ENSBTAP00000034710  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000021074  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000007217  ..............................................................................
ENSBTAP00000029792  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000017319  ..............................................................................
ENSBTAP00000044100  ..............................................................................
ENSBTAP00000033594  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000055894  ..............................................................................
ENSBTAP00000015220  ..............................................................................
ENSBTAP00000033613  ..............................................................................
ENSBTAP00000056320  ..............................................................................
ENSBTAP00000025249  ..............................................................................
ENSBTAP00000029159  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000017662  ..............................................................................
ENSBTAP00000012479  ..............................................................................
ENSBTAP00000029886  ..............................................................................
ENSBTAP00000027388  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000023673  ..............................................................................
ENSBTAP00000041488  ..............................................................................
ENSBTAP00000001452  ..............................................................................
ENSBTAP00000028498  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000020240  ..............................................................................
ENSBTAP00000053650  ..............................................................................
ENSBTAP00000041651  ..............................................................................
ENSBTAP00000005154  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000022068  ..............................................................................
ENSBTAP00000026682  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000027954  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000013601  ..............................................................................
ENSBTAP00000005477  ..............................................................................
ENSBTAP00000055305  ..............................................................................
ENSBTAP00000036054  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000002717  ..............................................................................
ENSBTAP00000036015  ..............................................................................
ENSBTAP00000051638  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000016306  ..............................................................................
ENSBTAP00000013714  ..............................................................................
ENSBTAP00000036550  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000023383  ..............................................................................
ENSBTAP00000027030  ..............................................................................
ENSBTAP00000053270  ..............................................................................
ENSBTAP00000054640  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000009967  ..............................................................................
ENSBTAP00000015183  ..............................................................................
ENSBTAP00000014222  ..............................................................................
ENSBTAP00000026288  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000009228  ..............................................................................
ENSBTAP00000026785  ..............................................................................
ENSBTAP00000002578  ..............................................................................
ENSBTAP00000000106  ..............................................................................
ENSBTAP00000028840  ..............................................................................
ENSBTAP00000053594  ..............................................................................
ENSBTAP00000055414  tileeqqdtdltsqsrkgsltgesktsresisfehteippqegrtqahayeellfvspelqaktgvsipedhlsepak
ENSBTAP00000026698  ..............................................................................
ENSBTAP00000017015  ..............................................................................
ENSBTAP00000049908  ..............................................................................
ENSBTAP00000021395  ..............................................................................
ENSBTAP00000007194  ..............................................................................
ENSBTAP00000025455  ..............................................................................


                                                                                                    
                                                                                                    
d1qxpa2               ..............................................................................
ENSBTAP00000019411  ..............................................................................
ENSBTAP00000036057  ..............................................................................
ENSBTAP00000038404  ..............................................................................
ENSBTAP00000010971  ..............................................................................
ENSBTAP00000019803  ..............................................................................
ENSBTAP00000014038  ..............................................................................
ENSBTAP00000002055  ..............................................................................
ENSBTAP00000049731  ..............................................................................
ENSBTAP00000005577  ..............................................................................
ENSBTAP00000034949  ..............................................................................
ENSBTAP00000017447  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000046644  ..............................................................................
ENSBTAP00000022814  ..............................................................................
ENSBTAP00000019758  ..............................................................................
ENSBTAP00000019321  ..............................................................................
ENSBTAP00000011677  ..............................................................................
ENSBTAP00000011680  ..............................................................................
ENSBTAP00000021742  ..............................................................................
ENSBTAP00000005348  ..............................................................................
ENSBTAP00000016609  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000018403  ..............................................................................
ENSBTAP00000026407  ..............................................................................
ENSBTAP00000052557  ..............................................................................
ENSBTAP00000054167  ..............................................................................
ENSBTAP00000010319  ..............................................................................
ENSBTAP00000041545  ..............................................................................
ENSBTAP00000055204  ..............................................................................
ENSBTAP00000003718  ..............................................................................
ENSBTAP00000011676  ..............................................................................
ENSBTAP00000049395  ..............................................................................
ENSBTAP00000054983  ..............................................................................
ENSBTAP00000052219  ..............................................................................
ENSBTAP00000025402  ..............................................................................
ENSBTAP00000011678  ..............................................................................
ENSBTAP00000000433  ..............................................................................
ENSBTAP00000021491  ..............................................................................
ENSBTAP00000044733  ..............................................................................
ENSBTAP00000010937  ..............................................................................
ENSBTAP00000056439  ..............................................................................
ENSBTAP00000055780  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000034705  ..............................................................................
ENSBTAP00000035936  ..............................................................................
ENSBTAP00000013699  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000011496  ..............................................................................
ENSBTAP00000019111  ..............................................................................
ENSBTAP00000017036  ..............................................................................
ENSBTAP00000003213  ..............................................................................
ENSBTAP00000055444  ..............................................................................
ENSBTAP00000024550  ..............................................................................
ENSBTAP00000015248  ..............................................................................
ENSBTAP00000021328  ..............................................................................
ENSBTAP00000037091  ..............................................................................
ENSBTAP00000029967  ..............................................................................
ENSBTAP00000021449  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000042361  ..............................................................................
ENSBTAP00000016509  ..............................................................................
ENSBTAP00000026714  ..............................................................................
ENSBTAP00000004690  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000013117  ..............................................................................
ENSBTAP00000017574  ..............................................................................
ENSBTAP00000004885  ..............................................................................
ENSBTAP00000008961  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000006283  ..............................................................................
ENSBTAP00000014306  ..............................................................................
ENSBTAP00000053252  ..............................................................................
ENSBTAP00000014304  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000041264  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000017358  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000055296  ..............................................................................
ENSBTAP00000016852  ..............................................................................
ENSBTAP00000036380  ..............................................................................
ENSBTAP00000041719  ..............................................................................
ENSBTAP00000049636  ..............................................................................
ENSBTAP00000024444  ..............................................................................
ENSBTAP00000004556  ..............................................................................
ENSBTAP00000038767  ..............................................................................
ENSBTAP00000031285  ..............................................................................
ENSBTAP00000011457  ..............................................................................
ENSBTAP00000011047  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000037104  ..............................................................................
ENSBTAP00000002672  ..............................................................................
ENSBTAP00000028269  ..............................................................................
ENSBTAP00000016647  ..............................................................................
ENSBTAP00000004536  ..............................................................................
ENSBTAP00000042177  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000050283  ..............................................................................
ENSBTAP00000048539  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000007972  ..............................................................................
ENSBTAP00000040815  ..............................................................................
ENSBTAP00000025661  ..............................................................................
ENSBTAP00000028350  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000021537  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000039155  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000016315  ..............................................................................
ENSBTAP00000021091  ..............................................................................
ENSBTAP00000021618  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000034078  ..............................................................................
ENSBTAP00000006645  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000015802  ..............................................................................
ENSBTAP00000032680  ..............................................................................
ENSBTAP00000055007  ..............................................................................
ENSBTAP00000020148  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000012557  ..............................................................................
ENSBTAP00000011888  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000021603  ..............................................................................
ENSBTAP00000010838  ..............................................................................
ENSBTAP00000014575  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000053698  ..............................................................................
ENSBTAP00000006806  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000044105  ..............................................................................
ENSBTAP00000026904  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000044226  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000042182  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000006275  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000004963  ..............................................................................
ENSBTAP00000023774  ..............................................................................
ENSBTAP00000020395  ..............................................................................
ENSBTAP00000020150  ..............................................................................
ENSBTAP00000025561  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000034009  ..............................................................................
ENSBTAP00000020539  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000017461  ..............................................................................
ENSBTAP00000044096  ..............................................................................
ENSBTAP00000008523  ..............................................................................
ENSBTAP00000035196  ..............................................................................
ENSBTAP00000041997  ..............................................................................
ENSBTAP00000025499  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000002174  ..............................................................................
ENSBTAP00000000589  ..............................................................................
ENSBTAP00000028239  ..............................................................................
ENSBTAP00000014894  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000041966  ..............................................................................
ENSBTAP00000008933  ..............................................................................
ENSBTAP00000056088  ..............................................................................
ENSBTAP00000033794  ..............................................................................
ENSBTAP00000012786  ..............................................................................
ENSBTAP00000030018  ..............................................................................
ENSBTAP00000040233  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000024301  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000015611  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000000847  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000054975  ..............................................................................
ENSBTAP00000046639  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000053164  ..............................................................................
ENSBTAP00000016774  ..............................................................................
ENSBTAP00000022630  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000033974  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000005979  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000053746  ..............................................................................
ENSBTAP00000023221  ..............................................................................
ENSBTAP00000019429  ..............................................................................
ENSBTAP00000052019  ..............................................................................
ENSBTAP00000042244  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000018877  ..............................................................................
ENSBTAP00000053019  ..............................................................................
ENSBTAP00000003073  ..............................................................................
ENSBTAP00000012886  ..............................................................................
ENSBTAP00000044222  ..............................................................................
ENSBTAP00000028499  ..............................................................................
ENSBTAP00000047378  ..............................................................................
ENSBTAP00000009308  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000050406  ..............................................................................
ENSBTAP00000031879  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000001250  ..............................................................................
ENSBTAP00000026035  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000053194  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000033188  ..............................................................................
ENSBTAP00000053548  ..............................................................................
ENSBTAP00000011687  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000009115  ..............................................................................
ENSBTAP00000023873  ..............................................................................
ENSBTAP00000054471  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000025205  ..............................................................................
ENSBTAP00000047882  ..............................................................................
ENSBTAP00000001368  ..............................................................................
ENSBTAP00000029786  ..............................................................................
ENSBTAP00000028993  ..............................................................................
ENSBTAP00000023678  ..............................................................................
ENSBTAP00000034710  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000021074  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000007217  ..............................................................................
ENSBTAP00000029792  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000017319  ..............................................................................
ENSBTAP00000044100  ..............................................................................
ENSBTAP00000033594  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000055894  ..............................................................................
ENSBTAP00000015220  ..............................................................................
ENSBTAP00000033613  ..............................................................................
ENSBTAP00000056320  ..............................................................................
ENSBTAP00000025249  ..............................................................................
ENSBTAP00000029159  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000017662  ..............................................................................
ENSBTAP00000012479  ..............................................................................
ENSBTAP00000029886  ..............................................................................
ENSBTAP00000027388  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000023673  ..............................................................................
ENSBTAP00000041488  ..............................................................................
ENSBTAP00000001452  ..............................................................................
ENSBTAP00000028498  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000020240  ..............................................................................
ENSBTAP00000053650  ..............................................................................
ENSBTAP00000041651  ..............................................................................
ENSBTAP00000005154  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000022068  ..............................................................................
ENSBTAP00000026682  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000027954  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000013601  ..............................................................................
ENSBTAP00000005477  ..............................................................................
ENSBTAP00000055305  ..............................................................................
ENSBTAP00000036054  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000002717  ..............................................................................
ENSBTAP00000036015  ..............................................................................
ENSBTAP00000051638  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000016306  ..............................................................................
ENSBTAP00000013714  ..............................................................................
ENSBTAP00000036550  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000023383  ..............................................................................
ENSBTAP00000027030  ..............................................................................
ENSBTAP00000053270  ..............................................................................
ENSBTAP00000054640  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000009967  ..............................................................................
ENSBTAP00000015183  ..............................................................................
ENSBTAP00000014222  ..............................................................................
ENSBTAP00000026288  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000009228  ..............................................................................
ENSBTAP00000026785  ..............................................................................
ENSBTAP00000002578  ..............................................................................
ENSBTAP00000000106  ..............................................................................
ENSBTAP00000028840  ..............................................................................
ENSBTAP00000053594  ..............................................................................
ENSBTAP00000055414  kevqkdkscepksqkiegkswtgelltcnwnmkyakhedeeqahliydnsrftdlhsiirniqsykeikgrstfngvs
ENSBTAP00000026698  ..............................................................................
ENSBTAP00000017015  ..............................................................................
ENSBTAP00000049908  ..............................................................................
ENSBTAP00000021395  ..............................................................................
ENSBTAP00000007194  ..............................................................................
ENSBTAP00000025455  ..............................................................................


                                                                                     100            
                                                                                       |            
d1qxpa2               ..........................................................RNYLTIFRKF...DLDK.SG
ENSBTAP00000019411  ..........................................................EEIREAFRVF...DKDG.NG
ENSBTAP00000036057  ..........................................................EEIREAFRVF...DKDG.NG
ENSBTAP00000038404  ..........................................................QKLKWAFSMY...DLDG.NG
ENSBTAP00000010971  ..........................................................QKLMWAFSMY...DLDG.NG
ENSBTAP00000019803  ..........................................................KKWQAVYKQF...DVDR.SG
ENSBTAP00000014038  ..........................................................QKLRFAFRIY...DMDK.DG
ENSBTAP00000002055  ..........................................................EEIREAFRVF...DKDG.NG
ENSBTAP00000049731  ..........................................................EEIREAFRVF...DKDG.NG
ENSBTAP00000005577  ..........................................................QKLKWAFSMY...DLDG.NG
ENSBTAP00000034949  ..........................................................QKLEWAFSLY...DVDG.NG
ENSBTAP00000017447  ..........................................................TDIEDLFKKI...NGDK.TD
ENSBTAP00000010858  ..........................................................--LNWLLNVY...DTGR.TG
ENSBTAP00000046644  ..........................................................PEIDNIFSEF...GAKS.KP
ENSBTAP00000022814  ..........................................................QKLNWAFNMY...DLDG.DG
ENSBTAP00000019758  ..........................................................----------...----.--
ENSBTAP00000019321  ..........................................................QKLNWAFEMY...DLDG.DG
ENSBTAP00000011677  ..........................................................KTWQKIFKHY...DTDQ.SG
ENSBTAP00000011680  ..........................................................KTWQKIFKHY...DTDQ.SG
ENSBTAP00000021742  ..........................................................DRLNWAFNLY...DLNK.DG
ENSBTAP00000005348  ..........................................................----------...----.--
ENSBTAP00000016609  ..........................................................----------...----.--
ENSBTAP00000012740  ..........................................................MCLNWLLNVY...DTGR.TG
ENSBTAP00000018403  ..........................................................EGLREIFRAF...DQDD.DG
ENSBTAP00000026407  ..........................................................----------...----.--
ENSBTAP00000052557  ..........................................................EEILKAFRLF...DDDE.TG
ENSBTAP00000054167  ..........................................................EKLNWAFNLY...DINK.DG
ENSBTAP00000010319  ..........................................................EEILKAFKLF...DDDE.TG
ENSBTAP00000041545  ..........................................................PEVQELFEKF...SSDG.Q-
ENSBTAP00000055204  ..........................................................TDWQNVFRTY...DRDN.SG
ENSBTAP00000003718  ..........................................................EKLRWTFNLY...DINK.DG
ENSBTAP00000011676  ..........................................................RKYLDIFRET...DHNH.SG
ENSBTAP00000049395  ..........................................................KEIDRTFEEA...-TGS.KE
ENSBTAP00000054983  ..........................................................----------...----.--
ENSBTAP00000052219  ..........................................................NGWRQHFISF...DSDR.SG
ENSBTAP00000025402  ..........................................................PEIDEIFTSY...HSKA.KP
ENSBTAP00000011678  ..........................................................RNYLSIFRKF...DLDK.SG
ENSBTAP00000000433  ..........................................................EALENIYK--...----.--
ENSBTAP00000021491  ..........................................................EEILKAFKLF...DDDD.TG
ENSBTAP00000044733  ..........................................................QKYQKIYREI...DVDR.SG
ENSBTAP00000010937  ..........................................................RDLYLLLLSY...-SDK.KD
ENSBTAP00000056439  ..........................................................RDLYLLLLSY...-SDK.KD
ENSBTAP00000055780  ..........................................................EELSDLFRMF...DKNA.DG
ENSBTAP00000038002  ..........................................................HLSQALFQS-...----.--
ENSBTAP00000034705  ..........................................................PELEEIFHRY...-SGE.DR
ENSBTAP00000035936  ..........................................................HKLKWTFKIY...DKDR.NG
ENSBTAP00000013699  ..........................................................QQWKNLFQQY...DRDC.SG
ENSBTAP00000002564  ..........................................................TTALEIFNEH...DLQA.SE
ENSBTAP00000011496  ..........................................................EKLRWAFKLY...DLDN.DG
ENSBTAP00000019111  ..........................................................EEILKAFKLF...DDDD.SG
ENSBTAP00000017036  ..........................................................QKLRWYFKLY...DVDG.NG
ENSBTAP00000003213  ..........................................................RDLYLLMLTY...-SNH.KD
ENSBTAP00000055444  ..........................................................RDLYLLMLTY...-SNH.KD
ENSBTAP00000024550  ..........................................................NSWKQNFITV...DKDG.SG
ENSBTAP00000015248  ..........................................................DVIRNAFACF...DEEA.SG
ENSBTAP00000021328  ..........................................................DVIRNAFACF...DEEA.TG
ENSBTAP00000037091  ..........................................................DVIRNAFACF...DEEA.TG
ENSBTAP00000029967  ..........................................................RELRDAFREF...DTNG.DG
ENSBTAP00000021449  ..........................................................QEMRDAFKEF...DANG.DG
ENSBTAP00000053176  ..........................................................----------...----.--
ENSBTAP00000042361  ..........................................................KELRDAFREF...DTNG.DG
ENSBTAP00000016509  ..........................................................HKLKWTFKIY...DKDR.NG
ENSBTAP00000026714  ..........................................................KELRDAFREF...DTNG.DG
ENSBTAP00000004690  ..........................................................KKWTDIFREC...DQDQ.SG
ENSBTAP00000010858  ..........................................................----------...----.--
ENSBTAP00000013117  ..........................................................PEIYFLLVQF...-SSN.KE
ENSBTAP00000017574  ..........................................................EEIIEIFNTY...SENR.KI
ENSBTAP00000004885  ..........................................................KKMKLAFKSL...DKNN.DG
ENSBTAP00000008961  ..........................................................----------...----.--
ENSBTAP00000028063  ..........................................................----------...-LDH.ST
ENSBTAP00000012740  ..........................................................----------...----.--
ENSBTAP00000006283  ..........................................................RELRIAFREF...DRDR.DG
ENSBTAP00000014306  ..........................................................EDYVEGLRVF...DKEG.NG
ENSBTAP00000053252  ..........................................................PEVYFLLVQI...-SKN.KE
ENSBTAP00000014304  ..........................................................EDYVEGLRVF...DKEG.NG
ENSBTAP00000045669  ..........................................................LLLNFLLAAF...DPEG.HG
ENSBTAP00000041264  ..........................................................----------...----.--
ENSBTAP00000006711  ..........................................................----------...----.--
ENSBTAP00000017358  ..........................................................----------...----.--
ENSBTAP00000053274  ..........................................................LLLNFLLAAF...DPEG.HG
ENSBTAP00000055296  ..........................................................----------...----.--
ENSBTAP00000016852  ..........................................................EVIMQAFRKL...DKTG.DG
ENSBTAP00000036380  ..........................................................KEILLAMLMA...DKEK.KG
ENSBTAP00000041719  ..........................................................QDYLEGLRVF...DKEQ.NG
ENSBTAP00000049636  ..........................................................EDFVEGLRVF...DKEG.NG
ENSBTAP00000024444  ..........................................................ETILNAFKVF...DPEG.KG
ENSBTAP00000004556  ..........................................................PCIKPLFNSC...DSFK.DG
ENSBTAP00000038767  ..........................................................NKLHFAFRLY...DLDK.DD
ENSBTAP00000031285  ..........................................................VCIRPF----...----.--
ENSBTAP00000011457  ..........................................................EKMKYCFEVF...DLNG.DS
ENSBTAP00000011047  ..........................................................EDFVEGLRVF...DKEG.NG
ENSBTAP00000002564  ..........................................................----------...----.--
ENSBTAP00000037104  ..........................................................ETILHAFKVF...DTEG.KG
ENSBTAP00000002672  ..........................................................EAILSAFRLF...DPSG.KG
ENSBTAP00000028269  ..........................................................DVITGAFKVL...DPEG.KG
ENSBTAP00000016647  ..........................................................NKLRFAFQLY...DLDR.DG
ENSBTAP00000004536  ..........................................................QRLLLLFHSL...DRNQ.DG
ENSBTAP00000042177  ..........................................................RVVHWYFKLL...DKNN.SG
ENSBTAP00000028063  ..........................................................----------...----.--
ENSBTAP00000050283  ..........................................................EDFVEGLRVF...DKES.NG
ENSBTAP00000048539  ..........................................................KILQMSFKLF...DLDK.DG
ENSBTAP00000045669  ..........................................................----------...----.--
ENSBTAP00000007972  ..........................................................AVVTAAFAKL...DRSG.DG
ENSBTAP00000040815  ..........................................................RVVHWYFSQL...DSNS.SS
ENSBTAP00000025661  ..........................................................EIIQVAFKLF...DVDE.DG
ENSBTAP00000028350  ..........................................................IKSHYAFRIF...DFDD.DG
ENSBTAP00000053274  ..........................................................----------...----.--
ENSBTAP00000021537  ..........................................................LKAYYAFKIY...DFNN.DD
ENSBTAP00000055481  ..........................................................LKYRQLFNSH...DKTM.SG
ENSBTAP00000039155  ..........................................................DHIWEAFHVF...DKDS.KI
ENSBTAP00000029333  ..........................................................LKYRQLFNSH...DKTM.SG
ENSBTAP00000016315  ..........................................................----------...----.--
ENSBTAP00000021091  ..........................................................MFYQEVFHKQ...DTNR.SG
ENSBTAP00000021618  ..........................................................EKSRLMFRMY...DFDG.NG
ENSBTAP00000055520  ..........................................................----------...----.--
ENSBTAP00000055624  ..........................................................----------...----.--
ENSBTAP00000016319  ..........................................................----------...----.--
ENSBTAP00000034078  ..........................................................DILLRAFEVL...DPAK.RG
ENSBTAP00000006645  ..........................................................LKIEYAFRIY...DFNE.NG
ENSBTAP00000021909  ..........................................................KTEREQFVEFr..DKNR.DG
ENSBTAP00000001426  ..........................................................TEFMEAWRKY...DTDR.SG
ENSBTAP00000015802  ..........................................................KKLRLVFKSL...DKKN.DG
ENSBTAP00000032680  ..........................................................KKLRLVFKSL...DKKN.DG
ENSBTAP00000055007  ..........................................................EELAECFRIF...DR--.--
ENSBTAP00000020148  ..........................................................----------...----.--
ENSBTAP00000052345  ..........................................................AKYDEIFLKT...DKDM.DG
ENSBTAP00000029334  ..........................................................LKYRQKFNSL...DKSM.SG
ENSBTAP00000052345  ..........................................................----------...----.--
ENSBTAP00000056127  ..........................................................LSEREQFNEFr..DLNK.DG
ENSBTAP00000012557  ..........................................................SDLQIIFNII...DSDH.SG
ENSBTAP00000011888  ..........................................................DKLKFLFQVY...DVDG.KH
ENSBTAP00000017060  ..........................................................----------...----.--
ENSBTAP00000031854  ..........................................................TSIEYWFRCM...DVDG.DG
ENSBTAP00000031823  ..........................................................QTEREQFRDFr..DLNK.DG
ENSBTAP00000021603  ..........................................................DKSRLMFTMY...DLDG.NG
ENSBTAP00000010838  ..........................................................----------...----.--
ENSBTAP00000014575  ..........................................................LKASYAFKIY...DFNT.DN
ENSBTAP00000011215  ..........................................................TSIEYWFRCM...DVDG.DG
ENSBTAP00000053698  ..........................................................DSIFWQFDMQ...----.--
ENSBTAP00000006806  ..........................................................----------...----.--
ENSBTAP00000029334  ..........................................................----------...----.--
ENSBTAP00000044105  ..........................................................----------...----.--
ENSBTAP00000026904  ..........................................................----------...----.--
ENSBTAP00000017060  ..........................................................--FDEIFLKT...DLDL.DG
ENSBTAP00000055520  ..........................................................----------...----.--
ENSBTAP00000044226  ..........................................................----------...----.--
ENSBTAP00000055624  ..........................................................----------...----.--
ENSBTAP00000042182  ..........................................................LEWQATFDKF...DEDA.SG
ENSBTAP00000010796  ..........................................................RPMRRTFKAY...DEGG.TG
ENSBTAP00000021174  ..........................................................EEFMKTWRKY...DTDH.SG
ENSBTAP00000006275  ..........................................................----------...----.--
ENSBTAP00000020950  ..........................................................VEKDRFMNDY...DRDA.DG
ENSBTAP00000053738  ..........................................................RPMRRTFKAY...DEGG.TG
ENSBTAP00000004963  ..........................................................EKLKFCFEVY...YFNG.DG
ENSBTAP00000023774  ..........................................................TDFDTVFWKC...DMQK.--
ENSBTAP00000020395  ..........................................................EEIESAFRAL...SSEG.KP
ENSBTAP00000020150  ..........................................................----------...----.--
ENSBTAP00000025561  ..........................................................AMMCN-----...----.--
ENSBTAP00000053738  ..........................................................SDLSKNFIET...DSEG.NG
ENSBTAP00000034009  ..........................................................----------...----.--
ENSBTAP00000020539  ..........................................................SNLETIFRII...DSDH.SG
ENSBTAP00000020778  ..........................................................RDRKREFEELi..DANH.DG
ENSBTAP00000017461  ..........................................................NEVRHIFTAF...DRHY.RG
ENSBTAP00000044096  ..........................................................----------...----.--
ENSBTAP00000008523  ..........................................................----------...----.--
ENSBTAP00000035196  ..........................................................LFLQSTFDKH...DLDR.DC
ENSBTAP00000041997  ..........................................................----------...----.--
ENSBTAP00000025499  ..........................................................EDVKKVFHIL...DKDK.SG
ENSBTAP00000055481  ..........................................................K---------...----.--
ENSBTAP00000002174  ..........................................................----------...----.--
ENSBTAP00000000589  ..........................................................----------...----.--
ENSBTAP00000028239  ..........................................................----------...----.--
ENSBTAP00000014894  ..........................................................DQVIASFKVL...AGDK.N-
ENSBTAP00000026544  ..........................................................RDFEKIFAHY...DVSK.TG
ENSBTAP00000029333  ..........................................................K---------...----.--
ENSBTAP00000041966  ..........................................................VHCQSVFQNS...-PKN.AG
ENSBTAP00000008933  ..........................................................----------...----.--
ENSBTAP00000056088  ..........................................................----------...----.--
ENSBTAP00000033794  ..........................................................----------...----.--
ENSBTAP00000012786  ..........................................................EQVIASFRIL...ASDK.-P
ENSBTAP00000030018  ..........................................................EQVVASFKIL...AGDK.N-
ENSBTAP00000040233  ..........................................................KTVIKALMLI...DVNT.TG
ENSBTAP00000003365  ..........................................................AELLKSFKQL...DVND.NG
ENSBTAP00000053176  ..........................................................DKLEFMFRLY...DTDG.NG
ENSBTAP00000024301  ..........................................................DQVMASFKIL...AGDK.N-
ENSBTAP00000022292  ..........................................................SMFIVAFQLF...DKSG.NG
ENSBTAP00000015611  ..........................................................----------...----.--
ENSBTAP00000012770  ..........................................................AALQYIFKLL...DIEN.KG
ENSBTAP00000000847  ..........................................................C---------...----.--
ENSBTAP00000053738  ..........................................................KTVIKALMLI...DVNT.TG
ENSBTAP00000054975  ..........................................................SQVKDVFRFI...DNDQ.SG
ENSBTAP00000046639  ..........................................................SFVRKAFMKL...DFNK.TG
ENSBTAP00000052345  ..........................................................----------...----.--
ENSBTAP00000053164  ..........................................................DTLLAAFRHY...DKKG.DG
ENSBTAP00000016774  ..........................................................----------...----.--
ENSBTAP00000022630  ..........................................................----------...----.--
ENSBTAP00000010796  ..........................................................HAIAQEFENF...DTMK.TN
ENSBTAP00000021909  ..........................................................VRDERRFKMA...DKDG.DL
ENSBTAP00000033974  ..........................................................GELRAALCIF...DKEA.RG
ENSBTAP00000006711  ..........................................................DKLEFMFRLY...DSDE.NG
ENSBTAP00000010796  ..........................................................QDISKALAKL...DKSR.TG
ENSBTAP00000004912  ..........................................................ALFMVAFQLF...DKAG.KG
ENSBTAP00000005979  ..........................................................QFVQRMFEKH...DQDR.DG
ENSBTAP00000053738  ..........................................................HAIAQEFENF...DTMK.TN
ENSBTAP00000053746  ..........................................................EKLRFLFHMY...DSDS.DG
ENSBTAP00000023221  ..........................................................--PKTFFKLH...DVNS.DG
ENSBTAP00000019429  ..........................................................----------...----.--
ENSBTAP00000052019  ..........................................................----------...----.--
ENSBTAP00000042244  ..........................................................----------...----.--
ENSBTAP00000053738  ..........................................................SAFCNMLRSY...DLGD.TG
ENSBTAP00000018877  ..........................................................----------...----.--
ENSBTAP00000053019  ..........................................................KDISKTFRKI...----.--
ENSBTAP00000003073  ..........................................................----------...----.--
ENSBTAP00000012886  ..........................................................-RYKKRFHKF...DADQ.KG
ENSBTAP00000044222  ..........................................................----------...----.--
ENSBTAP00000028499  ..........................................................----------...----.--
ENSBTAP00000047378  ..........................................................TRVWGLWEEL...GVGS.SG
ENSBTAP00000009308  ..........................................................TEVAKTFR--...----.--
ENSBTAP00000017060  ..........................................................----------...----.--
ENSBTAP00000050406  ..........................................................SDIAKTFRKA...----.--
ENSBTAP00000031879  ..........................................................SDIAKTFRKA...----.--
ENSBTAP00000031854  ..........................................................TVIQRIFYTV...NRSW.SG
ENSBTAP00000001250  ..........................................................DTIQLAFKMF...-GSQ.DG
ENSBTAP00000026035  ..........................................................----------...----.--
ENSBTAP00000011215  ..........................................................TVIQRIFYTV...NRSW.SG
ENSBTAP00000002128  ..........................................................DVLTDVVKAI...DKIK.DE
ENSBTAP00000053194  ..........................................................DELEDSFQAL...-AEG.KA
ENSBTAP00000056127  ..........................................................PRDERRFKAA...DLDS.DQ
ENSBTAP00000033188  ..........................................................SRVMDFFRRI...DKDQ.DG
ENSBTAP00000053548  ..........................................................SRVMDFFRRI...DKDQ.DG
ENSBTAP00000011687  ..........................................................RHSRPVFELL...DLDG.EL
ENSBTAP00000007636  ..........................................................NDVDTALSFY...HMA-.GA
ENSBTAP00000020950  ..........................................................EESFRQLHLK...DKKR.--
ENSBTAP00000009115  ..........................................................RAFQDAYNFF...NKDK.TG
ENSBTAP00000023873  ..........................................................----------...----.--
ENSBTAP00000054471  ..........................................................----------...----.--
ENSBTAP00000039694  ..........................................................EDFAIALNMY...NF-A.SR
ENSBTAP00000025205  ..........................................................----------...----.--
ENSBTAP00000047882  ..........................................................--QLHYFKMH...DYDG.NN
ENSBTAP00000001368  ..........................................................-PYLSAFGDL...DQNQ.DG
ENSBTAP00000029786  ..........................................................EKLKLLYKM-...----.--
ENSBTAP00000028993  ..........................................................----------...----.--
ENSBTAP00000023678  ..........................................................DNIREAFQIY...DKEA.SG
ENSBTAP00000034710  ..........................................................----------...----.--
ENSBTAP00000031823  ..........................................................ARDERRFRVA...DQDG.DS
ENSBTAP00000038002  ..........................................................DKLEFTFKLY...DTDR.NG
ENSBTAP00000021074  ..........................................................----------...----.--
ENSBTAP00000026544  ..........................................................VEFMRIWRKY...DADS.SG
ENSBTAP00000007217  ..........................................................ISPLDLFQLL...DQNH.DG
ENSBTAP00000029792  ..........................................................EKLKVLYKL-...----.--
ENSBTAP00000044088  ..........................................................EDFAIAMQMF...SLAH.R-
ENSBTAP00000017319  ..........................................................----------...----.--
ENSBTAP00000044100  ..........................................................-PFLDSFCVL...DKDQ.DG
ENSBTAP00000033594  ..........................................................----------...----.--
ENSBTAP00000026766  ..........................................................----------...----.--
ENSBTAP00000055894  ..........................................................TAFKEKYMEF...DLNN.EG
ENSBTAP00000015220  ..........................................................KTIGDMFQNQ...DRNQ.DG
ENSBTAP00000033613  ..........................................................MIVKNMFTNQ...DRNG.DG
ENSBTAP00000056320  ..........................................................PTSIEYWFRM...DLDG.DV
ENSBTAP00000025249  ..........................................................----------...----.--
ENSBTAP00000029159  ..........................................................ASFPFSFCVM...DKDR.EG
ENSBTAP00000044088  ..........................................................EDFAIAMQMF...SLAH.R-
ENSBTAP00000016319  ..........................................................A---------...----.--
ENSBTAP00000017662  ..........................................................EAFRSYFEIF...--NG.HG
ENSBTAP00000012479  ..........................................................EKLNLSFRKE...DRSF.SG
ENSBTAP00000029886  ..........................................................----------...----.--
ENSBTAP00000027388  ..........................................................EAFKKKYMEF...DLNE.DG
ENSBTAP00000039694  ..........................................................AGFRIAFNMF...DTDG.NE
ENSBTAP00000023673  ..........................................................EQAQELFLLC...DKEA.KG
ENSBTAP00000041488  ..........................................................EQAQELFLLC...DKEA.KG
ENSBTAP00000001452  ..........................................................----------...----.--
ENSBTAP00000028498  ..........................................................----------...----.--
ENSBTAP00000001426  ..........................................................EEFNAIFTFY...DKDG.SG
ENSBTAP00000020240  ..........................................................LTSSDTFKEY...DPDG.KG
ENSBTAP00000053650  ..........................................................LTSSDTFKEY...DPDG.KG
ENSBTAP00000041651  ..........................................................QVLLYLFALH...DYDQ.SG
ENSBTAP00000005154  ..........................................................----------...---A.DG
ENSBTAP00000021174  ..........................................................KEFNKAFELY...DQDG.NG
ENSBTAP00000022068  ..........................................................----------...----.--
ENSBTAP00000026682  ..........................................................AEIEAIFTKY...DQDG.DQ
ENSBTAP00000007636  ..........................................................NDVDTALSFY...HMAG.-A
ENSBTAP00000027954  ..........................................................---------F...DPGN.TG
ENSBTAP00000020778  ..........................................................----------...----.--
ENSBTAP00000013601  ..........................................................----------...----.--
ENSBTAP00000005477  ..........................................................SGIQQSFDILgftNSKG.EK
ENSBTAP00000055305  ..........................................................----DTFKEY...DPDG.KG
ENSBTAP00000036054  ..........................................................----DTFKEY...DPDG.KG
ENSBTAP00000004912  ..........................................................ELIRKIYSTL...AGNRkDV
ENSBTAP00000022292  ..........................................................EHARQAFALK...DKSK.SG
ENSBTAP00000002717  ..........................................................----------...----.--
ENSBTAP00000036015  ..........................................................----------...----.--
ENSBTAP00000051638  ..........................................................EKLKLLFKLH...----.--
ENSBTAP00000026766  ..........................................................EKAKYIFSLF...ASES.GS
ENSBTAP00000053738  ..........................................................QDISKALAKL...DKSR.TG
ENSBTAP00000016306  ..........................................................----------...----.--
ENSBTAP00000013714  ..........................................................----------...----.--
ENSBTAP00000036550  ..........................................................EKIKLLY---...----.--
ENSBTAP00000053738  ..........................................................-AFRKRFLDF...TKEP.NG
ENSBTAP00000023383  ..........................................................----------...----.--
ENSBTAP00000027030  ..........................................................ENSQEILKAL...DFSL.DG
ENSBTAP00000053270  ..........................................................ENSQEILKAL...DFSL.DG
ENSBTAP00000054640  ..........................................................ENSQEILKAL...DFSL.DG
ENSBTAP00000012770  ..........................................................HQTRIGLSLY...DVAG.QG
ENSBTAP00000009967  ..........................................................LETLQRFKAL...DAEQ.LG
ENSBTAP00000015183  ..........................................................EEYGELFDKV...DVAQ.EG
ENSBTAP00000014222  ..........................................................TKLTAAFTRF...DQDG.NG
ENSBTAP00000026288  ..........................................................----------...----.--
ENSBTAP00000002128  ..........................................................AAFQNALKIF...HRIK.CG
ENSBTAP00000003365  ..........................................................--LSDIFEVI...DLDG.NG
ENSBTAP00000053738  ..........................................................EKVEKALSAG...DPCT.SG
ENSBTAP00000009228  ..........................................................----------...----.--
ENSBTAP00000026785  ..........................................................----------...----.--
ENSBTAP00000002578  ..........................................................EKVQDNFDKI...EF--.--
ENSBTAP00000000106  ..........................................................----------...----.--
ENSBTAP00000028840  ..........................................................----------...----.--
ENSBTAP00000053594  ..........................................................ERFEEAFAQF...DAEG.DG
ENSBTAP00000055414  vnllqfvqlletfvgedsplsvsealtsffrkgfvetkeekmsglekarqnasrirreLLLKALFQKW...DCDG.SG
ENSBTAP00000026698  ..........................................................QTVAGAFSYF...QQDA.DG
ENSBTAP00000017015  ..........................................................----------...----.--
ENSBTAP00000049908  ..........................................................--LLMAFVYF...DQSH.CG
ENSBTAP00000021395  ..........................................................----------...----.--
ENSBTAP00000007194  ..........................................................VDCLLAFVYF...DANW.CG
ENSBTAP00000025455  ..........................................................LLLKALFQKW...DCDG.SG


                                                        110       120                               
                                                          |         |                               
d1qxpa2               ...................................SMSAYEMRMAIEAA.................GF..KLP.....
ENSBTAP00000019411  ...................................YISAAELRHVMTNL.................GE..KLT.....
ENSBTAP00000036057  ...................................YISAAELRHVMTNL.................GE..KLT.....
ENSBTAP00000038404  ...................................YISKAEMLEIVQAIykmvssvmkmpe.....DE..STP.....
ENSBTAP00000010971  ...................................YISREEMLEIVQAIykmvssvmkmpe.....DE..STP.....
ENSBTAP00000019803  ...................................TIGSSELPGAFEAA.................GF..RLN.....
ENSBTAP00000014038  ...................................YISNGELFQVLKMMv................GN..NLK.....
ENSBTAP00000002055  ...................................YISAAELRHVMTNL.................GE..KLT.....
ENSBTAP00000049731  ...................................YISAAELRHVMTNL.................GE..KLT.....
ENSBTAP00000005577  ...................................YISRSEMLEIVQAIykmvssvmkmpe.....DE..STP.....
ENSBTAP00000034949  ...................................TISKNEVLEIVTAIfkmispedtkhlpe...DE..NTP.....
ENSBTAP00000017447  ...................................YLTVDQLVSFLNEHqrdprlneilfpfy...DA..KRA.....
ENSBTAP00000010858  ...................................RIRVLSFKT-----.................--..---.....
ENSBTAP00000046644  ...................................YLTVDQMMDFINLKqrdprlneil.......YP..PLK.....
ENSBTAP00000022814  ...................................KITRVEMLEIIEAIykmvgtvimmkmne...DG..LTP.....
ENSBTAP00000019758  ...................................--------------.................--..---.....
ENSBTAP00000019321  ...................................RITRLEMLEIIEAIykmvgtvimmrmnq...DG..LTP.....
ENSBTAP00000011677  ...................................TINSYEMRNAVKDA.................GF..HLN.....
ENSBTAP00000011680  ...................................TINSYEMRNAVKDA.................GF..HLN.....
ENSBTAP00000021742  ...................................CITKEEMLDIMKSIydmmgkytypal.....RE..EAP.....
ENSBTAP00000005348  ...................................--------------.................--..---.....
ENSBTAP00000016609  ...................................--------------.................--..---.....
ENSBTAP00000012740  ...................................KIRVQSLKIGLIAL.................--..---.....
ENSBTAP00000018403  ...................................YISVDELRQATSQL.................GE..KVS.....
ENSBTAP00000026407  ...................................--------------.................--..---.....
ENSBTAP00000052557  ...................................KISFKNLKRVAKEL.................GE..NLT.....
ENSBTAP00000054167  ...................................YITKEEMLDIMKAIydmmgkctypvl.....KE..DAP.....
ENSBTAP00000010319  ...................................KISFKNLKRVAKEL.................GE..NLS.....
ENSBTAP00000041545  ...................................KLTLLEFVDFLQEEqke..............GE..RAS.....
ENSBTAP00000055204  ...................................MIDKNELKQALSGF.................GY..RLS.....
ENSBTAP00000003718  ...................................YINKEEMMDIVKAIydmmgkytypvl.....KE..DTP.....
ENSBTAP00000011676  ...................................TIDAHEMRTALKKA.................GF..TLS.....
ENSBTAP00000049395  ...................................TLSVDQLVTFLQHQqreeea...........GP..ALA.....
ENSBTAP00000054983  ...................................-----EMHGKNWSKlcrdcqvid........GR..SVT.....
ENSBTAP00000052219  ...................................TVDPQELQKALTTM.................GF..RLS.....
ENSBTAP00000025402  ...................................YMTKEHLAKFINQ-.................--..---.....
ENSBTAP00000011678  ...................................SMSAYEMRMAIEFA.................GF..KLN.....
ENSBTAP00000000433  ...................................--------------.................--..---.....
ENSBTAP00000021491  ...................................SISLNNIKRVAKEL.................GE..NLT.....
ENSBTAP00000044733  ...................................TMNSYEMRKALEEA.................GF..KMP.....
ENSBTAP00000010937  ...................................HLTVEELAQFLKVE.................QKmtNVT.....
ENSBTAP00000056439  ...................................HLTVEELAQFLKVE.................QKmtNVT.....
ENSBTAP00000055780  ...................................YIDLEELKIMLQAT.................GE..TIT.....
ENSBTAP00000038002  ...................................--------------.................--..---.....
ENSBTAP00000034705  ...................................VLSASELLEFLEDQ.................GEh.KAT.....
ENSBTAP00000035936  ...................................CIDRQELLDIVESIyklkkacsveveaeqqgKL..LTP.....
ENSBTAP00000013699  ...................................SISYTELQQALSQM.................GY..NLS.....
ENSBTAP00000002564  ..................................hVMDVVEVIHCLTAL.................YE..RLE.....
ENSBTAP00000011496  ...................................YITRNEMLDIVDAIyqmvgntvelpe.....EE..NTP.....
ENSBTAP00000019111  ...................................KISLRNLRRVAREL.................GE..NMS.....
ENSBTAP00000017036  ...................................CIDRDELLTIIRAIrainpcsd.........ST..MTA.....
ENSBTAP00000003213  ...................................HLDATDLLRFLEVEqkmt.............G-..-VT.....
ENSBTAP00000055444  ...................................HLDATDLLRFLEVEqkmt.............G-..-VT.....
ENSBTAP00000024550  ...................................SVEHHELNQAIAAM.................GY..RLS.....
ENSBTAP00000015248  ...................................FIHEDHLRELLTTM.................GD..RFT.....
ENSBTAP00000021328  ...................................TIQEDYLRELLTTM.................GD..RFT.....
ENSBTAP00000037091  ...................................TIQEDYLRELLTTM.................GD..RFT.....
ENSBTAP00000029967  ...................................CISLGELRAALKALl................GE..RLS.....
ENSBTAP00000021449  ...................................EITLGELQQAMQRLl................GD..KLT.....
ENSBTAP00000053176  ...................................--------------.................--..---.....
ENSBTAP00000042361  ...................................EISTSELREAMRKLl................GH..QVG.....
ENSBTAP00000016509  ...................................CIDRQELLDIVEVKrpwgppqg.........KL..LTP.....
ENSBTAP00000026714  ...................................EISTSELREAMRKLl................GH..QVG.....
ENSBTAP00000004690  ...................................TLNSYEMRLAVEKA.................GI..KLN.....
ENSBTAP00000010858  ...................................--------------.................--..---.....
ENSBTAP00000013117  ...................................FLDTKDLMMFLEAEqgvahi...........NE..EIS.....
ENSBTAP00000017574  ...................................LLEKNLVEFLMREQytldf............NK..SIA.....
ENSBTAP00000004885  ...................................KIEASEIVQSLQIL.................GL..TIS.....
ENSBTAP00000008961  ...................................--------------.................--..---.....
ENSBTAP00000028063  ...................................EISVSRLETVISSI.................YY..QLN.....
ENSBTAP00000012740  ...................................--------------.................--..---.....
ENSBTAP00000006283  ...................................RITVAELREAAPALl................GE..PLV.....
ENSBTAP00000014306  ...................................TVMGAEIRHVLVTL.................GE..KMT.....
ENSBTAP00000053252  ...................................YLDANDLMLFLEAEq................GVt.HIT.....
ENSBTAP00000014304  ...................................TVMGAEIRHVLVTL.................GE..KMT.....
ENSBTAP00000045669  ...................................KISVFAVKMALATL.................--..---.....
ENSBTAP00000041264  ...................................--------------.................--..---.....
ENSBTAP00000006711  ...................................--------------.................--..---.....
ENSBTAP00000017358  ...................................--------------.................--..---.....
ENSBTAP00000053274  ...................................KISVFAVKMALATL.................--..---.....
ENSBTAP00000055296  ...................................--------------.................--..---.....
ENSBTAP00000016852  ...................................VITIEDLREVYNAKhhpkyqn..........GE..WTE.....
ENSBTAP00000036380  ...................................YIMASELRSKLMQL.................GE..KLT.....
ENSBTAP00000041719  ...................................KVMGAELRHVLTTL.................GE..RMT.....
ENSBTAP00000049636  ...................................TVMGAELRHVLATL.................GE..KMK.....
ENSBTAP00000024444  ...................................VLKADYIKEMLTTQ.................AE..RFS.....
ENSBTAP00000004556  ...................................KLSNNEWCYCFQK-.................--..---.....
ENSBTAP00000038767  ...................................KISRDELLQVLRMMv................GV..NIS.....
ENSBTAP00000031285  ...................................--------------.................--..---.....
ENSBTAP00000011457  ...................................FISKEEMFHMLKNSllkqp............SE..EDPdegi.
ENSBTAP00000011047  ...................................TVMGAELRHVLATL.................GE..KLT.....
ENSBTAP00000002564  ...................................--------------.................--..---.....
ENSBTAP00000037104  ...................................FVKADFIKEKLMTQ.................AD..RFS.....
ENSBTAP00000002672  ...................................VVNKDEFRQLLLTQ.................AD..KFS.....
ENSBTAP00000028269  ...................................TIKKKFLEELLTTQ.................CD..RFS.....
ENSBTAP00000016647  ...................................KISRHEMLQALRLMv................GV..QVT.....
ENSBTAP00000004536  ...................................QIDVSEIQQSFRAL.................GI..SIS.....
ENSBTAP00000042177  ...................................DIGKKEIKPFKRFLr................KK..SKP.....
ENSBTAP00000028063  ...................................--------------.................--..---.....
ENSBTAP00000050283  ...................................TVMGAELRHVLATL.................GE..KMS.....
ENSBTAP00000048539  ...................................FITEQELAAILRAAf................G-..-VP.....
ENSBTAP00000045669  ...................................--------------.................--..---.....
ENSBTAP00000007972  ...................................VVTVDDLRGVYSGRthpkvrs..........GE..WTE.....
ENSBTAP00000040815  ...................................DINKREMKPFKRYV.................KK..KAK.....
ENSBTAP00000025661  ...................................FITEEEFSTILQASl................G-..-VP.....
ENSBTAP00000028350  ...................................TLNREDLSQLVNCLtgese............DT..RLSasem.
ENSBTAP00000053274  ...................................--------------.................--..---.....
ENSBTAP00000021537  ...................................YICAWDLEQTVTKLtr...............G-..ELS.....
ENSBTAP00000055481  ...................................HLTGPQARTILMQS.................S-..-LP.....
ENSBTAP00000039155  ...................................LVSTAKRRHAMTWL.................GK..KLN.....
ENSBTAP00000029333  ...................................HLTGPQARTILMQS.................S-..-LP.....
ENSBTAP00000016315  ...................................--------------.................--..---.....
ENSBTAP00000021091  ...................................SLNWAQLRAAMREA.................GI..MLS.....
ENSBTAP00000021618  ...................................LISKDEFIRMLRSFieis.............NN..CLTktql.
ENSBTAP00000055520  ...................................--------------.................--..---.....
ENSBTAP00000055624  ...................................--------------.................--..---.....
ENSBTAP00000016319  ...................................--------------.................--..---.....
ENSBTAP00000034078  ...................................FLSKDELIKYMTEE.................GE..PFS.....
ENSBTAP00000006645  ...................................FIDEEDLQRIILRLlnsddm...........SE..DLL.....
ENSBTAP00000021909  ...................................KMDKEETKDWILPS.................DY..DHA.....
ENSBTAP00000001426  ...................................YIEANELKGFLSDLlkkanrpy.........DE..PKL.....
ENSBTAP00000015802  ...................................RIDAQEIMQSLRDL.................GV..KIS.....
ENSBTAP00000032680  ...................................RIDAQEIMQSLRDL.................GV..KIS.....
ENSBTAP00000055007  ...................................--------------.................--..---.....
ENSBTAP00000020148  ...................................--------------.................--..---.....
ENSBTAP00000052345  ...................................FVSGLEVREIFLKT.................G-..-LP.....
ENSBTAP00000029334  ...................................YLSGFQARNALLQS.................N-..-LS.....
ENSBTAP00000052345  ...................................--------------.................--..---.....
ENSBTAP00000056127  ...................................KLDKDEISHWILPQ.................DY..DHA.....
ENSBTAP00000012557  ...................................LISMEEFRSMWRLFkshy.............SV..HID.....
ENSBTAP00000011888  plwdgrrtqregqrerpvsvtaqhwassspetgsgSIDADELRTVLQSClyes.............AI..SLPkekl.
ENSBTAP00000017060  ...................................--------------.................--..---.....
ENSBTAP00000031854  ...................................VLSMYELEYFYEEQ.................CE..RMEamgie
ENSBTAP00000031823  ...................................KLNGSEVGHWVLPP.................AQ..DQP.....
ENSBTAP00000021603  ...................................FLSKDEFFTMMRVPptprprsfieis.....NN..CLTktql.
ENSBTAP00000010838  ...................................--------------.................--..---.....
ENSBTAP00000014575  ...................................FICKEDLQLTLARLt................KS..ELD.....
ENSBTAP00000011215  ...................................VLSMYELEYFYEEQ.................CE..RMEamgie
ENSBTAP00000053698  ...................................RITLEELKHILYHAf................RD..HLT.....
ENSBTAP00000006806  ...................................--------------.................--..---.....
ENSBTAP00000029334  ...................................--------------.................--..---.....
ENSBTAP00000044105  ...................................--------------.................--..---.....
ENSBTAP00000026904  ...................................--------------.................--..---.....
ENSBTAP00000017060  ...................................YVSGQEVKEIFMHS.................G-..-LT.....
ENSBTAP00000055520  ...................................--------------.................--..---.....
ENSBTAP00000044226  ...................................--------------.................--..---.....
ENSBTAP00000055624  ...................................--------------.................--..---.....
ENSBTAP00000042182  ...................................TMNSYELRLALNAA.................GF..HLN.....
ENSBTAP00000010796  ...................................LLSVADFRKVLRQY.................SI..NLS.....
ENSBTAP00000021174  ...................................FIETEELKNFLKDLlekanktv.........DD..TKL.....
ENSBTAP00000006275  ...................................--------------.................--..---.....
ENSBTAP00000020950  ...................................RLDPQELLSWVVPN.................NQ..GIA.....
ENSBTAP00000053738  ...................................LLSVADFRKVLRQY.................SI..NLS.....
ENSBTAP00000004963  ...................................YISRERIYDMLKN-.................--..---.....
ENSBTAP00000023774  ...................................-LTVDELKRLLYDTf................CE..HLS.....
ENSBTAP00000020395  ...................................YVTKEELYQNLT--.................--..---.....
ENSBTAP00000020150  ...................................--------------.................--..---.....
ENSBTAP00000025561  ...................................--------------.................--..---.....
ENSBTAP00000053738  ...................................ILRRRDMKNALYGF.................DI..PLT.....
ENSBTAP00000034009  ...................................--------------.................--..---.....
ENSBTAP00000020539  ...................................SISLDEFRHTWKLFsshm.............NI..DIT.....
ENSBTAP00000020778  ...................................IVTMAELEDYMDPM.................NE..FSA.....
ENSBTAP00000017461  ...................................YLTLEDFKKAFKQV.................AP..KLS.....
ENSBTAP00000044096  ...................................--------------.................--..---.....
ENSBTAP00000008523  ...................................--------------.................--..---.....
ENSBTAP00000035196  ...................................ALSPDELKDLFKVFpyipw............GP..DVN.....
ENSBTAP00000041997  ...................................--------------.................--..---.....
ENSBTAP00000025499  ...................................FIEEEELGFILKGFspd..............AR..DLS.....
ENSBTAP00000055481  ...................................--------------.................--..---.....
ENSBTAP00000002174  ...................................--------------.................--..---.....
ENSBTAP00000000589  ...................................-------------Elpsfv............GE..KVD.....
ENSBTAP00000028239  ...................................--------------.................--..---.....
ENSBTAP00000014894  ...................................FITAEELRREL---.................--..---.....
ENSBTAP00000026544  ...................................ALEGPEVDGFVKDMmelvqpsir........GV..DL-.....
ENSBTAP00000029333  ...................................--------------.................--..---.....
ENSBTAP00000041966  ...................................VFLSSDLWKAIRDTdfla.............GI..SIT.....
ENSBTAP00000008933  ...................................--------------.................--..KLP.....
ENSBTAP00000056088  ...................................--------------.................--..---.....
ENSBTAP00000033794  ...................................--------------.................--..---.....
ENSBTAP00000012786  ...................................YILAEELRREL---.................--..---.....
ENSBTAP00000030018  ...................................YITAEELRREL---.................--..---.....
ENSBTAP00000040233  ...................................LVQPHELRRVLETF.................CL..KMK.....
ENSBTAP00000003365  ...................................SILHTDLYKLLTKK.................GE..KMT.....
ENSBTAP00000053176  ...................................FLDSSELENIISQMmhvaeylew........DV..--Tel...
ENSBTAP00000024301  ...................................YITVDELRRE----.................--..---.....
ENSBTAP00000022292  ...................................EVTFENVKEIFGQTti...............HH..HIPf....
ENSBTAP00000015611  ...................................--------------.................--..---.....
ENSBTAP00000012770  ...................................YLNVFSLNYFFRAIqelmkihg.........QD..PVSf....
ENSBTAP00000000847  ...................................--------------.................--..---.....
ENSBTAP00000053738  ...................................LVQPHELRRVLETF.................CL..KMK.....
ENSBTAP00000054975  ...................................YLDEEELKFFLQKFesg..............AR..ELT.....
ENSBTAP00000046639  ...................................SVSIIDIRKCYCAKmhprvi...........SG..HST.....
ENSBTAP00000052345  ...................................--------------.................--..---.....
ENSBTAP00000053164  ...................................VIDRAELQEACDQA.................CL..HLD.....
ENSBTAP00000016774  ...................................--------------.................--..---.....
ENSBTAP00000022630  ...................................--------------.................--..---.....
ENSBTAP00000010796  ...................................TASRDEFRSICTRH.................VQ..VLT.....
ENSBTAP00000021909  ...................................IATKEEFTAFL---.................--..---.....
ENSBTAP00000033974  ...................................YIDWDTLKYVLMNV.................GE..PLN.....
ENSBTAP00000006711  ...................................LLDQAEMDRIVSQMlhiaqylew........DP..TEL.....
ENSBTAP00000010796  ...................................YISLGRLQRLLQEC.................GC..SLK.....
ENSBTAP00000004912  ...................................EVTFEDVKQVFGQTti...............HQ..HIP.....
ENSBTAP00000005979  ...................................ALSPAELQSLFSVFpaapw............G-..---.....
ENSBTAP00000053738  ...................................TASRDEFRSICTRH.................VQ..VLT.....
ENSBTAP00000053746  ...................................RITLEEYRNVVEELlsg..............NP..HIE.....
ENSBTAP00000023221  ...................................FLDEQELEALFTKElekvydpkne.......E-..---.....
ENSBTAP00000019429  ...................................--------------.................--..---.....
ENSBTAP00000052019  ...................................--------------.................--..---.....
ENSBTAP00000042244  ...................................--------------.................--..---.....
ENSBTAP00000053738  ...................................LIGRNNFKKIMRVF.................CP..FLT.....
ENSBTAP00000018877  ...................................--------------.................--..---.....
ENSBTAP00000053019  ...................................--------------.................--..---.....
ENSBTAP00000003073  ...................................--------------.................--..---.....
ENSBTAP00000012886  ...................................FITIVDVQRVLESI.................GV..QMD.....
ENSBTAP00000044222  ...................................--------------.................--..---.....
ENSBTAP00000028499  ...................................--------------.................--..---.....
ENSBTAP00000047378  ...................................HLTEQELALVCQSI.................GLq.GLA.....
ENSBTAP00000009308  ...................................--------------.................--..---.....
ENSBTAP00000017060  ...................................--------------.................--..---.....
ENSBTAP00000050406  ...................................--------------.................--..---.....
ENSBTAP00000031879  ...................................--------------.................--..---.....
ENSBTAP00000031854  ...................................KITATEIR------.................--..---.....
ENSBTAP00000001250  ...................................SVEEHALSSILKTAl................G-..-VA.....
ENSBTAP00000026035  ...................................--------------.................--..---.....
ENSBTAP00000011215  ...................................KITATEIR------.................--..---.....
ENSBTAP00000002128  ...................................NIDYGDLNTCLQNL.................GV..YLS.....
ENSBTAP00000053194  ...................................YITKEDMKQALT--.................--..---.....
ENSBTAP00000056127  ...................................TATREEFTAFL---.................--..---.....
ENSBTAP00000033188  ...................................KITRQEFIDGILAS.................KF..PTT.....
ENSBTAP00000053548  ...................................KITRQEFIDGILSS.................KF..PTS.....
ENSBTAP00000011687  ...................................KIGPDHLHMYNFLF.................N-..-IK.....
ENSBTAP00000007636  ...................................SLDKVTMQQVARTVa................KV..ELS.....
ENSBTAP00000020950  ...................................--------------.................--..---.....
ENSBTAP00000009115  ...................................CIDLHGMMCTLAKL.................GM..NLT.....
ENSBTAP00000023873  ...................................--------------.................--..---.....
ENSBTAP00000054471  ...................................--------------.................--..---.....
ENSBTAP00000039694  ...................................SIGQDEFKRAVYVAt................GL..KLS.....
ENSBTAP00000025205  ...................................--------------.................--..---.....
ENSBTAP00000047882  ...................................LLDGLELSTAITHVhkeegse..........QA..PMN.....
ENSBTAP00000001368  ...................................CISKEEMVSYF---.................--..---.....
ENSBTAP00000029786  ...................................--------------.................--..---.....
ENSBTAP00000028993  ...................................--------------.................--..---.....
ENSBTAP00000023678  ...................................YVDRETFFKICGSY.................QL..PVD.....
ENSBTAP00000034710  ...................................--------------.................--..---.....
ENSBTAP00000031823  ...................................MATREELTAFL---.................--..---.....
ENSBTAP00000038002  ...................................ILDSSEVDRIIIQMmrmaeyl..........DW..DVSel...
ENSBTAP00000021074  ...................................--------------.................--..---.....
ENSBTAP00000026544  ...................................FISAAELCNFLRDL.................--..---.....
ENSBTAP00000007217  ...................................RLQLREVLAQNRLGn................GR..WMT.....
ENSBTAP00000029792  ...................................--------------.................--..---.....
ENSBTAP00000044088  ...................................PVRLAEFKRAVKVAt................GQ..ELS.....
ENSBTAP00000017319  ...................................--------------.................--..---.....
ENSBTAP00000044100  ...................................LISKDEMMAYFLRA.................--..---.....
ENSBTAP00000033594  ...................................--------------.................--..---.....
ENSBTAP00000026766  ...................................--------------.................--..---.....
ENSBTAP00000055894  ...................................EIDLMSLKRMMEKL.................GV..PKT.....
ENSBTAP00000015220  ...................................KITAEELK------.................--..---.....
ENSBTAP00000033613  ...................................KVTAEEFK------.................--..---.....
ENSBTAP00000056320  ...................................ALFMFELEYFYEEQ.................SR..RLDsmaie
ENSBTAP00000025249  ...................................--------------.................--..---.....
ENSBTAP00000029159  ...................................LISRDEITAYFM--.................--..---.....
ENSBTAP00000044088  ...................................PVRLAEFKRAVKVAt................GQ..ELS.....
ENSBTAP00000016319  ...................................--------------.................--..---.....
ENSBTAP00000017662  ...................................EVDAQSLENILLLV.................GI..SLT.....
ENSBTAP00000012479  ...................................CLPPPKVRAICGKH.................GL..YLT.....
ENSBTAP00000029886  ...................................--------------.................--..-LR.....
ENSBTAP00000027388  ...................................GIDIMSLKRMMEKL.................GV..PKT.....
ENSBTAP00000039694  ...................................MVDKKEFLVLQEIF.................RK..KNE.....
ENSBTAP00000023673  ...................................FITRHDLQGLQSDL.................P-..-LT.....
ENSBTAP00000041488  ...................................FITRHDLQGLQSDL.................P-..-LT.....
ENSBTAP00000001452  ...................................--------------.................--..---.....
ENSBTAP00000028498  ...................................--------------.................--..---.....
ENSBTAP00000001426  ...................................YIDENELDALLKD-.................--..---.....
ENSBTAP00000020240  ...................................VISKRDFHKAMESH.................K-..HYT.....
ENSBTAP00000053650  ...................................VISKRDFHKAMESH.................K-..HYT.....
ENSBTAP00000041651  ...................................QLDGLELLSMLTAAlapgas...........DS..PTTnpv..
ENSBTAP00000005154  ...................................VLSPGELRELFSGVd................GH..PAD.....
ENSBTAP00000021174  ...................................YIDENELDALLKDL.................CE..KNK.....
ENSBTAP00000022068  ...................................--------------.................--..---.....
ENSBTAP00000026682  ...................................ELTEHE--------.................--..---.....
ENSBTAP00000007636  ...................................SLDKVTMQQVARTVa................KV..ELS.....
ENSBTAP00000027954  ...................................FISTGKFRSLLDSH.................SS..KLD.....
ENSBTAP00000020778  ...................................--------------.................--..---.....
ENSBTAP00000013601  ...................................--------------.................--..---.....
ENSBTAP00000005477  ...................................AIQREDFLNLLHTK.................GE..HMT.....
ENSBTAP00000055305  ...................................IISKKEFQKAMEGQ.................K-..QYT.....
ENSBTAP00000036054  ...................................IISKKEFQKAMEGQ.................K-..QYT.....
ENSBTAP00000004912  ...................................EVTKEEFVLAAQKF.................G-..QVT.....
ENSBTAP00000022292  ...................................LISGLDFSDIMVTIr................SH..MLT.....
ENSBTAP00000002717  ...................................--------------.................--..---.....
ENSBTAP00000036015  ...................................--------------.................--..---.....
ENSBTAP00000051638  ...................................--------------.................--..---.....
ENSBTAP00000026766  ...................................YVIREEMERMLHVV.................DG..KVP.....
ENSBTAP00000053738  ...................................YISLGRLQRLLQEC.................GC..SLK.....
ENSBTAP00000016306  ...................................-----------HTI.................--..---.....
ENSBTAP00000013714  ...................................--------------.................--..---.....
ENSBTAP00000036550  ...................................--------------.................--..---.....
ENSBTAP00000053738  ...................................KIHTHDFKKVLEDY.................GM..PMD.....
ENSBTAP00000023383  ...................................--------------.................--..---.....
ENSBTAP00000027030  ...................................NVNLTELTLALE--.................--..---.....
ENSBTAP00000053270  ...................................NVNLTELTLALE--.................--..---.....
ENSBTAP00000054640  ...................................NVNLTELTLALE--.................--..---.....
ENSBTAP00000012770  ...................................YLRESDLENYILELiptlpqld.........GL..EKS.....
ENSBTAP00000009967  ...................................TITYEQYKQA----.................--..---.....
ENSBTAP00000015183  ...................................FINWDKLTSFL---.................--..---.....
ENSBTAP00000014222  ...................................VLDEKEQK------.................--..---.....
ENSBTAP00000026288  ...................................--------------.................--..---.....
ENSBTAP00000002128  ...................................RVPVSEVDKVLDSM.................DI..LVV.....
ENSBTAP00000003365  ...................................LLSLEEYNFFELRTs................GE..KCD.....
ENSBTAP00000053738  ...................................YVSLNYLKIVLDTF.................VY..RLP.....
ENSBTAP00000009228  ...................................--------------.................--..---.....
ENSBTAP00000026785  ...................................VISVSELINAMKQI.................K-..HIP.....
ENSBTAP00000002578  ...................................--------------.................--..---.....
ENSBTAP00000000106  ...................................--------------.................--..---.....
ENSBTAP00000028840  ...................................--------------.................--..---.....
ENSBTAP00000053594  ...................................TVDAENMLEALKNSs................GA..NL-.....
ENSBTAP00000055414  ...................................FLDLKEIDELLYTY.................KE..GME.....
ENSBTAP00000026698  ...................................LVDFRDVALALAAL.................SG..GRS.....
ENSBTAP00000017015  ...................................--------------.................--..---.....
ENSBTAP00000049908  ...................................YLLEKDLEEIFYTL.................GL..HLS.....
ENSBTAP00000021395  ...................................--------------.................--..---.....
ENSBTAP00000007194  ...................................YLHRRDLERILLTL.................GL..RLS.....
ENSBTAP00000025455  ...................................FLDLKEIDELLYTY.................KE..GME.....


                          130                                                                       
                            |                                                                       
d1qxpa2               ....CQL...................................................................HQVI
ENSBTAP00000019411  ....DEE...................................................................VDEM
ENSBTAP00000036057  ....DEE...................................................................VDEM
ENSBTAP00000038404  ....EKR...................................................................TEKI
ENSBTAP00000010971  ....EKR...................................................................TEKI
ENSBTAP00000019803  ....EHL...................................................................YNMI
ENSBTAP00000014038  ....DTQ...................................................................LQQI
ENSBTAP00000002055  ....DEE...................................................................VDEM
ENSBTAP00000049731  ....DEE...................................................................VDEM
ENSBTAP00000005577  ....EKR...................................................................TDKI
ENSBTAP00000034949  ....EKR...................................................................AEKI
ENSBTAP00000017447  ....MQI...................................................................IEMY
ENSBTAP00000010858  ....---...................................................................----
ENSBTAP00000046644  ....QEQ...................................................................VQVL
ENSBTAP00000022814  ....EQR...................................................................VDKI
ENSBTAP00000019758  ....---...................................................................----
ENSBTAP00000019321  ....QQR...................................................................VDKI
ENSBTAP00000011677  ....NQL...................................................................YDII
ENSBTAP00000011680  ....NQL...................................................................YDII
ENSBTAP00000021742  ....REH...................................................................VESF
ENSBTAP00000005348  ....---...................................................................----
ENSBTAP00000016609  ....--Eiferflnklclrpd.....................................................IDKI
ENSBTAP00000012740  ....---...................................................................----
ENSBTAP00000018403  ....QDE...................................................................LDAM
ENSBTAP00000026407  ....---...................................................................----
ENSBTAP00000052557  ....DEE...................................................................LQEM
ENSBTAP00000054167  ....RQH...................................................................VETF
ENSBTAP00000010319  ....DEE...................................................................LQEM
ENSBTAP00000041545  ....DLA...................................................................LELI
ENSBTAP00000055204  ....DQF...................................................................HDIL
ENSBTAP00000003718  ....RQH...................................................................VDIF
ENSBTAP00000011676  ....DQV...................................................................QQTI
ENSBTAP00000049395  ....LSL...................................................................IERY
ENSBTAP00000054983  ....VTD...................................................................VDIV
ENSBTAP00000052219  ....PQA...................................................................VNSI
ENSBTAP00000025402  ....---...................................................................----
ENSBTAP00000011678  ....KKL...................................................................YELI
ENSBTAP00000000433  ....---...................................................................----
ENSBTAP00000021491  ....DDE...................................................................LQEM
ENSBTAP00000044733  ....CQL...................................................................HQVI
ENSBTAP00000010937  ....TDY...................................................................CIDI
ENSBTAP00000056439  ....TDY...................................................................CIDI
ENSBTAP00000055780  ....EDD...................................................................IEEL
ENSBTAP00000038002  ....---...................................................................----
ENSBTAP00000034705  ....LAH...................................................................AQQL
ENSBTAP00000035936  ....EEV...................................................................VDRI
ENSBTAP00000013699  ....PQF...................................................................TQLL
ENSBTAP00000002564  ....E--...................................................................----
ENSBTAP00000011496  ....EKR...................................................................VDRI
ENSBTAP00000019111  ....DEE...................................................................LRAM
ENSBTAP00000017036  ....EEF...................................................................TDTV
ENSBTAP00000003213  ....LES...................................................................CRDI
ENSBTAP00000055444  ....LES...................................................................CRDI
ENSBTAP00000024550  ....PQT...................................................................VTTI
ENSBTAP00000015248  ....DEE...................................................................VDEM
ENSBTAP00000021328  ....DEE...................................................................VDEL
ENSBTAP00000037091  ....DEE...................................................................VDEL
ENSBTAP00000029967  ....QRE...................................................................VDEI
ENSBTAP00000021449  ....SQE...................................................................ISEV
ENSBTAP00000053176  ....---...................................................................----
ENSBTAP00000042361  ....HRD...................................................................IEEI
ENSBTAP00000016509  ....EEV...................................................................VDRI
ENSBTAP00000026714  ....HRD...................................................................IEEI
ENSBTAP00000004690  ....NKV...................................................................TQVL
ENSBTAP00000010858  ....---...................................................................----
ENSBTAP00000013117  ....LEI...................................................................IHKY
ENSBTAP00000017574  ....SEI...................................................................IQKY
ENSBTAP00000004885  ....EQQ...................................................................AELI
ENSBTAP00000008961  ....---...................................................................----
ENSBTAP00000028063  ....KRLpsthqisveqsisll....................................................LNFM
ENSBTAP00000012740  ....---...................................................................----
ENSBTAP00000006283  ....GPE...................................................................LEEM
ENSBTAP00000014306  ....EEE...................................................................VEML
ENSBTAP00000053252  ....EDM...................................................................CLDI
ENSBTAP00000014304  ....EEE...................................................................VEML
ENSBTAP00000045669  ....---...................................................................----
ENSBTAP00000041264  ....---...................................................................----
ENSBTAP00000006711  ....---...................................................................----
ENSBTAP00000017358  ....---...................................................................----
ENSBTAP00000053274  ....---...................................................................----
ENSBTAP00000055296  ....---...................................................................----
ENSBTAP00000016852  ....EQV...................................................................FRKF
ENSBTAP00000036380  ....HKE...................................................................VEDL
ENSBTAP00000041719  ....EEE...................................................................VESV
ENSBTAP00000049636  ....EEE...................................................................VEAL
ENSBTAP00000024444  ....KEE...................................................................IDQM
ENSBTAP00000004556  ....---...................................................................----
ENSBTAP00000038767  ....DEQ...................................................................LGSI
ENSBTAP00000031285  ....---...................................................................----
ENSBTAP00000011457  ....KDL...................................................................VEIT
ENSBTAP00000011047  ....EDE...................................................................VEKL
ENSBTAP00000002564  ....---...................................................................----
ENSBTAP00000037104  ....EEE...................................................................VKQM
ENSBTAP00000002672  ....PAE...................................................................VEQM
ENSBTAP00000028269  ....QEE...................................................................IKNM
ENSBTAP00000016647  ....EEQ...................................................................LESI
ENSBTAP00000004536  ....LEQ...................................................................AEKI
ENSBTAP00000042177  ....KKC...................................................................VKKF
ENSBTAP00000028063  ....---...................................................................----
ENSBTAP00000050283  ....EAE...................................................................VEQL
ENSBTAP00000048539  ....DLD...................................................................VSTL
ENSBTAP00000045669  ....---...................................................................----
ENSBTAP00000007972  ....EQV...................................................................LRHF
ENSBTAP00000040815  ....PKK...................................................................CARR
ENSBTAP00000025661  ....DLD...................................................................VSGL
ENSBTAP00000028350  ....KQL...................................................................IDNI
ENSBTAP00000053274  ....---...................................................................----
ENSBTAP00000021537  ....TEEvsli...............................................................CEKV
ENSBTAP00000055481  ....QAQ...................................................................LASI
ENSBTAP00000039155  ....NQE...................................................................VEEM
ENSBTAP00000029333  ....QAQ...................................................................LASI
ENSBTAP00000016315  ....---...................................................................----
ENSBTAP00000021091  ....DDV...................................................................CQLM
ENSBTAP00000021618  ....AEV...................................................................VESM
ENSBTAP00000055520  ....---...................................................................----
ENSBTAP00000055624  ....---...................................................................----
ENSBTAP00000016319  ....---...................................................................----
ENSBTAP00000034078  ....QEE...................................................................MEEM
ENSBTAP00000006645  ....TDL...................................................................TSHV
ENSBTAP00000021909  ....EAE...................................................................ARHL
ENSBTAP00000001426  ....QEY...................................................................TQTI
ENSBTAP00000015802  ....EQQ...................................................................AEKI
ENSBTAP00000032680  ....EQQ...................................................................AEKI
ENSBTAP00000055007  ....---...................................................................----
ENSBTAP00000020148  ....---...................................................................----
ENSBTAP00000052345  ....SAL...................................................................LAHI
ENSBTAP00000029334  ....QTQ...................................................................LATI
ENSBTAP00000052345  ....---...................................................................----
ENSBTAP00000056127  ....QAE...................................................................ARHL
ENSBTAP00000012557  ....DSQ...................................................................FDEL
ENSBTAP00000011888  ....DQL...................................................................TLAL
ENSBTAP00000017060  ....---...................................................................----
ENSBTAP00000031854  plpfHDL...................................................................LCQM
ENSBTAP00000031823  ....LVE...................................................................ANHL
ENSBTAP00000021603  ....AEV...................................................................VESM
ENSBTAP00000010838  ....---...................................................................----
ENSBTAP00000014575  ....EDEvvlv...............................................................CDKV
ENSBTAP00000011215  plpfHDL...................................................................LCQM
ENSBTAP00000053698  ....MKD...................................................................IENI
ENSBTAP00000006806  ....---...................................................................----
ENSBTAP00000029334  ....---...................................................................----
ENSBTAP00000044105  ....---...................................................................----
ENSBTAP00000026904  ....---...................................................................----
ENSBTAP00000017060  ....QNL...................................................................LAHI
ENSBTAP00000055520  ....---...................................................................----
ENSBTAP00000044226  ....---...................................................................----
ENSBTAP00000055624  ....---...................................................................----
ENSBTAP00000042182  ....NQL...................................................................TQAL
ENSBTAP00000010796  ....EEE...................................................................FFHI
ENSBTAP00000021174  ....AEY...................................................................TDLM
ENSBTAP00000006275  ....---...................................................................----
ENSBTAP00000020950  ....QEE...................................................................ARHL
ENSBTAP00000053738  ....EEE...................................................................FFHI
ENSBTAP00000004963  ....---...................................................................----
ENSBTAP00000023774  ....MKD...................................................................IENI
ENSBTAP00000020395  ....REQ...................................................................ADYC
ENSBTAP00000020150  ....---...................................................................----
ENSBTAP00000025561  ....---...................................................................----
ENSBTAP00000053738  ....PRE...................................................................FEKL
ENSBTAP00000034009  ....---...................................................................----
ENSBTAP00000020539  ....DDC...................................................................ICDL
ENSBTAP00000020778  ....LNE...................................................................AKQM
ENSBTAP00000017461  ....ERI...................................................................ILEV
ENSBTAP00000044096  ....---...................................................................----
ENSBTAP00000008523  ....---...................................................................----
ENSBTAP00000035196  ....N--...................................................................----
ENSBTAP00000041997  ....---...................................................................----
ENSBTAP00000025499  ....VKE...................................................................TKTL
ENSBTAP00000055481  ....---...................................................................----
ENSBTAP00000002174  ....---...................................................................----
ENSBTAP00000000589  ....EEG...................................................................LKKL
ENSBTAP00000028239  ....---...................................................................----
ENSBTAP00000014894  ....---...................................................................----
ENSBTAP00000026544  ....DKF...................................................................REIL
ENSBTAP00000029333  ....---...................................................................----
ENSBTAP00000041966  ....SEL...................................................................LDLM
ENSBTAP00000008933  ....NSV...................................................................LGKI
ENSBTAP00000056088  ....---...................................................................----
ENSBTAP00000033794  ....---...................................................................----
ENSBTAP00000012786  ....---...................................................................----
ENSBTAP00000030018  ....---...................................................................----
ENSBTAP00000040233  ....DEE...................................................................YKKF
ENSBTAP00000003365  ....REE...................................................................VNAI
ENSBTAP00000053176  ....NPI...................................................................LHEM
ENSBTAP00000024301  ....---...................................................................----
ENSBTAP00000022292  ....NWD...................................................................CEFI
ENSBTAP00000015611  ....---...................................................................----
ENSBTAP00000012770  ....QDV...................................................................KDEI
ENSBTAP00000000847  ....---...................................................................----
ENSBTAP00000053738  ....DEE...................................................................YKKF
ENSBTAP00000054975  ....ESE...................................................................TKSL
ENSBTAP00000046639  ....EEE...................................................................IKSS
ENSBTAP00000052345  ....---...................................................................----
ENSBTAP00000053164  ....EKL...................................................................LDQL
ENSBTAP00000016774  ....---...................................................................----
ENSBTAP00000022630  ....---...................................................................----
ENSBTAP00000010796  ....DEQ...................................................................FDRL
ENSBTAP00000021909  ....---...................................................................----
ENSBTAP00000033974  ....EQ-...................................................................---M
ENSBTAP00000006711  ....RPI...................................................................LKEM
ENSBTAP00000010796  ....EEE...................................................................LIDL
ENSBTAP00000004912  ....FNW...................................................................DSEF
ENSBTAP00000005979  ....---...................................................................----
ENSBTAP00000053738  ....DEQ...................................................................FDRL
ENSBTAP00000053746  ....KES...................................................................ARSI
ENSBTAP00000023221  ....--Ddmvemeeerlrm.......................................................REHV
ENSBTAP00000019429  ....---...................................................................----
ENSBTAP00000052019  ....---...................................................................----
ENSBTAP00000042244  ....---...................................................................----
ENSBTAP00000053738  ....TEH...................................................................LVKL
ENSBTAP00000018877  ....---...................................................................----
ENSBTAP00000053019  ....---...................................................................----
ENSBTAP00000003073  ....---...................................................................----
ENSBTAP00000012886  ....ENT...................................................................LHEI
ENSBTAP00000044222  ....---...................................................................----
ENSBTAP00000028499  ....---...................................................................----
ENSBTAP00000047378  ....KEE...................................................................LEDL
ENSBTAP00000009308  ....---...................................................................----
ENSBTAP00000017060  ....---...................................................................----
ENSBTAP00000050406  ....---...................................................................----
ENSBTAP00000031879  ....---...................................................................----
ENSBTAP00000031854  ....---...................................................................----
ENSBTAP00000001250  ....ELT...................................................................VTDL
ENSBTAP00000026035  ....---...................................................................----
ENSBTAP00000011215  ....---...................................................................----
ENSBTAP00000002128  ....KPE...................................................................FQKI
ENSBTAP00000053194  ....---...................................................................----
ENSBTAP00000056127  ....---...................................................................----
ENSBTAP00000033188  ....KLE...................................................................MTAV
ENSBTAP00000053548  ....RLE...................................................................MSAV
ENSBTAP00000011687  ....KQQ...................................................................LRDL
ENSBTAP00000007636  ....DHV...................................................................CDVV
ENSBTAP00000020950  ....---...................................................................----
ENSBTAP00000009115  ....KHD...................................................................VHNE
ENSBTAP00000023873  ....---...................................................................----
ENSBTAP00000054471  ....---...................................................................----
ENSBTAP00000039694  ....PHL...................................................................VNTV
ENSBTAP00000025205  ....---...................................................................----
ENSBTAP00000047882  ....EDE...................................................................LINL
ENSBTAP00000001368  ....---...................................................................----
ENSBTAP00000029786  ....---...................................................................----
ENSBTAP00000028993  ....---...................................................................----
ENSBTAP00000023678  ....DSL...................................................................IKEL
ENSBTAP00000034710  ....---...................................................................----
ENSBTAP00000031823  ....---...................................................................----
ENSBTAP00000038002  ....RPI...................................................................LQEM
ENSBTAP00000021074  ....---...................................................................----
ENSBTAP00000026544  ....---...................................................................----
ENSBTAP00000007217  ....PET...................................................................IQEM
ENSBTAP00000029792  ....---...................................................................----
ENSBTAP00000044088  ....NNI...................................................................LDTV
ENSBTAP00000017319  ....---...................................................................----
ENSBTAP00000044100  ....---...................................................................----
ENSBTAP00000033594  ....---...................................................................----
ENSBTAP00000026766  ....---...................................................................----
ENSBTAP00000055894  ....HLE...................................................................MKKM
ENSBTAP00000015220  ....---...................................................................----
ENSBTAP00000033613  ....---...................................................................----
ENSBTAP00000056320  alpfEDC...................................................................MCQM
ENSBTAP00000025249  ....---...................................................................----
ENSBTAP00000029159  ....---...................................................................----
ENSBTAP00000044088  ....NNI...................................................................LDTV
ENSBTAP00000016319  ....---...................................................................----
ENSBTAP00000017662  ....TAQ...................................................................VEGA
ENSBTAP00000012479  ....LSL...................................................................LETL
ENSBTAP00000029886  ....GLC...................................................................VDAL
ENSBTAP00000027388  ....HLE...................................................................LKKL
ENSBTAP00000039694  ....KREtkgdeekramlrlqlygyhsptnsvlktdaeelvsrsywdtlrrntsqalfsdfaeradditnlvtdTTLL
ENSBTAP00000023673  ....PEQ...................................................................LEAV
ENSBTAP00000041488  ....PEQ...................................................................LEAV
ENSBTAP00000001452  ....---...................................................................----
ENSBTAP00000028498  ....---...................................................................----
ENSBTAP00000001426  ....---...................................................................----
ENSBTAP00000020240  ....QSE...................................................................TEFL
ENSBTAP00000053650  ....QSE...................................................................TEFL
ENSBTAP00000041651  ....ILV...................................................................VDKV
ENSBTAP00000005154  ....NLE...................................................................TEKL
ENSBTAP00000021174  ....---...................................................................----
ENSBTAP00000022068  ....---...................................................................----
ENSBTAP00000026682  ....---...................................................................----
ENSBTAP00000007636  ....DHV...................................................................CDVV
ENSBTAP00000027954  ....PHK...................................................................REVL
ENSBTAP00000020778  ....---...................................................................----
ENSBTAP00000013601  ....---...................................................................----
ENSBTAP00000005477  ....EEE...................................................................MTDC
ENSBTAP00000055305  ....QSE...................................................................IDFL
ENSBTAP00000036054  ....QSE...................................................................IDFL
ENSBTAP00000004912  ....PME...................................................................VDIL
ENSBTAP00000022292  ....PFV...................................................................EENL
ENSBTAP00000002717  ....---...................................................................----
ENSBTAP00000036015  ....---...................................................................----
ENSBTAP00000051638  ....---...................................................................----
ENSBTAP00000026766  ....DTL...................................................................RK--
ENSBTAP00000053738  ....EEE...................................................................LIDL
ENSBTAP00000016306  ....---...................................................................----
ENSBTAP00000013714  ....---...................................................................----
ENSBTAP00000036550  ....---...................................................................----
ENSBTAP00000053738  ....DDQ...................................................................YALL
ENSBTAP00000023383  ....---...................................................................----
ENSBTAP00000027030  ....---...................................................................----
ENSBTAP00000053270  ....---...................................................................----
ENSBTAP00000054640  ....---...................................................................----
ENSBTAP00000012770  ....--Fysfyvcta...........................................................VRKF
ENSBTAP00000009967  ....---...................................................................----
ENSBTAP00000015183  ....---...................................................................----
ENSBTAP00000014222  ....---...................................................................----
ENSBTAP00000026288  ....---...................................................................----
ENSBTAP00000002128  ....PET...................................................................LQEV
ENSBTAP00000003365  ....EDA...................................................................WAVC
ENSBTAP00000053738  ....RRI...................................................................FIQL
ENSBTAP00000009228  ....---...................................................................----
ENSBTAP00000026785  ....ESK...................................................................LLSL
ENSBTAP00000002578  ....---...................................................................----
ENSBTAP00000000106  ....---...................................................................----
ENSBTAP00000028840  ....---...................................................................----
ENSBTAP00000053594  ....---...................................................................----
ENSBTAP00000055414  ....KE-...................................................................----
ENSBTAP00000026698  ....LEE...................................................................LT--
ENSBTAP00000017015  ....---...................................................................----
ENSBTAP00000049908  ....RAQ...................................................................VKKL
ENSBTAP00000021395  ....---...................................................................----
ENSBTAP00000007194  ....AEQ...................................................................AKQL
ENSBTAP00000025455  ....KE-...................................................................----


                                          140                  150               160         170    
                                            |                    |                 |           |    
d1qxpa2               ............V...ARFA..D...D....ELI....IDFDNFVRCLVRLE........ILFK..IFKQLDPENTGT
ENSBTAP00000019411  ............Ir..EADI..D...G....DGQ....VNYEEFVQMM----........----..------------
ENSBTAP00000036057  ............Ir..EADI..D...G....DGQ....VNYEEFVQMM----........----..------------
ENSBTAP00000038404  ............Fr..QMDT..N...R....DGK....LSLEEFIR------........----..------------
ENSBTAP00000010971  ............Fr..QMDT..N...N....DGK....LSLEEFIR------........----..------------
ENSBTAP00000019803  ............I...RRYS..D...E....GGN....MDFDNFISCLVRLD........AMFR..AFKSLDKDGTGQ
ENSBTAP00000014038  ........vdktIi..NADK..D...G....DGR....ISFEEFCA------........----..------------
ENSBTAP00000002055  ............Ir..EADI..D...G....DGQ....VNYEEFVQMM----........----..------------
ENSBTAP00000049731  ............Ir..EADI..D...G....DGQ....VNYEEFVHMM----........----..------------
ENSBTAP00000005577  ............Fr..QMDT..N...N....DGK....LSLEEFIKGAKSDP........S---..------------
ENSBTAP00000034949  ............Wg..FFGK..K...D....DDK....LTEKEFIE------........----..------------
ENSBTAP00000017447  ............Ep..DEDL..K...K....QGL....ISSDGFCRYLMSD-........----..------------
ENSBTAP00000010858  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000046644  ............Ie..KYEP..N...NslakKGQ....ISVDGFMRYLS---........----..------------
ENSBTAP00000022814  ............Fs..KMDK..N...K....DDQ....ITLDEFKEAAK---........----..------------
ENSBTAP00000019758  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000019321  ............Fk..KMDQ..D...K....DDQ....ITLEEFKEAAK---........----..------------
ENSBTAP00000011677  ............T...MRYA..D...K....YMN....IDFDSFICCFVRLE........GMFR..AFNAFDKDGDGI
ENSBTAP00000011680  ............T...MRYA..D...K....YMN....IDFDSFICCFVRLE........GMFR..AFNAFDKDGDGI
ENSBTAP00000021742  ............Fq..KMDR..N...K....DGV....VTIEEFIESCQKDE........NIMR..SMQLFD------
ENSBTAP00000005348  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000016609  ............Ll..EIGA..K...G....KPY....LTLEQLMDFI----........----..------------
ENSBTAP00000012740  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000018403  ............Ir..EADV..D...Q....DGR....VNYEEFVRIL----........----..------------
ENSBTAP00000026407  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000052557  ............Id..EADR..D...G....DGE....VNEDEFLRIMK---........----..------------
ENSBTAP00000054167  ............Fq..KMDK..N...K....DGV....VTIDEFIESCQKDE........NIMR..SMQL--------
ENSBTAP00000010319  ............Id..EADR..D...G....DGE....VNEQEFLRIMK---........----..------------
ENSBTAP00000041545  ............D...RYEP..S...E....SGKlrhvLSMDGFLG------........----..------------
ENSBTAP00000055204  ............Ir..KFDR..Q...G....RGQ....IAFDDFIQGCIVLQ........RLTD..IFRRYDTDQDGW
ENSBTAP00000003718  ............Fq..KMDK..N...K....DGI....VTLDEFLESCQEDD........NIMR..SLQL--------
ENSBTAP00000011676  ............A...MRYA..C...S....KLT....MDFDSFIACMIRLE........TLFK..LFRLLDKDQNGI
ENSBTAP00000049395  ............Ep..SETA..K...A....QRQ....MTKDGFLMYL----........----..------------
ENSBTAP00000054983  ............Fs..KIKG..K...S....CRT....ITFEQFKEAL----........----..------------
ENSBTAP00000052219  ............A...KRYS..-...T....NGK....ITFDDYIACCVKLR........ALTD..SFRRRDTAQQGV
ENSBTAP00000025402  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000011678  ............I...TRYS..E...P....DLA....VDFDNFVCCLVRLE........TMFR..FFKTLDTDLDGV
ENSBTAP00000000433  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000021491  ............Ld..EADH..D...G....DGE....INKEEFLKMMQ---........----..------------
ENSBTAP00000044733  ............V...ARFA..D...D....DLI....IDFDNFVRCLIRLE........TLFR..IFKQLDPENTGM
ENSBTAP00000010937  ............Ir..KFEV..S...E....ENKvknvLGIEGFTNFM----........----..------------
ENSBTAP00000056439  ............Ir..KFEV..S...E....ENKvknvLGIEGFTNFM----........----..------------
ENSBTAP00000055780  ............Mk..DGDK..N...N....DGR....IDYDEFLEFM----........----..------------
ENSBTAP00000038002  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000034705  ............Ih..TYEL..N...E....TAKqhelMTLDGFMMYLL---........----..------------
ENSBTAP00000035936  ............Fl..LVDE..N...G....DGQ....LSLNEFVEGARRDK........WVMK..MLQ---------
ENSBTAP00000013699  ............Vsr.YCPR..S...A....NPA....MQLDRFIQVCTQLQ........VLTE..AFREKDTAVQGS
ENSBTAP00000002564  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000011496  ............Fa..MMDK..N...A....DGK....LTLQEFQEGSKADP........SIVQ..ALSLYD------
ENSBTAP00000019111  ............Ie..EFDK..D...G....DGE....INQEEFIAIM----........----..------------
ENSBTAP00000017036  ............Fs..KIDV..N...G....DGE....LSLEEFMEGVQKDQ........----..------------
ENSBTAP00000003213  ............I...----..-...-....---....--------------........----..------------
ENSBTAP00000055444  ............I...----..-...-....---....--------------........----..------------
ENSBTAP00000024550  ............V...KRYS..-...K....NGR....IFFDDYVACCVKLR........ALTD..FFRRRDHLQQGV
ENSBTAP00000015248  ............Yr..EAPI..D...K....KGN....FNYVEFTRIL----........----..------------
ENSBTAP00000021328  ............Yr..EAPI..D...K....KGN....FNYIEFTRIL----........----..------------
ENSBTAP00000037091  ............Yr..EAPI..D...K....KGN....FNYIEFTRIL----........----..------------
ENSBTAP00000029967  ............Lr..DIDL..N...G....DGL....VDFEEFVRMM----........----..------------
ENSBTAP00000021449  ............Vq..EADI..N...G....DGT....VDFEEFVKMM----........----..------------
ENSBTAP00000053176  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000042361  ............Ir..DVDL..N...G....DGR....VDFEEFVRMM----........----..------------
ENSBTAP00000016509  ............Fl..LVDE..N...G....DGQ....LSLNEFVEGARRDK........WVMK..MLQ---------
ENSBTAP00000026714  ............Ir..DVDL..N...G....DGR....VDFEEFVRMM----........----..------------
ENSBTAP00000004690  ............V...ARYA..N...D....SLI....MEFDSFISCFLRLK........AMFKtaYFLTMDPENTGQ
ENSBTAP00000010858  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000013117  ............Ep..SKEG..Q...E....KGW....LSIDGFTNYLMS--........----..------------
ENSBTAP00000017574  ............Ep..IEEV..K...Q....AHQ....MSFEGFRRYM----........----..------------
ENSBTAP00000004885  ............Lq..SIDA..D...G....TMT....VDWNEWRDYFLFNPvtdieeiiRFWK..HSTGIDIGDSLT
ENSBTAP00000008961  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000028063  ............Ia..AYDS..E...G....RGK....LTV-----------........----..------------
ENSBTAP00000012740  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000006283  ............Lq..EVDL..N...G....DGT....VDFNEFVMMLS---........----..------------
ENSBTAP00000014306  ............V...AGHE..D...S....NGC....INYEELVRMV----........----..------------
ENSBTAP00000053252  ............Ir..RYEL..S...EegrqKGF....LAIDGFTQYLLS--........----..------------
ENSBTAP00000014304  ............V...AGHE..D...S....NGC....INYEAFVRHI----........----..------------
ENSBTAP00000045669  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000041264  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000006711  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000017358  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000053274  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000055296  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000016852  ............Ld..NFDSpyD...K....DGV....VTPEEFMNYYAG--........----..------------
ENSBTAP00000036380  ............Fr..EAGI..E...P....NGK....VKYDEFIQK-----........----..------------
ENSBTAP00000041719  ............L...AGHE..D...S....SGC....INYEAFLKHI----........----..------------
ENSBTAP00000049636  ............M...AGQE..D...S....NGC....INYEAFVKHI----........----..------------
ENSBTAP00000024444  ............Fa..AFPP..D...V....TGN....LDYKNLVHIIT---........----..------------
ENSBTAP00000004556  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000038767  ........adrtIq..EADQ..D...G....DSA....ISFTEFVKVLE---........----..------------
ENSBTAP00000031285  ............Fn..SCDT..Y...K....DGR....VSTAEWCFCF----........----..------------
ENSBTAP00000011457  ............Lk..KMDH..D...H....DGK....LSFADYEQAVRE--........----..------------
ENSBTAP00000011047  ............M...AGQE..D...S....NGC....INYEAFVKHI----........----..------------
ENSBTAP00000002564  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000037104  ............Fa..AFPP..D...V....CGN....LDYRNLCYVIT---........----..------------
ENSBTAP00000002672  ............Fa..LTPM..D...L....AGN....IDYKSLCYIIT---........----..------------
ENSBTAP00000028269  ............Wa..AFPP..D...V....GGN....VDYKNICYVIT---........----..------------
ENSBTAP00000016647  ........adrtVq..EADE..D...G....DGA....VSFLEFAKSL----........----..------------
ENSBTAP00000004536  ............Lh..SMDR..D...G....TMT....IDWQEWRDHFLLH-........----..------------
ENSBTAP00000042177  ............Ve..YCDV..N...N....DKS....ISLQELMGCL----........----..------------
ENSBTAP00000028063  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000050283  ............L...AGQE..D...A....NGC....INYEAFVKHI----........----..------------
ENSBTAP00000048539  ............Fr..EIAG..P...N....SDR....ISYRTFKKFALKHP........AYAK..LFSSY-------
ENSBTAP00000045669  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000007972  ............Ld..NFDSs.E...K....DGQ....VTLAEFQDYYSGV-........----..------------
ENSBTAP00000040815  ............Ftd.YCDL..N...K....DKV....ISLPELKGCL----........----..------------
ENSBTAP00000025661  ............Fk..EIAQ..-...-....GDS....VSYEEFKSFALKHP........EYAK..IFTTY-------
ENSBTAP00000028350  ............Le..ESDI..D...R....DGT....INLSEFQHVISRSP........DFAS..SFK---------
ENSBTAP00000053274  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000021537  ............Ld..EADG..D...H....DGR....LSLEDFQNMILRAP........DFLS..TFH---------
ENSBTAP00000055481  ............Wn..LSDI..D...Q....DGK....LTAEEFILAMHLID........----..------------
ENSBTAP00000039155  ............Ir..AAHM..D...A....DGQ....VNCEEFMHLL----........----..------------
ENSBTAP00000029333  ............Wn..LSDI..D...Q....DGK....LTAEEFILAMHLID........----..------------
ENSBTAP00000016315  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000021091  ............L...IRYG..G...P....DLQ....MNFVRFVRLMLRVE........NMED..VFQNLTQDGKGI
ENSBTAP00000021618  ............Fr..ESGF..Q...D....KQE....LTWEDFHFMLRDHD........----..------------
ENSBTAP00000055520  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000055624  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000016319  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000034078  ............Ls..AAID..P...E....SNS....IHYKDYITMM----........----..------------
ENSBTAP00000006645  ............Ln..ESDL..D...N....DNM....LSFSEFEHAMAKSP........DFMN..SFRIH-------
ENSBTAP00000021909  ............Vy..ESDQ..N...K....DGK....LTKEEIVD------........----..------------
ENSBTAP00000001426  ............Lr..MFDL..N...G....DGK....LGLSEMSRL-----........----..------------
ENSBTAP00000015802  ............Lk..SMDK..N...G....TMT....IDWNEWRDYHLLHP........----..------------
ENSBTAP00000032680  ............Lk..SMDK..N...G....TMT....IDWNEWRDYHLLHP........----..------------
ENSBTAP00000055007  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000020148  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000052345  ............Wa..LCDT..K...N....CGK....LSKDQFALAFH---........----..------------
ENSBTAP00000029334  ............Wt..LADI..D...G....DGQ....LKAEEFILAMHLT-........----..------------
ENSBTAP00000052345  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000056127  ............Vy..ESDK..N...K....DEK....LTKEEILD------........----..------------
ENSBTAP00000012557  ............Ae..RMDL..N...K....DGS....IDFNEFLKAF----........----..------------
ENSBTAP00000011888  ............Fe..SADK..D...C....SGT....ITFEELRDELQRF-........----..------------
ENSBTAP00000017060  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000031854  ............Ld..LVKP..A...S....DGK....ITLRDLKRCRM---........----..------------
ENSBTAP00000031823  ............Lh..ESDT..D...K....DGR....LSKAEI--------........----..------------
ENSBTAP00000021603  ............Fr..ESGF..Q...D....KQE....LTWEDFHFMLRDH-........----..------------
ENSBTAP00000010838  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000014575  ............Ie..EADL..D...G....DGK....LGFADFEDMIAKAP........DF--..------------
ENSBTAP00000011215  ............Ld..LVKP..A...S....DGK....ITLRDLKRCRM---........----..------------
ENSBTAP00000053698  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000006806  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000029334  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000044105  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000026904  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000017060  ............Wa..LADT..R...Q....TGK....LSKDQFALAMYFI-........----..------------
ENSBTAP00000055520  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000044226  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000055624  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000042182  ............T...SRYR..D...S....RLR....VDFERFVSCMAQLI........CVFR..YCSQHLDGGEGV
ENSBTAP00000010796  ............Le..YYDK..T...L....SSK....ISYNDFLRAF----........----..------------
ENSBTAP00000021174  ............Lk..LFDS..N...N....DGK....LELTEMARLL----........----..------------
ENSBTAP00000006275  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000020950  ............Id..EMDL..N...S....DRK....LSEEEIL-------........----..------------
ENSBTAP00000053738  ............Le..YYDK..T...L....SSK....ISYNDFLRAF----........----..------------
ENSBTAP00000004963  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000023774  ............I...----..-...-....---....--------------........----..------------
ENSBTAP00000020395  ............V...----..-...-....---....--------------........----..------------
ENSBTAP00000020150  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000025561  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000053738  ............Wm..RYDS..E...G....RGH....ITYQEFLQ------........----..------------
ENSBTAP00000034009  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000020539  ............Ar..SIDF..N...K....DGH....IDINEFLEAF----........----..------------
ENSBTAP00000020778  ............Ia..IADE..N...Q....NHY....LEPEEVLK------........----..------------
ENSBTAP00000017461  ............F...----..-...-....---....--------------........----..------------
ENSBTAP00000044096  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000008523  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000035196  ............-...TVGT..N...E....KGW....ITYQGFLSQ-----........----..------------
ENSBTAP00000041997  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000025499  ............La..AGDK..D...G....DGK....IGADEFSTL-----........----..------------
ENSBTAP00000055481  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000002174  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000000589  ............Mg..DLDE..N...S....DQQ....VDFQEYAVFLALIT........----..------------
ENSBTAP00000028239  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000014894  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000026544  ............Lr..HCDV..N...K....DGK....IQKSELALCL----........----..------------
ENSBTAP00000029333  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000041966  ............K...LRYS..D...S....TGR....VSFPSLVCLLMRLE........AMAK..AFQNLSKDGKGL
ENSBTAP00000008933  ............Wk..LADC..D...G....DGM....LDEEEFALA-----........----..------------
ENSBTAP00000056088  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000033794  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000012786  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000030018  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000040233  ............Aq..HYNI..D...K....DAA....VDYNVFLKN-----........----..------------
ENSBTAP00000003365  ............In..LADV..N...A....DGK....FDYIKFCKLYM---........----..------------
ENSBTAP00000053176  ............Me..EIDY..D...H....DGT....VSLEEWIQ------........----..------------
ENSBTAP00000024301  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000022292  ............Rl..HFGH..N...R....KKH....LNYTEFTQFL----........----..------------
ENSBTAP00000015611  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000012770  ............Fd..MVKP..K...D....PLK....ISLQD---------........----..------------
ENSBTAP00000000847  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000053738  ............Aq..HYNI..D...K....DAA....VDYNVFLKN-----........----..------------
ENSBTAP00000054975  ............Ma..AADN..D...G....DGK....IGADEFQEMV----........----..------------
ENSBTAP00000046639  ............Fl..ETLK..DacsK....SDE....VSYGEFEDY-----........----..------------
ENSBTAP00000052345  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000053164  ............Fe..YCDV..D...K....DGL....INYLEFANFLTW--........----..------------
ENSBTAP00000016774  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000022630  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000010796  ............We..EMPV..N...S....KGR....LRYLDFLS------........----..------------
ENSBTAP00000021909  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000033974  ............Mk..EADE..N...G....DGT....LNYE----------........----..------------
ENSBTAP00000006711  ............Lq..GMDY..D...R....DGF....VSLEEWVHG-----........----..------------
ENSBTAP00000010796  ............L...NRTS..W...GiawhNNS....INYLDFLRAV----........----..------------
ENSBTAP00000004912  ............Vql.HFGK..E...R....KRH....LTYAEFTQFL----........----..------------
ENSBTAP00000005979  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000053738  ............We..EMPV..N...S....KGR....LRYLDFLS------........----..------------
ENSBTAP00000053746  adgammeaasvcVg..QMEP..D...Qv...YEG....ITFDDFLKIWQGID........IET-..------------
ENSBTAP00000023221  ............Mn..EVDT..N...K....DRL....VTLDEFLKA-----........----..------------
ENSBTAP00000019429  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000052019  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000042244  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000053738  ............Cs..KFQD..I...A....SGR....ILYKKLLACL----........----..------------
ENSBTAP00000018877  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000053019  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000003073  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000012886  ............Ln..EVDL..N...K....NGQ....VELNEFLQLM----........----..------------
ENSBTAP00000044222  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000028499  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000047378  ............Fn..KLDQ..D...G....DGR....VSLEELQL------........----..------------
ENSBTAP00000009308  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000017060  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000050406  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000031879  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000031854  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000001250  ............Fr..AIDQ..E...R....KGR....IAFADFKRFAEANP........----..------------
ENSBTAP00000026035  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000011215  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000002128  ............T...----..-...-....---....--------------........----..------------
ENSBTAP00000053194  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000056127  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000033188  ............Ad..IFDR..D...G....DGY....IDYYEFVAAL----........----..------------
ENSBTAP00000053548  ............Ad..IFDR..D...G....DGY....IDYYEFVAAL----........----..------------
ENSBTAP00000011687  ............Yy..NFDI..T...G....DRKl...LNYKEFK-------........----..------------
ENSBTAP00000007636  ............Fa..LFDC..D...G....NGE....LSNKEFVSIM----........----..------------
ENSBTAP00000020950  ............Fe..KANQ..D...S....GPG....LNLEEFIA------........----..------------
ENSBTAP00000009115  ............Lr..CADI..D...Q....DGK....VNFSDFLKVL----........----..------------
ENSBTAP00000023873  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000054471  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000039694  ............Fk..IFDV..D...K....DDQ....LSYKEFIGIM----........----..------------
ENSBTAP00000025205  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000047882  ........idgvLr..DDDK..N...N....DGY....IDYAEFAK------........----..------------
ENSBTAP00000001368  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000029786  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000028993  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000023678  ............I...RMCS..H...G....EDK....IDYYNFVRAF----........----..------------
ENSBTAP00000034710  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000031823  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000038002  ............Mk..EIDY..D...G....SGS....VSLAEWLR------........----..------------
ENSBTAP00000021074  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000026544  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000007217  ............YsaiKADP..D...G....DGV....LSLQEFSNMD--LR........DFHK..YMRSHRAESSQL
ENSBTAP00000029792  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000044088  ............Fk..IFDL..D...G....DEC....LSHEEFLGVL----........----..------------
ENSBTAP00000017319  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000044100  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000033594  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000026766  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000055894  ............Is..EVTG..G...V....SDT....ISYRDFVNMM----........----..------------
ENSBTAP00000015220  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000033613  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000056320  ............Ld..LVKP..Q...T....EGR....ITLQDLKRCK----........----..------------
ENSBTAP00000025249  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000029159  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000044088  ............Fk..IFDL..D...G....DEC....LSHEEFLGVL----........----..------------
ENSBTAP00000016319  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000017662  ............Lr..SADI..D...G....DGH....VNFKDFLTVMT---........----..------------
ENSBTAP00000012479  ............Ln..HQDL..G...Y....QNE....IKWENFVEWL----........----..------------
ENSBTAP00000029886  ............Ie..LSDE..N...A....DWK....LSFQEFLKCL----........----..------------
ENSBTAP00000027388  ............Im..EVSS..G...P....GET....FSYSDFLKMM----........----..------------
ENSBTAP00000039694  ............Vh..FFGK..K...G....KAE....LNFEDFYRFM----........----..------------
ENSBTAP00000023673  ............Fe..SLDQ..A...H....TGF....LTAREFCL------........----..------------
ENSBTAP00000041488  ............Fe..SLDQ..A...H....TGF....LTAREFCL------........----..------------
ENSBTAP00000001452  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000028498  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000001426  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000020240  ............Ls..CAET..D...E....NET....LDYEEFVKR-----........----..------------
ENSBTAP00000053650  ............Ls..CAET..D...E....NET....LDYEEFVKR-----........----..------------
ENSBTAP00000041651  ............Le..TQDL..N...G....DGL....MTPAELVN------........----..------------
ENSBTAP00000005154  ............Cd..Y---..-...-....---....--------------........----..------------
ENSBTAP00000021174  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000022068  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000026682  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000007636  ............Fa..LFDC..D...G....NGE....LSNKEFVSIM----........----..------------
ENSBTAP00000027954  ............La..LADS..H...A....NGQ....ICYQDFVNLM----........----..------------
ENSBTAP00000020778  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000013601  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000005477  ............F...----..-...-....---....--------------........----..------------
ENSBTAP00000055305  ............Ls..CAEA..D...E....NDM....FNYIDFVD------........----..------------
ENSBTAP00000036054  ............Ls..CAEA..D...E....NDM....FNYIDFVD------........----..------------
ENSBTAP00000004912  ............Fq..LAD-..-...-....---....--------------........----..------------
ENSBTAP00000022292  ............Vs..AAGG..S...I....SHQ....VSFSYFNAFNSLLN........----..------------
ENSBTAP00000002717  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000036015  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000051638  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000026766  ............-...--CF..S...E....GEK....VNYEKFRNWLLLNK........DAFT..FSRW--------
ENSBTAP00000053738  ............L...NRTS..W...GiawhNNS....INYLDFLRAV----........----..------------
ENSBTAP00000016306  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000013714  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000036550  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000053738  ............Tt..KLGY..K...K....EG-....--------------........----..------------
ENSBTAP00000023383  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000027030  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000053270  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000054640  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000012770  ............Ff..FLDP..L...R....TGK....IKIQDIL-------........----..------------
ENSBTAP00000009967  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000015183  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000014222  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000026288  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000002128  ............Ik..YADI..N...S....NQM....VDIGD---------........----..------------
ENSBTAP00000003365  ............Re..NFDT..-...K....KNE....LTRQGFM-------........----..------------
ENSBTAP00000053738  ............Mk..RFGL..K...T....TTK....VNWKQFL-------........----..------------
ENSBTAP00000009228  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000026785  ............As..ALDD..N...K....DGK....VDIDDLVKVI----........----..------------
ENSBTAP00000002578  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000000106  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000028840  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000053594  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000055414  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000026698  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000017015  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000049908  ............L...----..-...-....---....--------------........----..------------
ENSBTAP00000021395  ............-...----..-...-....---....--------------........----..------------
ENSBTAP00000007194  ............V...----..-...-....---....--------------........----..------------
ENSBTAP00000025455  ............-...----..-...-....---....--------------........----..------------


                         180                                                                        
                           |                                                                        
d1qxpa2               IQLDLISWLSF---svl.............................................................
ENSBTAP00000019411  --------------................................................................
ENSBTAP00000036057  --------------................................................................
ENSBTAP00000038404  --------------g...............................................................
ENSBTAP00000010971  --------------g...............................................................
ENSBTAP00000019803  IQVNIQEWLQLTM-................................................................
ENSBTAP00000014038  --------------v...............................................................
ENSBTAP00000002055  --------------t...............................................................
ENSBTAP00000049731  --------------t...............................................................
ENSBTAP00000005577  --------------ivrllqc.........................................................
ENSBTAP00000034949  --------------g...............................................................
ENSBTAP00000017447  --------------enapvfldrlely...................................................
ENSBTAP00000010858  --------------giislck.........................................................
ENSBTAP00000046644  --------------geengvvspekldl..................................................
ENSBTAP00000022814  --------------sdpsivlllq......................................................
ENSBTAP00000019758  --------------gikekdidkdl.....................................................
ENSBTAP00000019321  --------------sdpsivlllqc.....................................................
ENSBTAP00000011677  IKLNVLEWLQLTMY................................................................
ENSBTAP00000011680  IKLNVLEWLQLTM-................................................................
ENSBTAP00000021742  --------------n...............................................................
ENSBTAP00000005348  --------------keedidenll......................................................
ENSBTAP00000016609  --------------nqkqrdprlnevlypplrpsqarlliekyepnkqflerdqmsmegfsrylggeengilpleald
ENSBTAP00000012740  --------------skg.............................................................
ENSBTAP00000018403  --------------tq..............................................................
ENSBTAP00000026407  --------------kgkskeeafdaicqlvagkepanvgvtkaktggaverltdtskytgshker.............
ENSBTAP00000052557  --------------k...............................................................
ENSBTAP00000054167  --------------f...............................................................
ENSBTAP00000010319  --------------kt..............................................................
ENSBTAP00000041545  --------------ylcskdgdifnptchply..............................................
ENSBTAP00000055204  IQVSYEQYLSM---v...............................................................
ENSBTAP00000003718  --------------fq..............................................................
ENSBTAP00000011676  VQLSLAEWLCC---v...............................................................
ENSBTAP00000049395  --------------lsadgsafdlahrrvy................................................
ENSBTAP00000054983  --------------eelakkrfkdksaeeavrevhkliegkapiisgvtkaissptvsrltdtskftgshker.....
ENSBTAP00000052219  VNFPYDDFIQCVM-s...............................................................
ENSBTAP00000025402  --------------kqrdsrlnsllfpparpdqvqglidkyepsginvqrgqlspegmvwflcgpensvlaqdkl...
ENSBTAP00000011678  VTFDLFKWLQLTM-................................................................
ENSBTAP00000000433  --------------lmegkdpattgvtkattvggvsrltdtskytgthker...........................
ENSBTAP00000021491  --------------kt..............................................................
ENSBTAP00000044733  IQLDLISWLS----f...............................................................
ENSBTAP00000010937  --------------rspacdifnplhhevy................................................
ENSBTAP00000056439  --------------rspacdifnplhhevy................................................
ENSBTAP00000055780  --------------kg..............................................................
ENSBTAP00000038002  --------------fqtgyyiedtvredvvclsdvscyfslleggrpedkleft........................
ENSBTAP00000034705  --------------spegaaldlahtrvf.................................................
ENSBTAP00000035936  --------------mdln............................................................
ENSBTAP00000013699  VRLSFEDFVTM---t...............................................................
ENSBTAP00000002564  --------------ergilvnvplcvdmslnwllnvfdrpsgrsgkmralsfktgiaclcg.................
ENSBTAP00000011496  --------------g...............................................................
ENSBTAP00000019111  --------------t...............................................................
ENSBTAP00000017036  --------------mlldtlt.........................................................
ENSBTAP00000003213  --------------eqfepcpenkskgamgidgftnytrspagdifnpehrlv.........................
ENSBTAP00000055444  --------------eqfepcpenkskgamgidgftnytrspagdifnpehrlv.........................
ENSBTAP00000024550  VSFVYDDFLQGTM-................................................................
ENSBTAP00000015248  --------------kh..............................................................
ENSBTAP00000021328  --------------kh..............................................................
ENSBTAP00000037091  --------------kh..............................................................
ENSBTAP00000029967  --------------................................................................
ENSBTAP00000021449  --------------s...............................................................
ENSBTAP00000053176  --------------pddftthlfmsfsnkfphsspmvkskpallssglkmnkgaitpprtspantcspevihlkdivc
ENSBTAP00000042361  --------------................................................................
ENSBTAP00000016509  --------------mdln............................................................
ENSBTAP00000026714  --------------................................................................
ENSBTAP00000004690  ISLDLNQWLQITM-................................................................
ENSBTAP00000010858  --------------iprqlgevasfggsniepsvrscfqfannkpeieaalfldwmrlepqsmvwlpvlhrvaaaet.
ENSBTAP00000013117  --------------pdcyifdpehkkvc..................................................
ENSBTAP00000017574  --------------dssecllfdnkcdhvy................................................
ENSBTAP00000004885  IPDEFTE-------................................................................
ENSBTAP00000008961  --------------qpwssllrnwnslav.................................................
ENSBTAP00000028063  --------------fsvkamlatmcgg...................................................
ENSBTAP00000012740  --------------lepqsmvwlpvlhrvaaaet............................................
ENSBTAP00000006283  --------------r...............................................................
ENSBTAP00000014306  --------------l...............................................................
ENSBTAP00000053252  --------------secnifdpeqskv...................................................
ENSBTAP00000014304  --------------l...............................................................
ENSBTAP00000045669  --------------cgg.............................................................
ENSBTAP00000041264  --------------pwptllknwqllav..................................................
ENSBTAP00000006711  --------------kaylevdlpqplsthlflafsqkprqktpehpkegasnseasgadsdiqnadnaakadeacapd
ENSBTAP00000017358  --------------lfqpwgsilrnwnflav...............................................
ENSBTAP00000053274  --------------cgg.............................................................
ENSBTAP00000055296  --------------lfqpwgsilrnwnflav...............................................
ENSBTAP00000016852  --------------vsasidtdvyfivmmrtaw.............................................
ENSBTAP00000036380  --------------l...............................................................
ENSBTAP00000041719  --------------l...............................................................
ENSBTAP00000049636  --------------m...............................................................
ENSBTAP00000024444  --------------hg..............................................................
ENSBTAP00000004556  --------------pgglpcqne.......................................................
ENSBTAP00000038767  --------------kvdveq..........................................................
ENSBTAP00000031285  --------------wrekppclae......................................................
ENSBTAP00000011457  --------------etllleafgpclpdpks...............................................
ENSBTAP00000011047  --------------m...............................................................
ENSBTAP00000002564  --------------lgevaafggsnvepsvrscfrfstgkpvieasqflewvnlepqsmvwlavlhrvtiae......
ENSBTAP00000037104  --------------hg..............................................................
ENSBTAP00000002672  --------------hg..............................................................
ENSBTAP00000028269  --------------hg..............................................................
ENSBTAP00000016647  --------------ekmnieqkm.......................................................
ENSBTAP00000004536  --------------slenvedvlyfwkhs.................................................
ENSBTAP00000042177  --------------gatreevkad......................................................
ENSBTAP00000028063  --------------vfegpsfgytehsvrtcfpqqkkimlnmfldtmmadpppqclvwlplmhrlahven........
ENSBTAP00000050283  --------------m...............................................................
ENSBTAP00000048539  --------------ldl.............................................................
ENSBTAP00000045669  --------------tavfegpsfgyteqsarscfsqqkkvtlngfldtlmsdpppqclvwlpllhrlanven......
ENSBTAP00000007972  --------------sasmdtdeefvammtsa...............................................
ENSBTAP00000040815  --------------gvskeg..........................................................
ENSBTAP00000025661  --------------ldlqt...........................................................
ENSBTAP00000028350  --------------i...............................................................
ENSBTAP00000053274  --------------tavfegpsfgyteqsarscfsqqkkvtlngfldtlmsdpppqclvwlpllhrlanven......
ENSBTAP00000021537  --------------i...............................................................
ENSBTAP00000055481  --------------vamsgqplppvlppeyippsfr..........................................
ENSBTAP00000039155  --------------v...............................................................
ENSBTAP00000029333  --------------vamsgqplppvlppeyippsfr..........................................
ENSBTAP00000016315  --------------hlivarkngyplpeglpptlqpey........................................
ENSBTAP00000021091  Y-------------................................................................
ENSBTAP00000021618  --------------selrftqlcv......................................................
ENSBTAP00000055520  --------------lapaaaalitlsg...................................................
ENSBTAP00000055624  --------------lapaaaalitlsg...................................................
ENSBTAP00000016319  --------------rkngydlpeklpeslmpkl.............................................
ENSBTAP00000034078  --------------................................................................
ENSBTAP00000006645  --------------fw..............................................................
ENSBTAP00000021909  --------------kydlfvgsqatdfgeal...............................................
ENSBTAP00000001426  --------------l...............................................................
ENSBTAP00000015802  --------------venipeiilywkhs..................................................
ENSBTAP00000032680  --------------venipeiilywkhs..................................................
ENSBTAP00000055007  --------------................................................................
ENSBTAP00000020148  --------------chesfiksa.......................................................
ENSBTAP00000052345  --------------linqklikgidpphiltpemipp.........................................
ENSBTAP00000029334  --------------dmakagqplplalppelvppsfr.........................................
ENSBTAP00000052345  --------------flvycalekepvpmslppalvppskr......................................
ENSBTAP00000056127  --------------nwnmfvgsqatnygedl...............................................
ENSBTAP00000012557  --------------yv..............................................................
ENSBTAP00000011888  --------------pgvlenl.........................................................
ENSBTAP00000017060  --------------hlvyralekepvpsvlppslippskr......................................
ENSBTAP00000031854  --------------ah..............................................................
ENSBTAP00000031823  --------------lgnwnmfvgsqatnygedl.............................................
ENSBTAP00000021603  --------------dselrrtqlc......................................................
ENSBTAP00000010838  --------------adiatdyhnhshgaqlc...............................................
ENSBTAP00000014575  --------------lr..............................................................
ENSBTAP00000011215  --------------ah..............................................................
ENSBTAP00000053698  --------------i...............................................................
ENSBTAP00000006806  --------------aaltvacnnffw....................................................
ENSBTAP00000029334  --------------klklqgqqlpvvlppimkqpp...........................................
ENSBTAP00000044105  --------------adiatdyhnhshgaqlc...............................................
ENSBTAP00000026904  --------------aaltvacndyfveql.................................................
ENSBTAP00000017060  --------------qqkvskgidppqvlspdmvppser........................................
ENSBTAP00000055520  --------------lltdlqqiptvvgesralcsvesatrscfqgvlspvikeekflswlqseppillwiptcyrlsa
ENSBTAP00000044226  --------------aaltvacnnffw....................................................
ENSBTAP00000055624  --------------lltdlqqiptvvgesralcsvesatrscfqgvlspvikeekflswlqseppillwiptcyrlsa
ENSBTAP00000042182  VCLTHRQWM-----q...............................................................
ENSBTAP00000010796  --------------................................................................
ENSBTAP00000021174  --------------p...............................................................
ENSBTAP00000006275  --------------ittacheff.......................................................
ENSBTAP00000020950  --------------enqdlfltseatdygrqlhd............................................
ENSBTAP00000053738  --------------................................................................
ENSBTAP00000004963  --------------slhqqsp.........................................................
ENSBTAP00000023774  --------------m...............................................................
ENSBTAP00000020395  --------------shmkpyvdgkgrelptafdyvef.........................................
ENSBTAP00000020150  --------------agltiacndyfvv...................................................
ENSBTAP00000025561  --------------effeg...........................................................
ENSBTAP00000053738  --------------k...............................................................
ENSBTAP00000034009  --------------rvlktahidihk....................................................
ENSBTAP00000020539  --------------rl..............................................................
ENSBTAP00000020778  --------------ysefftgsklvdyar.................................................
ENSBTAP00000017461  --------------sd..............................................................
ENSBTAP00000044096  --------------sheemhntap......................................................
ENSBTAP00000008523  --------------sheemhntap......................................................
ENSBTAP00000035196  --------------wtl.............................................................
ENSBTAP00000041997  --------------nhlikvkleghelpnelpahlvppskr.....................................
ENSBTAP00000025499  --------------v...............................................................
ENSBTAP00000055481  --------------lklqgyqlpsalppvmkqq.............................................
ENSBTAP00000002174  --------------nhlikvkleghelpadlpphlvppskr.....................................
ENSBTAP00000000589  --------------imcndffq........................................................
ENSBTAP00000028239  --------------hlieakleghglptnlprrlvppskr......................................
ENSBTAP00000014894  --------------ppdqaeyciarm....................................................
ENSBTAP00000026544  --------------................................................................
ENSBTAP00000029333  --------------lklqgyqlpsalppvmkqq.............................................
ENSBTAP00000041966  YLT-EM--------ewmnlvm.........................................................
ENSBTAP00000008933  --------------khlikiklsgyelpsslpphlvppshr.....................................
ENSBTAP00000056088  --------------srvlktah........................................................
ENSBTAP00000033794  --------------yhlqyhrqlcahyc..................................................
ENSBTAP00000012786  --------------ppdqaqycikrmp...................................................
ENSBTAP00000030018  --------------paeqaeycirrm....................................................
ENSBTAP00000040233  --------------l...............................................................
ENSBTAP00000003365  --------------a...............................................................
ENSBTAP00000053176  --------------g...............................................................
ENSBTAP00000024301  --------------lppdqa..........................................................
ENSBTAP00000022292  --------------qe..............................................................
ENSBTAP00000015611  --------------fklamacnkv......................................................
ENSBTAP00000012770  --------------lin.............................................................
ENSBTAP00000000847  --------------mayndffle.......................................................
ENSBTAP00000053738  --------------l...............................................................
ENSBTAP00000054975  --------------................................................................
ENSBTAP00000046639  --------------y...............................................................
ENSBTAP00000052345  --------------rlvacaqnglevslsslnlavppprfhd....................................
ENSBTAP00000053164  --------------kdktplkeyeekvlikgrkadcanpaeanveesepalllkpedivlkepgssektlrtllrpsd
ENSBTAP00000016774  --------------ikvgleaheeihk...................................................
ENSBTAP00000022630  --------------kk..............................................................
ENSBTAP00000010796  --------------sf..............................................................
ENSBTAP00000021909  --------------................................................................
ENSBTAP00000033974  --------------a...............................................................
ENSBTAP00000006711  --------------gmttipllvllgmddsg...............................................
ENSBTAP00000010796  --------------e...............................................................
ENSBTAP00000004912  --------------le..............................................................
ENSBTAP00000005979  --------------phlpstvrtkagrlplhgylcqwtl.......................................
ENSBTAP00000053738  --------------sf..............................................................
ENSBTAP00000053746  --------------kmhvrf..........................................................
ENSBTAP00000023221  --------------t...............................................................
ENSBTAP00000019429  --------------hkaa............................................................
ENSBTAP00000052019  --------------fqlaqacyh.......................................................
ENSBTAP00000042244  --------------rkaaagelqe......................................................
ENSBTAP00000053738  --------------gi..............................................................
ENSBTAP00000018877  --------------ggitspianli.....................................................
ENSBTAP00000053019  --------------................................................................
ENSBTAP00000003073  --------------st..............................................................
ENSBTAP00000012886  --------------saiqk...........................................................
ENSBTAP00000044222  --------------lciycheyfk......................................................
ENSBTAP00000028499  --------------gelakeirk.......................................................
ENSBTAP00000047378  --------------glf.............................................................
ENSBTAP00000009308  --------------k...............................................................
ENSBTAP00000017060  --------------rlvacaqsghevtlsnlnlnmpppkfhd....................................
ENSBTAP00000050406  --------------inrkegicalggtselssegtqhsyseeekyafvnwinkalendpd..................
ENSBTAP00000031879  --------------inrkegicalggtselssegtqhsyseeekyafvnwinkalendpd..................
ENSBTAP00000031854  --------------k...............................................................
ENSBTAP00000001250  --------------dfaeeylyp.......................................................
ENSBTAP00000026035  --------------fkvaqacfet......................................................
ENSBTAP00000011215  --------------k...............................................................
ENSBTAP00000002128  --------------eltev...........................................................
ENSBTAP00000053194  --------------peq.............................................................
ENSBTAP00000056127  --------------h...............................................................
ENSBTAP00000033188  --------------hpnkd...........................................................
ENSBTAP00000053548  --------------hpnkd...........................................................
ENSBTAP00000011687  --------------lf..............................................................
ENSBTAP00000007636  --------------k...............................................................
ENSBTAP00000020950  --------------f...............................................................
ENSBTAP00000009115  --------------td..............................................................
ENSBTAP00000023873  --------------................................................................
ENSBTAP00000054471  --------------shfffsqnn.......................................................
ENSBTAP00000039694  --------------k...............................................................
ENSBTAP00000025205  --------------shfffsqnn.......................................................
ENSBTAP00000047882  --------------s...............................................................
ENSBTAP00000001368  --------------lrss............................................................
ENSBTAP00000029786  --------------h...............................................................
ENSBTAP00000028993  --------------gf..............................................................
ENSBTAP00000023678  --------------s...............................................................
ENSBTAP00000034710  --------------rlaqclgkvrnswaydpqglqtlflemlfklmsl..............................
ENSBTAP00000031823  --------------h...............................................................
ENSBTAP00000038002  --------------a...............................................................
ENSBTAP00000021074  --------------fsflnvcyldtqsl..................................................
ENSBTAP00000026544  --------------flh.............................................................
ENSBTAP00000007217  VRNSHH--------twly............................................................
ENSBTAP00000029792  --------------h...............................................................
ENSBTAP00000044088  --------------k...............................................................
ENSBTAP00000017319  --------------lsvtim..........................................................
ENSBTAP00000044100  --------------ksqlhckmgpgfvhnf................................................
ENSBTAP00000033594  --------------t...............................................................
ENSBTAP00000026766  --------------saccrgplaerqkycfllvqvnk.........................................
ENSBTAP00000055894  --------------l...............................................................
ENSBTAP00000015220  --------------................................................................
ENSBTAP00000033613  --------------................................................................
ENSBTAP00000056320  --------------lanvffdtffn.....................................................
ENSBTAP00000025249  --------------gilqlndflvncqgehytydeilsiiqkfepsvsmchqglmsfegfarflmdkdnfa.......
ENSBTAP00000029159  --------------ra..............................................................
ENSBTAP00000044088  --------------kn..............................................................
ENSBTAP00000016319  --------------vaqsgfplrvesintvkdlp............................................
ENSBTAP00000017662  --------------dtrrf...........................................................
ENSBTAP00000012479  --------------................................................................
ENSBTAP00000029886  --------------................................................................
ENSBTAP00000027388  --------------l...............................................................
ENSBTAP00000039694  --------------dn..............................................................
ENSBTAP00000023673  --------------gl..............................................................
ENSBTAP00000041488  --------------gl..............................................................
ENSBTAP00000001452  --------------vy..............................................................
ENSBTAP00000028498  --------------ige.............................................................
ENSBTAP00000001426  --------------ly..............................................................
ENSBTAP00000020240  --------------f...............................................................
ENSBTAP00000053650  --------------f...............................................................
ENSBTAP00000041651  --------------f...............................................................
ENSBTAP00000005154  --------------fsehlg..........................................................
ENSBTAP00000021174  --------------qdldinniptykksi.................................................
ENSBTAP00000022068  --------------eairngdpds......................................................
ENSBTAP00000026682  --------------hqqm............................................................
ENSBTAP00000007636  --------------k...............................................................
ENSBTAP00000027954  --------------................................................................
ENSBTAP00000020778  --------------v...............................................................
ENSBTAP00000013601  --------------amiaatqrgv......................................................
ENSBTAP00000005477  --------------atlfglnpe.......................................................
ENSBTAP00000055305  --------------rf..............................................................
ENSBTAP00000036054  --------------rf..............................................................
ENSBTAP00000004912  --------------l...............................................................
ENSBTAP00000022292  --------------nmelvrkiystlagtrkdvevtkeefa.....................................
ENSBTAP00000002717  --------------dlnkvrermtkfiddtmretaepflfvdefltylfsrensiwdekydvv...............
ENSBTAP00000036015  --------------hfdelcwtltakknyqvdsngnsmlsnqdafrlwclfn..........................
ENSBTAP00000051638  --------------ispaytevqykdpskgdelskeellyfsqlh.................................
ENSBTAP00000026766  --------------lls.............................................................
ENSBTAP00000053738  --------------ennk............................................................
ENSBTAP00000016306  --------------yevvdssvnhs.....................................................
ENSBTAP00000013714  --------------lqe.............................................................
ENSBTAP00000036550  --------------rlh.............................................................
ENSBTAP00000053738  --------------msyldfa.........................................................
ENSBTAP00000023383  --------------rslmysaqktmdlpfleasalragerpelcrvslpefqqflleyqgelwavdrlqvqefmlsfl
ENSBTAP00000027030  --------------nellv...........................................................
ENSBTAP00000053270  --------------nellv...........................................................
ENSBTAP00000054640  --------------nellv...........................................................
ENSBTAP00000012770  --------------acsfld..........................................................
ENSBTAP00000009967  --------------glwftgd.........................................................
ENSBTAP00000015183  --------------lltlyekd........................................................
ENSBTAP00000014222  --------------etqqkl..........................................................
ENSBTAP00000026288  --------------trylsk..........................................................
ENSBTAP00000002128  --------------iift............................................................
ENSBTAP00000003365  --------------dlnl............................................................
ENSBTAP00000053738  --------------ts..............................................................
ENSBTAP00000009228  --------------rf..............................................................
ENSBTAP00000026785  --------------elvdkedvhistsqvaeiva............................................
ENSBTAP00000002578  --------------nrmcwtlcvkknltknplfiteedafkiwvifnflsedkypliivpeeieyllkklteamgvsw
ENSBTAP00000000106  --------------l...............................................................
ENSBTAP00000028840  --------------lsslgkhnsitmdnlastykqwsla.......................................
ENSBTAP00000053594  --------------qgelshiirql.....................................................
ENSBTAP00000055414  --------------smkk............................................................
ENSBTAP00000026698  --------------rlafelf.........................................................
ENSBTAP00000017015  --------------heslll..........................................................
ENSBTAP00000049908  --------------nkv.............................................................
ENSBTAP00000021395  --------------arnl............................................................
ENSBTAP00000007194  --------------sra.............................................................
ENSBTAP00000025455  --------------smkk............................................................


                                                                                                    
                                                                                                    
d1qxpa2               ..............................................................................
ENSBTAP00000019411  ..............................................................................
ENSBTAP00000036057  ..............................................................................
ENSBTAP00000038404  ..............................................................................
ENSBTAP00000010971  ..............................................................................
ENSBTAP00000019803  ..............................................................................
ENSBTAP00000014038  ..............................................................................
ENSBTAP00000002055  ..............................................................................
ENSBTAP00000049731  ..............................................................................
ENSBTAP00000005577  ..............................................................................
ENSBTAP00000034949  ..............................................................................
ENSBTAP00000017447  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000046644  ..............................................................................
ENSBTAP00000022814  ..............................................................................
ENSBTAP00000019758  ..............................................................................
ENSBTAP00000019321  ..............................................................................
ENSBTAP00000011677  ..............................................................................
ENSBTAP00000011680  ..............................................................................
ENSBTAP00000021742  ..............................................................................
ENSBTAP00000005348  ..............................................................................
ENSBTAP00000016609  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000018403  ..............................................................................
ENSBTAP00000026407  ..............................................................................
ENSBTAP00000052557  ..............................................................................
ENSBTAP00000054167  ..............................................................................
ENSBTAP00000010319  ..............................................................................
ENSBTAP00000041545  ..............................................................................
ENSBTAP00000055204  ..............................................................................
ENSBTAP00000003718  ..............................................................................
ENSBTAP00000011676  ..............................................................................
ENSBTAP00000049395  ..............................................................................
ENSBTAP00000054983  ..............................................................................
ENSBTAP00000052219  ..............................................................................
ENSBTAP00000025402  ..............................................................................
ENSBTAP00000011678  ..............................................................................
ENSBTAP00000000433  ..............................................................................
ENSBTAP00000021491  ..............................................................................
ENSBTAP00000044733  ..............................................................................
ENSBTAP00000010937  ..............................................................................
ENSBTAP00000056439  ..............................................................................
ENSBTAP00000055780  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000034705  ..............................................................................
ENSBTAP00000035936  ..............................................................................
ENSBTAP00000013699  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000011496  ..............................................................................
ENSBTAP00000019111  ..............................................................................
ENSBTAP00000017036  ..............................................................................
ENSBTAP00000003213  ..............................................................................
ENSBTAP00000055444  ..............................................................................
ENSBTAP00000024550  ..............................................................................
ENSBTAP00000015248  ..............................................................................
ENSBTAP00000021328  ..............................................................................
ENSBTAP00000037091  ..............................................................................
ENSBTAP00000029967  ..............................................................................
ENSBTAP00000021449  ..............................................................................
ENSBTAP00000053176  ylsllergrpedklefm.............................................................
ENSBTAP00000042361  ..............................................................................
ENSBTAP00000016509  ..............................................................................
ENSBTAP00000026714  ..............................................................................
ENSBTAP00000004690  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000013117  ..............................................................................
ENSBTAP00000017574  ..............................................................................
ENSBTAP00000004885  ..............................................................................
ENSBTAP00000008961  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000006283  ..............................................................................
ENSBTAP00000014306  ..............................................................................
ENSBTAP00000053252  ..............................................................................
ENSBTAP00000014304  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000041264  ..............................................................................
ENSBTAP00000006711  metkitekqvpaknqaaatpvgnlvapssgsespivylkdvvcylsllesgrpqdklefm..................
ENSBTAP00000017358  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000055296  ..............................................................................
ENSBTAP00000016852  ..............................................................................
ENSBTAP00000036380  ..............................................................................
ENSBTAP00000041719  ..............................................................................
ENSBTAP00000049636  ..............................................................................
ENSBTAP00000024444  ..............................................................................
ENSBTAP00000004556  ..............................................................................
ENSBTAP00000038767  ..............................................................................
ENSBTAP00000031285  ..............................................................................
ENSBTAP00000011457  ..............................................................................
ENSBTAP00000011047  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000037104  ..............................................................................
ENSBTAP00000002672  ..............................................................................
ENSBTAP00000028269  ..............................................................................
ENSBTAP00000016647  ..............................................................................
ENSBTAP00000004536  ..............................................................................
ENSBTAP00000042177  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000050283  ..............................................................................