SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

EF-hand alignments in Bos taurus 76_3.1

These alignments are sequences aligned to the 0045999 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1br1b_               ..............................................................................
ENSBTAP00000019411  madq..........................................................................
ENSBTAP00000036057  madq..........................................................................
ENSBTAP00000038404  lrpevmqdllestd................................................................
ENSBTAP00000010971  lrpemlqdlrente................................................................
ENSBTAP00000019803  ggggggggtamrilggvisaiseaaaqynpepvpprthysnieane................................
ENSBTAP00000014038  lemcsh........................................................................
ENSBTAP00000002055  adq...........................................................................
ENSBTAP00000049731  adq...........................................................................
ENSBTAP00000005577  mgkqnsklrpevlqdlrente.........................................................
ENSBTAP00000034949  lskeileelqlntk................................................................
ENSBTAP00000017447  vspmtclkkhwmklafmt............................................................
ENSBTAP00000010858  hpkmtelyqsladlnnvrfsayrtamklrrlqkalcldllslsaacdaldqhnlkqndqpmdilqiinc.........
ENSBTAP00000046644  srdaflekaytklklqvtpegriplkniyrlfsa............................................
ENSBTAP00000022814  mgkqnsklapevmedlvkste.........................................................
ENSBTAP00000019758  ppcldseltefplrmrdwlknvlvtlyerdednnlltekqklrvkkihenekrleagdhpvellardfeknynmyifp
ENSBTAP00000019321  mgktnsklapevledlvqnte.........................................................
ENSBTAP00000011677  pqlepgntdqe...................................................................
ENSBTAP00000011680  ntdqe.........................................................................
ENSBTAP00000021742  rpegleqlqeqtk.................................................................
ENSBTAP00000005348  pactdfevtqfplrmrdwlknilvqlyepnpehsgylnekqrnkvkkiyldekrllagdhsidlllrdfkknyhmyvy
ENSBTAP00000016609  srntflrkaytklklq..............................................................
ENSBTAP00000012740  hpkmtelfqsladlnnvrfsayrtaikirrlqkalcldllelnt..................................
ENSBTAP00000018403  aek...........................................................................
ENSBTAP00000026407  astdva........................................................................
ENSBTAP00000052557  pe............................................................................
ENSBTAP00000054167  rpealelleaqsk.................................................................
ENSBTAP00000010319  anmasttqrkrmspkpe.............................................................
ENSBTAP00000041545  erld..........................................................................
ENSBTAP00000055204  sf............................................................................
ENSBTAP00000003718  leqleaqtn.....................................................................
ENSBTAP00000011676  qedg..........................................................................
ENSBTAP00000049395  qk............................................................................
ENSBTAP00000054983  lsa...........................................................................
ENSBTAP00000052219  dplygyfaav....................................................................
ENSBTAP00000025402  srstfldkilvklkmq..............................................................
ENSBTAP00000011678  anlpdeqvlse...................................................................
ENSBTAP00000000433  ertfqrfavfgessssgt............................................................
ENSBTAP00000021491  srpssdqwkknaakie..............................................................
ENSBTAP00000044733  sedd..........................................................................
ENSBTAP00000010937  rthd..........................................................................
ENSBTAP00000056439  rthd..........................................................................
ENSBTAP00000055780  aveq..........................................................................
ENSBTAP00000038002  make..........................................................................
ENSBTAP00000034705  erldh.........................................................................
ENSBTAP00000035936  qqfsweeveengavgaada...........................................................
ENSBTAP00000013699  gvppnv........................................................................
ENSBTAP00000002564  hpkmtelyqtlaadlnnikfsayrtamklrrvqkalrld.......................................
ENSBTAP00000011496  ykgfik........................................................................
ENSBTAP00000019111  ..............................................................................
ENSBTAP00000017036  e.............................................................................
ENSBTAP00000003213  rtrd..........................................................................
ENSBTAP00000055444  rtrd..........................................................................
ENSBTAP00000024550  pmw...........................................................................
ENSBTAP00000015248  ..............................................................................
ENSBTAP00000021328  ..............................................................................
ENSBTAP00000037091  ..............................................................................
ENSBTAP00000029967  e.............................................................................
ENSBTAP00000021449  giaekqrerp....................................................................
ENSBTAP00000053176  ekwahlspsefsqlqkyaeystkklkdvleefhgngvlakynpegkqdi.............................
ENSBTAP00000042361  s.............................................................................
ENSBTAP00000016509  qqfsweeveengavgaada...........................................................
ENSBTAP00000026714  ..............................................................................
ENSBTAP00000004690  etdi..........................................................................
ENSBTAP00000010858  hledkyrylfkqvasstgfcdqrrlglllhdsiqiprqlgevas..................................
ENSBTAP00000013117  nmrtsw........................................................................
ENSBTAP00000017574  kwfllmv.......................................................................
ENSBTAP00000004885  ptaacqdveppt..................................................................
ENSBTAP00000008961  tfritkadaaefwrkafge...........................................................
ENSBTAP00000028063  emraqnfdvirlstyrtacklrfvqkrcnlhlvdiwnmieafrdnglntl............................
ENSBTAP00000012740  leekyrylfkevagptemcdqrqlglllhdaiqiprqlgevaafggsniepsvrscfqq...................
ENSBTAP00000006283  re............................................................................
ENSBTAP00000014306  ..............................................................................
ENSBTAP00000053252  tprf..........................................................................
ENSBTAP00000014304  ..............................................................................
ENSBTAP00000045669  qlfaemraqdldrirlstyrtacklrfvqkkcnlhlvdiwnviealrenalnnvdpnmelnvarleavlstifyqlnk
ENSBTAP00000041264  tyqltkvsahtfwrercgarc.........................................................
ENSBTAP00000006711  drwvsltpeefgqlqkyaeysskkikyvlaefneggslkqygph..................................
ENSBTAP00000017358  fritkadaaefwrkff..............................................................
ENSBTAP00000053274  qlfaemraqdldrirlstyrtacklrfvqkkcnlhlvdiwnviealrenalnnvdpnmelnvarleavlstifyqlnk
ENSBTAP00000055296  fritkadaaefwrkff..............................................................
ENSBTAP00000016852  i.............................................................................
ENSBTAP00000036380  ..............................................................................
ENSBTAP00000041719  ..............................................................................
ENSBTAP00000049636  ..............................................................................
ENSBTAP00000024444  ..............................................................................
ENSBTAP00000004556  ctdkelrnlasrlkdwfgalhedanrvinptsseta..........................................
ENSBTAP00000038767  mgsrastllrdeeleeikketg........................................................
ENSBTAP00000031285  tctgqdladlgdrlrdwfqllhenskqngsansgaspasgldkslgasckd...........................
ENSBTAP00000011457  knckhfskfevkclinlfynlvgevterqgviig............................................
ENSBTAP00000011047  ..............................................................................
ENSBTAP00000002564  vkeklqylfsqvansgsqcdqrhlgvllheaiqvprqlgevaafggsnvepsvrscfrfst.................
ENSBTAP00000037104  ..............................................................................
ENSBTAP00000002672  ..............................................................................
ENSBTAP00000028269  ..............................................................................
ENSBTAP00000016647  shaaripdvdslrqetg.............................................................
ENSBTAP00000004536  a.............................................................................
ENSBTAP00000042177  qgcpgakkrefltsvldalstdmvhavsdpsspgrlsepdpshtleer..............................
ENSBTAP00000028063  mldkl.........................................................................
ENSBTAP00000050283  ty............................................................................
ENSBTAP00000048539  eftkisqnlkldwdnihqcldkyaeiava.................................................
ENSBTAP00000045669  kimdklryifsmisdssgvmvygrydqflrevlklptavfegpsfgyteqsarscf......................
ENSBTAP00000007972  i.............................................................................
ENSBTAP00000040815  pgcpegkklefitslldalttdmvqainsaaptgggrfsepdpshtl...............................
ENSBTAP00000025661  eftkisrklkldwdgirkhldeyaaias..................................................
ENSBTAP00000028350  kellaeyqdltfltkqeillahrrfcellpqehrsveeslqarvsleqilslpelkanp...................
ENSBTAP00000053274  kimdklryifsmisdssgvmvygrydqflrevlklptavfegpsfgyteqsarscf......................
ENSBTAP00000021537  mgnkqtvftheqleayqdctfftrkeimrlfyryqdlapqlvpldytscpdvkvpyeligsmpelkd...........
ENSBTAP00000055481  pptaewavpq....................................................................
ENSBTAP00000039155  ..............................................................................
ENSBTAP00000029333  pptaewavpq....................................................................
ENSBTAP00000016315  stsypdepwr....................................................................
ENSBTAP00000021091  efftklfeky....................................................................
ENSBTAP00000021618  lsrae.........................................................................
ENSBTAP00000055520  alnsienstyrtafklrsvqtlcqldligssliqhvlrhqslweages..............................
ENSBTAP00000055624  alnsienstyrtafklrsvqtlcqldligssliqhvlrhqslweages..............................
ENSBTAP00000016319  ddpwk.........................................................................
ENSBTAP00000034078  h.............................................................................
ENSBTAP00000006645  mgqclryqmhwedleeyqaltfltrneilcihdsflklcppgkyykeatltvdqvsslpalrvnpfrdricr......
ENSBTAP00000021909  vrde..........................................................................
ENSBTAP00000001426  qqppylhlaelta.................................................................
ENSBTAP00000015802  elksifklsvfipsqefsty..........................................................
ENSBTAP00000032680  elksifklsvfipsqefsty..........................................................
ENSBTAP00000055007  arsy..........................................................................
ENSBTAP00000020148  pteterci......................................................................
ENSBTAP00000052345  wiv...........................................................................
ENSBTAP00000029334  spktgtsewavpqps...............................................................
ENSBTAP00000052345  isgtsaaelpwavkpedkakydaifdslcpv...............................................
ENSBTAP00000056127  e.............................................................................
ENSBTAP00000012557  kt............................................................................
ENSBTAP00000011888  kwlqwvthqfktiagedgeinlqdfkkalkvkesff..........................................
ENSBTAP00000017060  eahwavrveekakfdgifesllpvng....................................................
ENSBTAP00000031854  eeedinqitdyfs.................................................................
ENSBTAP00000031823  arde..........................................................................
ENSBTAP00000021603  lsrae.........................................................................
ENSBTAP00000010838  sqle..........................................................................
ENSBTAP00000014575  liiqmpelrenpf.................................................................
ENSBTAP00000011215  eeedinqitdyfs.................................................................
ENSBTAP00000053698  lani..........................................................................
ENSBTAP00000006806  seletametlinvfhahsgkegdky.....................................................
ENSBTAP00000029334  gpnmwait......................................................................
ENSBTAP00000044105  hle...........................................................................
ENSBTAP00000026904  mptqleiamnimirtfhryscregdrf...................................................
ENSBTAP00000017060  ptvswvvpvadk..................................................................
ENSBTAP00000055520  pltkytalfqlyaennrgghdlgarm....................................................
ENSBTAP00000044226  seletametlinvfhahsgkegdky.....................................................
ENSBTAP00000055624  pltkytalfqlyaennrgghdlgarm....................................................
ENSBTAP00000042182  elqqlfqelageeeelgapqlqillsialeparahaqtpreigl..................................
ENSBTAP00000010796  lrkkvqgc......................................................................
ENSBTAP00000021174  s.............................................................................
ENSBTAP00000006275  mselekavvalidvfhqysgregd......................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000053738  rkkvqgc.......................................................................
ENSBTAP00000004963  vnsfkkseieclirifhnvvgrgdvklanvg...............................................
ENSBTAP00000023774  ..............................................................................
ENSBTAP00000020395  leqqiqarnttgv.................................................................
ENSBTAP00000020150  mpsqmeham.....................................................................
ENSBTAP00000025561  plekaldvmvstfhkysgkegdkf......................................................
ENSBTAP00000053738  prrlke........................................................................
ENSBTAP00000034009  mtkledhlegiinifhqysvrvghf.....................................................
ENSBTAP00000020539  dilv..........................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000017461  rprtweas......................................................................
ENSBTAP00000044096  msqmessietiinifhqysvrlghydtliqkefkqlvqk.......................................
ENSBTAP00000008523  msqmessietiinifhqysvrlghydtliqkefkqlvqk.......................................
ENSBTAP00000035196  hptgplycpeekemk...............................................................
ENSBTAP00000041997  rdkpmydeifytlspvdgkitgana.....................................................
ENSBTAP00000025499  mtdllhaedikkavgaftavdsf.......................................................
ENSBTAP00000055481  pfggsldiwaitveerakhdqqfhslkpi.................................................
ENSBTAP00000002174  kdkptydeifytlspvngkitganakkemvks..............................................
ENSBTAP00000000589  spleqalavmvatfhkysgqegdkf.....................................................
ENSBTAP00000028239  tkdkskydeifynlapadgklsgtkaktw.................................................
ENSBTAP00000014894  enqiltrdakg...................................................................
ENSBTAP00000026544  v.............................................................................
ENSBTAP00000029333  pfggsldiwaitveerakhdqqfhslkpi.................................................
ENSBTAP00000041966  sqqsifykyaqqgld...............................................................
ENSBTAP00000008933  akdkpvydelfytlspingkisginakkemvtsk............................................
ENSBTAP00000056088  mtkledhlegiinifhqysvrvghf.....................................................
ENSBTAP00000033794  tpveeslfqiihcyheyaaregdaet....................................................
ENSBTAP00000012786  etqiltrdakg...................................................................
ENSBTAP00000030018  enqvltrdakg...................................................................
ENSBTAP00000040233  d.............................................................................
ENSBTAP00000003365  prskkfllteeeifymncraayltv.....................................................
ENSBTAP00000053176  v.............................................................................
ENSBTAP00000024301  rdakg.........................................................................
ENSBTAP00000022292  d.............................................................................
ENSBTAP00000015611  mtnllrsvvtvidtfykytkqdge......................................................
ENSBTAP00000012770  eelskesqetnwfsapsalrv.........................................................
ENSBTAP00000000847  etplekalttmvttfhkysgregskl....................................................
ENSBTAP00000053738  d.............................................................................
ENSBTAP00000054975  pdtfepqkffqtsglakm............................................................
ENSBTAP00000046639  kh............................................................................
ENSBTAP00000052345  npl...........................................................................
ENSBTAP00000053164  hhlkkvnyqn....................................................................
ENSBTAP00000016774  mltdlecainslidvyhkyslkkg......................................................
ENSBTAP00000022630  ksp...........................................................................
ENSBTAP00000010796  al............................................................................
ENSBTAP00000021909  s.............................................................................
ENSBTAP00000033974  m.............................................................................
ENSBTAP00000006711  vylkd.........................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000004912  ll............................................................................
ENSBTAP00000005979  hptaplydpeakqlrpa.............................................................
ENSBTAP00000053738  al............................................................................
ENSBTAP00000053746  pirskivraffdnrnlrkgtsgla......................................................
ENSBTAP00000023221  kevweeadgldpndfdp.............................................................
ENSBTAP00000019429  hpysefpe......................................................................
ENSBTAP00000052019  mtellnsiltv...................................................................
ENSBTAP00000042244  qspsrrvfnpytefke..............................................................
ENSBTAP00000053738  l.............................................................................
ENSBTAP00000018877  ytelekavvvlvenfykyvskhslvk....................................................
ENSBTAP00000053019  ttt...........................................................................
ENSBTAP00000003073  kevweeldgldpnrfnp.............................................................
ENSBTAP00000012886  sllp..........................................................................
ENSBTAP00000044222  slleqa........................................................................
ENSBTAP00000028499  aeplteleaaietvvttfftfagreg....................................................
ENSBTAP00000047378  yv............................................................................
ENSBTAP00000009308  sv............................................................................
ENSBTAP00000017060  plye..........................................................................
ENSBTAP00000050406  attq..........................................................................
ENSBTAP00000031879  attq..........................................................................
ENSBTAP00000031854  qtlsrieaafmdie................................................................
ENSBTAP00000001250  rllrglglkpekleqdldrhaesarmtqgrrvtlpefaaqlgv...................................
ENSBTAP00000026035  mpqllrningiieafrryarmegdca....................................................
ENSBTAP00000011215  tlsrieaafmdie.................................................................
ENSBTAP00000002128  algnvceti.....................................................................
ENSBTAP00000053194  tg............................................................................
ENSBTAP00000056127  ivd...........................................................................
ENSBTAP00000033188  wrkkymrwmnhkk.................................................................
ENSBTAP00000053548  wrkkymrwmnhkk.................................................................
ENSBTAP00000011687  lsvr..........................................................................
ENSBTAP00000007636  cglisfsdyiflttvlstpq..........................................................
ENSBTAP00000020950  p.............................................................................
ENSBTAP00000009115  rk............................................................................
ENSBTAP00000023873  qpegldqlqaqt..................................................................
ENSBTAP00000054471  mlr...........................................................................
ENSBTAP00000039694  gkaelnfedfyrfmdnlqtevleieflsy.................................................
ENSBTAP00000025205  mlr...........................................................................
ENSBTAP00000047882  eae...........................................................................
ENSBTAP00000001368  eewtsaakpkldqaimveh...........................................................
ENSBTAP00000029786  tkrnvvrtivtetsfttdeleelyalfkaehltscywggnsnaldrhdpslpyleqy.....................
ENSBTAP00000028993  ..............................................................................
ENSBTAP00000023678  dpgvr.........................................................................
ENSBTAP00000034710  p.............................................................................
ENSBTAP00000031823  tpeesqarlgrivdrmdrag..........................................................
ENSBTAP00000038002  scyfsll.......................................................................
ENSBTAP00000021074  qllrdilc......................................................................
ENSBTAP00000026544  g.............................................................................
ENSBTAP00000007217  qlva..........................................................................
ENSBTAP00000029792  akrsvvraipgdigfsieeledlymvfkakhlasqywgssrpaavrrdpslpyleqy.....................
ENSBTAP00000044088  dlgdkglisyteylflltiltkphs.....................................................
ENSBTAP00000017319  sdlekaiataalvfrns.............................................................
ENSBTAP00000044100  nkhir.........................................................................
ENSBTAP00000033594  gkegkgkippestlifnidlleirngprs.................................................
ENSBTAP00000026766  tptfyqtlagvthleesdiidlekrywllkaqsrtgrfdletfgplvsppirpslseg....................
ENSBTAP00000055894  lcdqkysdeenlp.................................................................
ENSBTAP00000015220  ah............................................................................
ENSBTAP00000033613  evsa..........................................................................
ENSBTAP00000056320  k.............................................................................
ENSBTAP00000025249  sdssmsfvefvelfksfsvrsrkdlkdlfdiyavpcdragseaaplytnltidenisglqpdldlltrnvsdlglfik
ENSBTAP00000029159  vspkpdpktiskhvqr..............................................................
ENSBTAP00000044088  fgk...........................................................................
ENSBTAP00000016319  lt............................................................................
ENSBTAP00000017662  eraeehl.......................................................................
ENSBTAP00000012479  pl............................................................................
ENSBTAP00000029886  kgsnys........................................................................
ENSBTAP00000027388  flddpkyssdedlpsk..............................................................
ENSBTAP00000039694  slskqelnqmlsetppvwkgsskl......................................................
ENSBTAP00000023673  le............................................................................
ENSBTAP00000041488  le............................................................................
ENSBTAP00000001452  v.............................................................................
ENSBTAP00000028498  sdverai.......................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000020240  nvemilkffdmflklkdlts..........................................................
ENSBTAP00000053650  nvemilkffdmflklkdlts..........................................................
ENSBTAP00000041651  epehm.........................................................................
ENSBTAP00000005154  al............................................................................
ENSBTAP00000021174  nfllkfqgvkmcg.................................................................
ENSBTAP00000022068  edsp..........................................................................
ENSBTAP00000026682  gdinfaeieeanrvlgpiyfttfvffmffillnmflaiindtysevksdlaqqkaemelsdlirkgyhkaliklklk.
ENSBTAP00000007636  hdvlkleferhdpv................................................................
ENSBTAP00000027954  q.............................................................................
ENSBTAP00000020778  v.............................................................................
ENSBTAP00000013601  idtaklypilm...................................................................
ENSBTAP00000005477  e.............................................................................
ENSBTAP00000055305  nvemilkffdmflklkdlts..........................................................
ENSBTAP00000036054  nvemilkffdmflklkdlts..........................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000022292  nwdcefirlhfghn................................................................
ENSBTAP00000002717  s.............................................................................
ENSBTAP00000036015  el............................................................................
ENSBTAP00000051638  t.............................................................................
ENSBTAP00000026766  kgl...........................................................................
ENSBTAP00000053738  eyfnfmghftkpqqvqeelkelqqstekampardklk.........................................
ENSBTAP00000016306  kqlkfeelqcdvs.................................................................
ENSBTAP00000013714  malvapeaps....................................................................
ENSBTAP00000036550  kqnvlrvvipevsvlpedleelydlfkrehmmscyweqprpmaprhdpsrpyaeqy......................
ENSBTAP00000053738  mtkdevieklksciqq..............................................................
ENSBTAP00000023383  e.............................................................................
ENSBTAP00000027030  wie...........................................................................
ENSBTAP00000053270  wie...........................................................................
ENSBTAP00000054640  wie...........................................................................
ENSBTAP00000012770  eelqnlwflldkhqtppmigee........................................................
ENSBTAP00000009967  ngtlti........................................................................
ENSBTAP00000015183  lenql.........................................................................
ENSBTAP00000014222  hlrkeqvsd.....................................................................
ENSBTAP00000026288  phlflrlhdwsve.................................................................
ENSBTAP00000002128  ssvirydvfinrlwdlrffd..........................................................
ENSBTAP00000003365  st............................................................................
ENSBTAP00000053738  sldeietafclelskc..............................................................
ENSBTAP00000009228  nvemilkffdmflklkdivg..........................................................
ENSBTAP00000026785  get...........................................................................
ENSBTAP00000002578  s.............................................................................
ENSBTAP00000000106  pvslpgiss.....................................................................
ENSBTAP00000028840  lhcrki........................................................................
ENSBTAP00000053594  gee...........................................................................
ENSBTAP00000055414  dpkgmipmvviqnvlyeffqnpdlqletcclpvdiadsmkprlnktefiqlislhiagfksetfekllkhlchcaaef
ENSBTAP00000026698  qs............................................................................
ENSBTAP00000017015  ..............................................................................
ENSBTAP00000049908  d.............................................................................
ENSBTAP00000021395  islnpsv.......................................................................
ENSBTAP00000007194  semefstlqdmpkelepsavl.........................................................
ENSBTAP00000025455  srirrell......................................................................


                                                                           10           20          
                                                                            |            |          
d1br1b_               .............................................FSEEQTAEFKEAFQLFD..RT.GDG..KILYSQ
ENSBTAP00000019411  .............................................LTEEQIAEFKEAFSLFD..KD.GDG..TITTKE
ENSBTAP00000036057  .............................................LTEEQIAEFKEAFSLFD..KD.GDG..TITTKE
ENSBTAP00000038404  .............................................FTEHEIQEWYKGFLR--..DC.PSG..HLSMEE
ENSBTAP00000010971  .............................................FSELELQEWYKGFLK--..DC.PTG..ILNVDE
ENSBTAP00000019803  .............................................--SEEVRQFRRLFAQL-..AG.DDM..EVSATE
ENSBTAP00000014038  .............................................FDADEIKRLGKRFKKLD..LD.NSG..SLSVEE
ENSBTAP00000002055  .............................................LTEEQIAEFKEAFSLFD..KD.GDG..TITTKE
ENSBTAP00000049731  .............................................LTEEQIAEFQEAFSLFD..KD.GDG..TITTKE
ENSBTAP00000005577  .............................................FTDHELQEWYKGFLK--..DC.PTG..HLTVDE
ENSBTAP00000034949  .............................................FTEEELSSWYQSFLK--..EC.PSG..RITRQE
ENSBTAP00000017447  .............................................-----------------..-N.TNG..KIPVRS
ENSBTAP00000010858  .............................................-----------------..--.---..------
ENSBTAP00000046644  .............................................-----------------..--.---..------
ENSBTAP00000022814  .............................................FNEHELKQWYKGFLK--..DC.PSG..RLNLEE
ENSBTAP00000019758  .................................vhwqfgqldqhp-----------------..--.---..------
ENSBTAP00000019321  .............................................FSEQELKQWYKGFLK--..DC.PSG..ILNLEE
ENSBTAP00000011677  .............................................--SEEQRQFRNIFRQI-..AG.DDM..EICADE
ENSBTAP00000011680  .............................................--SEEQRQFRNIFRQI-..AG.DDM..EICADE
ENSBTAP00000021742  .............................................FTRKELQVLYRGFKN--..EC.PSG..IVNEEN
ENSBTAP00000005348  ................................pvhwqfseldqhp-----------------..--.---..------
ENSBTAP00000016609  .............................................-----------------..VN.QDG..RIPVKN
ENSBTAP00000012740  .............................................-----------------..--.---..------
ENSBTAP00000018403  .............................................LSEEQVAEFKEAFDRFD..KN.KDG..TISVQE
ENSBTAP00000026407  .............................................-------GLEESFRKFA..IH.GDP..KASGHE
ENSBTAP00000052557  .............................................LTEEQKQEVREAFDLFD..AD.GSG..TIDVKE
ENSBTAP00000054167  .............................................FTKKELQILYRGFKN--..EC.PSG..VVNEDT
ENSBTAP00000010319  .............................................LTEEQKQEIREAFDLFD..AD.GTG..TIDVKE
ENSBTAP00000041545  .............................................------QWLSDWFQRGD..KN.QDG..RMSFGE
ENSBTAP00000055204  .............................................--------LWNVFQRVD..KD.RSG..VISDNE
ENSBTAP00000003718  .............................................FTKRELQVLYRGFKN--..EC.PSG..VVNEET
ENSBTAP00000011676  .............................................-------QLRSLFEKF-..AG.KDS..EIRANE
ENSBTAP00000049395  .............................................----LRHWIHSCLRKAD..KN.KDN..KMSFKE
ENSBTAP00000054983  .............................................--------LEEAFRKFA..VH.GDA..RASGRE
ENSBTAP00000052219  .............................................-----------------..AG.QDG..QIDADE
ENSBTAP00000025402  .............................................-----------------..LN.PEG..KIPVKN
ENSBTAP00000011678  .............................................--EEIDENFKSLFRQL-..AG.EDM..EISVKE
ENSBTAP00000000433  .............................................-----------------..--.---..EMNNKN
ENSBTAP00000021491  .............................................LNETQKQEIKEAFDLFD..VD.GSG..TIDVKE
ENSBTAP00000044733  .............................................----IDDGFRRLFAQL-..AG.EDA..EISAFE
ENSBTAP00000010937  .............................................------QWVKQTFEEAD..KN.GDG..LLNIEE
ENSBTAP00000056439  .............................................------QWVKQTFEEAD..KN.GDG..LLNIEE
ENSBTAP00000055780  .............................................LTEEQKNEFKAAFDIFV..LGaEDG..CISTKE
ENSBTAP00000038002  .............................................-----------------..--.-RG..LISPSD
ENSBTAP00000034705  .............................................-------WIHSYLHRAD..SN.QDS..KMSFKE
ENSBTAP00000035936  .............................................---AQLQEWYKKFLE--..EC.PSG..TLFMHE
ENSBTAP00000013699  .............................................-----DPEAYSWFQSVD..SD.HSG..YISIKE
ENSBTAP00000002564  .............................................-----------------..--.---..------
ENSBTAP00000011496  .............................................-----------------..DC.PSG..QLDAAG
ENSBTAP00000019111  .............................................LSEEQKQEIKDAFELFD..TD.KDE..AIDYHE
ENSBTAP00000017036  .............................................LSSTECHQWYKKFMT--..EC.PSG..QLTLYE
ENSBTAP00000003213  .............................................------QWLKQTFDEAD..KN.GDG..SLSIGE
ENSBTAP00000055444  .............................................------QWLKQTFDEAD..KN.GDG..SLSIGE
ENSBTAP00000024550  .............................................----------KCFLAI-..AG.QDG..EVDAEE
ENSBTAP00000015248  .............................................FDQSQIQEFKEAFNMID..QN.RDG..FIDKED
ENSBTAP00000021328  .............................................FDQSQIQEFKEAFNMID..QN.RDG..FIDKED
ENSBTAP00000037091  .............................................FDQSQIQEFKEAFNMID..QN.RDG..FIDKED
ENSBTAP00000029967  .............................................LRPEEIEELQAAFQEFD..RD.RDG..YIGYQE
ENSBTAP00000021449  .............................................LGPDEIEELREAFLEFD..KD.RDG..FISCKD
ENSBTAP00000053176  .............................................-----------------..--.---..------
ENSBTAP00000042361  .............................................LRPEEIEELREAFREFD..KD.KDG..YINCRD
ENSBTAP00000016509  .............................................---AQLQEWYKKFLE--..EC.PSG..TLFMHE
ENSBTAP00000026714  .............................................LRPEEIEELREAFREFD..KD.KDG..YINCRD
ENSBTAP00000004690  .............................................-----DQDFVRLFHIVA..GG.EGK..EIGMYE
ENSBTAP00000010858  .............................................-----------------..--.---..------
ENSBTAP00000013117  .............................................--------VSQMFSEID..VD.DLG..HITLCS
ENSBTAP00000017574  .............................................---------------RD..DF.KGG..KITLEK
ENSBTAP00000004885  .............................................-------RYETLFQKLD..RN.GDG..VVDISE
ENSBTAP00000008961  .............................................-----------------..--.-KT..IVPWKS
ENSBTAP00000028063  .............................................-----------------..-D.HST..EISVSR
ENSBTAP00000012740  .............................................-----------------..NN.---..------
ENSBTAP00000006283  .............................................LGPEELDELQAAFEEFD..TD.HDG..YIGYRD
ENSBTAP00000014306  .............................................FTEDQTAEFKEAFQLFD..RT.GDG..KILYSQ
ENSBTAP00000053252  .............................................------MWLKTVFEAAD..ID.GNG..IMLEDT
ENSBTAP00000014304  .............................................FTEDQTAEFKEAFQLFD..RT.GDG..KILYSQ
ENSBTAP00000045669  ......................................rmptthq-----------------..--.---..------
ENSBTAP00000041264  .............................................-----------------..--.---..VLPWAE
ENSBTAP00000006711  .............................................-----------------..--.---..------
ENSBTAP00000017358  .............................................-----------------..-G.DKT..IVPWKV
ENSBTAP00000053274  ......................................rmptthq-----------------..--.---..------
ENSBTAP00000055296  .............................................-----------------..-G.DKT..IVPWKV
ENSBTAP00000016852  .............................................------KGLGRVFRIMD..DN.NNR..TLDFKE
ENSBTAP00000036380  .............................................LSQDQINEYKECFSLYD..KQ.QRG..KIKATD
ENSBTAP00000041719  .............................................FNKDQLEEFKEAFELYD..RV.GDG..KIQFSQ
ENSBTAP00000049636  .............................................FSKQQQDEFKEAFLLFD..RT.GEC..KITLSQ
ENSBTAP00000024444  .............................................FEQTQIQEFKEAFTIMD..QN.RDG..FIDKND
ENSBTAP00000004556  .............................................-----------------..--.---..------
ENSBTAP00000038767  .............................................FSHSQITRLYSRFTSLD..KG.ENG..TLSRED
ENSBTAP00000031285  .............................................-----------------..--.---..------
ENSBTAP00000011457  .............................................-----------------..--.---..-LDRNA
ENSBTAP00000011047  .............................................FTPEQIEEFKEAFTLFD..RT.PKCemKITYGQ
ENSBTAP00000002564  .............................................-----------------..--.---..------
ENSBTAP00000037104  .............................................FDQSQIQEFKEAFTIMD..QN.RDG..FIDKED
ENSBTAP00000002672  .............................................FEQAQIQEFKEAFSCID..QN.RDG..IICKSD
ENSBTAP00000028269  .............................................FDQTQIQEFKEAFTVID..QN.RDG..IIDKED
ENSBTAP00000016647  .............................................FSQASLRRLYDRFNALD..RT.GKG..YLSRMD
ENSBTAP00000004536  .............................................---ERRQRWGRLFEELD..SN.KDG..RVDIRE
ENSBTAP00000042177  .............................................-----------------..--.---..------
ENSBTAP00000028063  .............................................---------RYVFSQM-..SD.SNG..LMIFSK
ENSBTAP00000050283  .............................................-----VTEFKEAFSLFD..RT.PTGelKIAYGQ
ENSBTAP00000048539  .............................................-----------------..-S.KGG..KIGIEE
ENSBTAP00000045669  .............................................-----------------..--.---..------
ENSBTAP00000007972  .............................................------QGVARFFRRLD..QD.GSR..SLDVRE
ENSBTAP00000040815  .............................................-----------------..--.---..------
ENSBTAP00000025661  .............................................-----------------..SS.KGG..RIGIEE
ENSBTAP00000028350  .............................................-----------------..--.---..------
ENSBTAP00000053274  .............................................-----------------..--.---..------
ENSBTAP00000021537  .............................................-----------------..--.---..------
ENSBTAP00000055481  .............................................---SSRLKYRQLFNSHD..KT.MSG..HLTGPQ
ENSBTAP00000039155  .............................................----------EAFSLFH..SD.SNS..TIPMQE
ENSBTAP00000029333  .............................................---SSRLKYRQLFNSHD..KT.MSG..HLTGPQ
ENSBTAP00000016315  .............................................ITEEQREYYVNQFRSLQ..PD.PSS..FISGSV
ENSBTAP00000021091  .............................................-----------------..--.--P..EINAIQ
ENSBTAP00000021618  .............................................-----------------..--.---..------
ENSBTAP00000055520  .............................................-----------------..--.---..TLSVQQ
ENSBTAP00000055624  .............................................-----------------..--.---..TLSVQQ
ENSBTAP00000016319  .............................................ITDEQRQYYVNQFKTIQ..PD.LNG..FIPGSA
ENSBTAP00000034078  .............................................------KKIKEAFEVFD..HE.SNN..TVDVRE
ENSBTAP00000006645  .............................................-----------------..--.---..------
ENSBTAP00000021909  .............................................----------RRFKMAD..KD.GDL..IATKEE
ENSBTAP00000001426  .............................................------TQFLEIWKHFD..AD.GNG..YIEGKE
ENSBTAP00000015802  .............................................-----------------..--.---..------
ENSBTAP00000032680  .............................................-----------------..--.---..------
ENSBTAP00000055007  .............................................LSEEMIAEFKAAFDMFD..AD.GGG..DISVKE
ENSBTAP00000020148  .............................................------ESLIAVFQKHAgrDG.NNS..KLSKAE
ENSBTAP00000052345  .............................................-SPAEKAKYDEIFLKTD..KD.MDG..FVSGLE
ENSBTAP00000029334  .............................................-----RLKYRQKFNSLD..KS.MSG..YLSGFQ
ENSBTAP00000052345  .............................................-----------------..--.---..------
ENSBTAP00000056127  .............................................----------RRFKAAD..LD.SDQ..TATREE
ENSBTAP00000012557  .............................................-------DLIRAFQLQD..RN.KSG..KLSMGQ
ENSBTAP00000011888  .............................................--------AERFFVLFD..SD.GSG..TITLQE
ENSBTAP00000017060  .............................................-----------------..--.---..------
ENSBTAP00000031854  .............................................--YEHFYVIYCKFWELD..SD.HDL..YISQAD
ENSBTAP00000031823  .............................................----------RRFRVAD..QD.GDS..MATREE
ENSBTAP00000021603  .............................................-----------------..--.---..------
ENSBTAP00000010838  .............................................---QAITDLINLFHKY-..SG.SDD..TIEKED
ENSBTAP00000014575  .............................................-----------------..--.---..------
ENSBTAP00000011215  .............................................--YEHFYVIYCKFWELD..SD.HDL..YISQAD
ENSBTAP00000053698  .............................................-SVEELDEIREAFRVLD..RD.GNG..FISKQE
ENSBTAP00000006806  .............................................-----------------..--.---..KLSKKE
ENSBTAP00000029334  .............................................--SEERTKHDKQFDNL-..KP.SGG..YITGDQ
ENSBTAP00000044105  .............................................---QAITDLINLFHKY-..SG.SDD..TIEKED
ENSBTAP00000026904  .............................................-----------------..--.---..KLNKGE
ENSBTAP00000017060  .............................................------MRFDEIFLKTD..LD.LDG..YVSGQE
ENSBTAP00000055520  .............................................-----------------..--.---..--T---
ENSBTAP00000044226  .............................................-----------------..--.---..KLSKKE
ENSBTAP00000055624  .............................................-----------------..--.---..--T---
ENSBTAP00000042182  .............................................-----------------..--.---..------
ENSBTAP00000010796  .............................................-----WRELLRECKERD..FN.KQG..EIPGPE
ENSBTAP00000021174  .............................................-------QFFEIWLHFD..AD.GSG..YLEGKE
ENSBTAP00000006275  .............................................-----------------..--.-KH..KLKKSE
ENSBTAP00000020950  .............................................---------KKRFEKAN..QD.SGP..GLNLEE
ENSBTAP00000053738  .............................................-----WRELLRECKERD..FN.KQG..EIPGPE
ENSBTAP00000004963  .............................................-----------------..--.---..-LDRNT
ENSBTAP00000023774  .............................................-------EIREAFKVFD..RD.GNG..FISKQE
ENSBTAP00000020395  .............................................-TEEALKEFSMMFKHFD..KD.KSG..RLNHQE
ENSBTAP00000020150  .............................................-----------------..--.---..------
ENSBTAP00000025561  .............................................-----------------..--.---..KLNKSE
ENSBTAP00000053738  .............................................----FFRDPYAAFFKMD..TD.RDG..ILTMHD
ENSBTAP00000034009  .............................................-----------------..--.--D..TLNKRE
ENSBTAP00000020539  .............................................-----------EFKKHD..KD.ETG..LIALSD
ENSBTAP00000020778  .............................................-TQEVLENLKDRWYQAD..NPpPDL..LLTESE
ENSBTAP00000017461  .............................................--PPEHKKWVEVFKACD..ED.NKG..YLSRED
ENSBTAP00000044096  .............................................-----------------..--.---..-----E
ENSBTAP00000008523  .............................................-----------------..--.---..-----E
ENSBTAP00000035196  .............................................--PACIKALTRIFKISD..QD.NDG..TLNDAE
ENSBTAP00000041997  .............................................-----------------..--.---..------
ENSBTAP00000025499  .............................................-----------------..--.---..------
ENSBTAP00000055481  .............................................-----------------..--.-SG..FITGNW
ENSBTAP00000002174  .............................................-----------------..--.---..------
ENSBTAP00000000589  .............................................-----------------..--.---..------
ENSBTAP00000028239  .............................................-----------------..--.---..------
ENSBTAP00000014894  .............................................ISQEQMQEFRASFNHFD..KD.HGG..ALGPEE
ENSBTAP00000026544  .............................................-------EFMRIWRKYD..AD.SSG..FISAAE
ENSBTAP00000029333  .............................................-----------------..--.-SG..FITGNW
ENSBTAP00000041966  .............................................-----------------..--.---..-IDATQ
ENSBTAP00000008933  .............................................-----------------..--.---..------
ENSBTAP00000056088  .............................................-----------------..--.--D..TLNKRE
ENSBTAP00000033794  .............................................-----------------..--.---..-LSLEE
ENSBTAP00000012786  .............................................ITQEQMNEFRASFNHFD..RR.KNG..LMDHED
ENSBTAP00000030018  .............................................LSQEQLNEFRASFNHFD..RK.RNG..MMEPDD
ENSBTAP00000040233  .............................................-------ELKRAFHLLD..TA.NNM..TVTKSE
ENSBTAP00000003365  .............................................---------------FK..SS.LDN..IISKDQ
ENSBTAP00000053176  .............................................-----------------..--.---..------
ENSBTAP00000024301  .............................................ISQEQMNEFRASFNHFD..RD.HSG..TLGPEE
ENSBTAP00000022292  .............................................--PQELRNIFLQYASTE..VD.GEH..YMTPED
ENSBTAP00000015611  .............................................-----------------..--.-CG..TLSKDE
ENSBTAP00000012770  .............................................---------YGQYLNLD..KD.HNG..MLSKEE
ENSBTAP00000000847  .............................................-----------------..--.---..------
ENSBTAP00000053738  .............................................-------ELKRAFHLLD..TA.NNM..TVTKSE
ENSBTAP00000054975  .............................................-----------------..--.---..------
ENSBTAP00000046639  .............................................------------LQQLD..KE.GNG..LLDKAD
ENSBTAP00000052345  .............................................--------YEKYYRQVD..TG.NTG..RVLASD
ENSBTAP00000053164  .............................................-----FDTLLAAFRHYD..KK.GDG..VIDRAE
ENSBTAP00000016774  .............................................-----------------..--.NYH..AVYRDD
ENSBTAP00000022630  .............................................------EELKGIFEKYAakEG.DPN..QLSKEE
ENSBTAP00000010796  .............................................---------STAFSALD..KE.DTG..FVKASD
ENSBTAP00000021909  .............................................---------------FD..YD.HDA..FLGAEE
ENSBTAP00000033974  .............................................---------------FS..EE.GKG..QVKTDE
ENSBTAP00000006711  .............................................-----------------..--.---..------
ENSBTAP00000010796  .............................................------------FIETD..SE.GNG..ILRRRD
ENSBTAP00000004912  .............................................---------FKQYASIE..KN.GEF..FMSPND
ENSBTAP00000005979  .............................................----CAQALTRIFRLSD..QD.MDQ..ALSDQE
ENSBTAP00000053738  .............................................---------STAFSALD..KE.DTG..FVKASD
ENSBTAP00000053746  .............................................-----------------..--.---..------
ENSBTAP00000023221  .............................................---------KTFFKLHD..VN.SDG..FLDEQE
ENSBTAP00000019429  .............................................FSRRLIKDLESMFKLYD..AG.RDG..FIDLME
ENSBTAP00000052019  .............................................---------IRVFQKYA..KE.NGDstSLCKEE
ENSBTAP00000042244  .............................................FSRKQIKDMEKMFKEYD..AG.RDG..FIDLME
ENSBTAP00000053738  .............................................---------KKALLLIK..SK.PDG..QITGQE
ENSBTAP00000018877  .............................................-----------------..--.---..------
ENSBTAP00000053019  .............................................ISREELEELQEAFNKID..ID.NSG..YVSDYE
ENSBTAP00000003073  .............................................---------KTFFILHD..IN.SDG..VLDEQE
ENSBTAP00000012886  .............................................---SDIDRYKKRFHKFD..AD.QKG..FITIVD
ENSBTAP00000044222  .............................................-----LATLVRTFQEYS..QF.SGN..PLCQAK
ENSBTAP00000028499  .............................................-----------------..--.RKG..SLSVNE
ENSBTAP00000047378  .............................................------SQLRDVYSSCD..TT.GTG..FLDREE
ENSBTAP00000009308  .............................................-SDEEMLELREAFAKVD..TD.GNG..YISCSE
ENSBTAP00000017060  .............................................----------SYYKQVD..PA.YTG..RVGASE
ENSBTAP00000050406  .............................................ISKDELDELKEAFAKVD..LN.SNG..FICDYE
ENSBTAP00000031879  .............................................ISKDELDELKEAFAKVD..LN.SNG..FICDYE
ENSBTAP00000031854  .............................................-----------------..--.-DQ..KADVYE
ENSBTAP00000001250  .............................................-----------------..--.---..------
ENSBTAP00000026035  .............................................-----------------..--.---..VLERGE
ENSBTAP00000011215  .............................................-----------------..--.-DQ..KADVYE
ENSBTAP00000002128  .............................................----------------K..KL.QEN..YIDAEE
ENSBTAP00000053194  .............................................LSEETRQEFETTFRHFD..EN.LTG..RLSHKD
ENSBTAP00000056127  .............................................--------------RID..SD.GDG..FVTTEE
ENSBTAP00000033188  .............................................------SRVMDFFRRID..KD.QDG..KITRQE
ENSBTAP00000053548  .............................................-----------------..--.---..------
ENSBTAP00000011687  .............................................----NVKALVEYFHLLD..VH.HKK..TLNDVL
ENSBTAP00000007636  .............................................------RNFEIAFKMFD..LN.GDG..EVDMEE
ENSBTAP00000020950  .............................................--EEQHKRLKSIIKKID..LD.SDG..FLTESE
ENSBTAP00000009115  .............................................LSPSQMRAFQDAYNFFN..KD.KTG..CIDLHG
ENSBTAP00000023873  .............................................-----------------..--.---..------
ENSBTAP00000054471  .............................................-------RAQEFFQTCD..KE.GKG..FIARAD
ENSBTAP00000039694  .............................................-----------------..SN.GMN..TISEED
ENSBTAP00000025205  .............................................-------RAQEFFQTCD..KE.GKG..FIARAD
ENSBTAP00000047882  .............................................-----------------..--.---..------
ENSBTAP00000001368  .............................................-----------------..--.---..------
ENSBTAP00000029786  .............................................-----------------..--.---..RIDLEQ
ENSBTAP00000028993  .............................................---EELARLRSVFAACD..AN.RSG..RLEREE
ENSBTAP00000023678  .............................................-----------------..--.---..------
ENSBTAP00000034710  .............................................LTARQLAAFQDVFKLFS..SS.PTG..SVDMRS
ENSBTAP00000031823  .............................................-----------------..-D.GDG..WVSLAE
ENSBTAP00000038002  .............................................-----------------..--.---..------
ENSBTAP00000021074  .............................................--------VIETFHKYA..RE.DAA..TLTCTE
ENSBTAP00000026544  .............................................--------FWQVWQRFD..VE.EKG..YIEEKE
ENSBTAP00000007217  .............................................-----------------..-D.RDH..FIRTLS
ENSBTAP00000029792  .............................................-----------------..--.---..RIDAHQ
ENSBTAP00000044088  .............................................-------GFHVAFKMLD..AD.GDE..MVEKKE
ENSBTAP00000017319  .............................................-----------------..SD.PDG..KLRKAT
ENSBTAP00000044100  .............................................-----------------..--.---..------
ENSBTAP00000033594  .............................................---------HESFQEMD..LN.DDW..KLSKNE
ENSBTAP00000026766  .............................................-----------LFNAFD..EN.RDN..HIDFKE
ENSBTAP00000055894  .............................................---EKLTAFKEKYMEFD..LN.NEG..EIDLMS
ENSBTAP00000015220  .............................................-----------------..--.---..------
ENSBTAP00000033613  .............................................-----------------..--.---..------
ENSBTAP00000056320  .............................................------------FWELD..TD.HDL..LIDAQD
ENSBTAP00000025249  skqqlsdnqrqisdaiaaasivtngtgvestslgvfgvgilqlnd-----------------..--.---..------
ENSBTAP00000029159  .............................................-----------------..--.---..------
ENSBTAP00000044088  .............................................-----------------..-R.GER..KLHYKE
ENSBTAP00000016319  .............................................LSDAEQKYYSDLFSYCD..IE.STK..KVSANG
ENSBTAP00000017662  .............................................-TMKQEEAFRSYFEIF-..-N.GHG..EVDAQS
ENSBTAP00000012479  .............................................-SSGLLDKLQKELKVLD..PV.SSG..FLLQSQ
ENSBTAP00000029886  .............................................-----------------..--.---..------
ENSBTAP00000027388  .............................................-----LEAFKKKYMEFD..LN.EDG..GIDIMS
ENSBTAP00000039694  .............................................-----------------..--.---..------
ENSBTAP00000023673  .............................................-----------------..--.---..------
ENSBTAP00000041488  .............................................-----------------..--.---..------
ENSBTAP00000001452  .............................................----------ETFKQID..TD.NDR..QLSKTE
ENSBTAP00000028498  .............................................------ETLIKNFHQYS..VEgGKE..TLTPSE
ENSBTAP00000001426  .............................................-----------------..--.---..------
ENSBTAP00000020240  .............................................-----------------..--.---..------
ENSBTAP00000053650  .............................................-----------------..--.---..------
ENSBTAP00000041651  .............................................-----------------..--.---..------
ENSBTAP00000005154  .............................................--------FQDVFRRAD..KN.DDG..KLSFEE
ENSBTAP00000021174  .............................................-----------------..--.---..------
ENSBTAP00000022068  .............................................-------RLRAVFDALD..GD.GDG..FVRIED
ENSBTAP00000026682  .............................................-----------------..--.---..------
ENSBTAP00000007636  .............................................-----------------..--.-DG..RITERQ
ENSBTAP00000027954  .............................................-----------------..--.---..------
ENSBTAP00000020778  .............................................-----------------..--.---..------
ENSBTAP00000013601  .............................................-----------------..--.---..------
ENSBTAP00000005477  .............................................-----------------..--.---..HICLSE
ENSBTAP00000055305  .............................................-----------------..--.---..------
ENSBTAP00000036054  .............................................-----------------..--.---..------
ENSBTAP00000004912  .............................................----QLEHAKQAFVQRD..SA.RTG..KVTAID
ENSBTAP00000022292  .............................................-----------------..--.---..------
ENSBTAP00000002717  .............................................-----------------..--.---..-ISLRE
ENSBTAP00000036015  .............................................-----LKSIWYAFTALD..VE.KSG..KVSKSQ
ENSBTAP00000051638  .............................................-----------------..--.---..------
ENSBTAP00000026766  .............................................-----------------..--.---..------
ENSBTAP00000053738  .............................................-----------------..--.---..------
ENSBTAP00000016306  .............................................-----------------..--.---..------
ENSBTAP00000013714  .............................................------EQARRVFQTYD..PE.DNG..FIPDSL
ENSBTAP00000036550  .............................................-----------------..--.---..RIDAQQ
ENSBTAP00000053738  .............................................-----------------..--.---..------
ENSBTAP00000023383  .............................................------RWLRKQFYSVD..RN.RED..RISAKD
ENSBTAP00000027030  .............................................------EKLQEVCEDLG..IT.RDG..HLNRKK
ENSBTAP00000053270  .............................................------EKLQEVCEDLG..IT.RDG..HLNRKK
ENSBTAP00000054640  .............................................------EKLQEVCEDLG..IT.RDG..HLNRKK
ENSBTAP00000012770  .............................................-----------------..--.--A..MINYEN
ENSBTAP00000009967  .............................................---EQLDNLRDQFL--D..IA.PKG..IIGNKA
ENSBTAP00000015183  .............................................-TPGDFVQIQRAFEPSE..PS.QTI..CMSREE
ENSBTAP00000014222  .............................................-----------------..--.---..------
ENSBTAP00000026288  .............................................-----------------..--.---..------
ENSBTAP00000002128  .............................................-----------------..--.---..------
ENSBTAP00000003365  .............................................-----------------..--.---..------
ENSBTAP00000053738  .............................................-----YEKVEKALSAGD..PC.TSG..YVSLNY
ENSBTAP00000009228  .............................................-----------------..--.---..------
ENSBTAP00000026785  .............................................-----------------..--.---..------
ENSBTAP00000002578  .............................................LKDELLKGIWHAFTALD..LD.HSG..KVSKSQ
ENSBTAP00000000106  .............................................-----IEDLQGLFHKTG..QD.VDG..KLTYQQ
ENSBTAP00000028840  .............................................-------KILELFHKVD..Q-.GKH..QISREE
ENSBTAP00000053594  .............................................-----------------..--.---..------
ENSBTAP00000055414  ........................................revik-----------------..--.---..------
ENSBTAP00000026698  .............................................-----------------..--.--R..RISQEE
ENSBTAP00000017015  .............................................LTEEEMYSLTETFQQCK..VI.PDC..SLTLED
ENSBTAP00000049908  .............................................-----------------..--.---..------
ENSBTAP00000021395  .............................................-----------------..--.---..RVKVEK
ENSBTAP00000007194  .............................................-----------------..--.---..------
ENSBTAP00000025455  .............................................-----------------..--.---..------


                      30                                40                                          
                       |                                 |                                          
d1br1b_               CGDVMRAL.................GQN.......PT....N....AEVMKV..........................
ENSBTAP00000019411  LGTVMRSL.................GQN.......PT....E....AELQDM..........................
ENSBTAP00000036057  LGTVMRSL.................GQN.......PT....E....AELQDM..........................
ENSBTAP00000038404  FKKIYGNF.................FPYg......DA....S....KFAEHV..........................
ENSBTAP00000010971  FKKIYANF.................FPYg......DA....S....KFAEHV..........................
ENSBTAP00000019803  LMNILNKVvtrhpdlk.........TDG.......FG....I....DTCRSM..........................
ENSBTAP00000014038  FMSLPELQ.................---.......-Q....N....PLVQRV..........................
ENSBTAP00000002055  LGTVMRSL.................GQN.......PT....E....AELQDM..........................
ENSBTAP00000049731  LGTVMRSL.................GQN.......PT....E....AELQDM..........................
ENSBTAP00000005577  FKKIYANF.................FPYg......DA....S....KFAEHV..........................
ENSBTAP00000034949  FQTIYSKF.................FPEa......DP....K....AYAQHV..........................
ENSBTAP00000017447  ITRTFAS-.................--G.......KT....E....KVIFQA..........................
ENSBTAP00000010858  --------.................---.......--....-....--LTTI..........................
ENSBTAP00000046644  --------.................---.......-D....R....KRVETA..........................
ENSBTAP00000022814  FQQLYVKF.................FPYg......DA....S....KFAQHA..........................
ENSBTAP00000019758  --------.................---.......--....-....------..........................
ENSBTAP00000019321  FQQLYIKF.................FPYg......DA....S....KFAQHA..........................
ENSBTAP00000011677  LKNVLNRVvnkhkdlk.........TQG.......FT....L....ESCRSM..........................
ENSBTAP00000011680  LKNVLNRVvnkhkdlk.........TQG.......FT....L....ESCRSM..........................
ENSBTAP00000021742  FKQIYSQF.................FPQg......DS....S....TYATFL..........................
ENSBTAP00000005348  --------.................---.......--....-....------..........................
ENSBTAP00000016609  ILKMFSA-.................---.......-D....K....KRVETA..........................
ENSBTAP00000012740  --------.................---.......--....-....--TNEV..........................
ENSBTAP00000018403  LGTVMQEV.................GLK.......LS....E....AELKKL..........................
ENSBTAP00000026407  MNGKNWAKlckdckvad........GKA.......VT....G....TDVDIV..........................
ENSBTAP00000052557  LKVAMRAL.................GFE.......PR....K....EEMKRM..........................
ENSBTAP00000054167  FKEIYSQF.................FPQg......DS....T....TYAHFL..........................
ENSBTAP00000010319  LKVAMRAL.................GFE.......PK....K....EEIKKM..........................
ENSBTAP00000041545  VQRLLHLM.................NVE.......MD....Q....EYAFQL..........................
ENSBTAP00000055204  LQQALSNG.................TWTp......FN....P....VTVRSI..........................
ENSBTAP00000003718  FKQIYAQF.................FPHg......DA....S....MYAHYL..........................
ENSBTAP00000011676  LRTALNEVfskrtdik.........F-Dg......FD....I....NTCREM..........................
ENSBTAP00000049395  LQNFLKEL.................NIQ.......VD....D....SYARKI..........................
ENSBTAP00000054983  MHGKNWSKlcrdcqvid........GRS.......VT....V....TDVDIV..........................
ENSBTAP00000052219  LQRCLTQS.................GIAggykp..FN....L....ETCRLM..........................
ENSBTAP00000025402  FQMFPA--.................---.......-D....R....KRVEAA..........................
ENSBTAP00000011678  LRTILNRIiskhkdlr.........TTG.......FS....L....ESCRSM..........................
ENSBTAP00000000433  FSKLCKDC.................GIMdgkt...VT....S....TDVDIV..........................
ENSBTAP00000021491  LKIAMRAL.................GFE.......PK....K....EEIKKM..........................
ENSBTAP00000044733  LQTILRRVlakrqdik.........SDG.......FS....I....ETCKIM..........................
ENSBTAP00000010937  IHQLMHKL.................NVN.......LP....R....RKVRQM..........................
ENSBTAP00000056439  IHQLMHKL.................NVN.......LP....R....RKVRQM..........................
ENSBTAP00000055780  LGKVMRML.................GQN.......PT....P....EELQEM..........................
ENSBTAP00000038002  FAQLQKYM.................EYSt......KK....V....SDVLKL..........................
ENSBTAP00000034705  IKNLLRMV.................NLD.......MN....D....MYAYGL..........................
ENSBTAP00000035936  FKRFFKVP.................DNE.......EA....T....QYVEAM..........................
ENSBTAP00000013699  LKQALVNS.................NWSs......FN....D....ETCLMM..........................
ENSBTAP00000002564  --------.................---.......--....-....------..........................
ENSBTAP00000011496  FQKIYKQF.................FPFg......DP....T....KFATFV..........................
ENSBTAP00000019111  LKVAMRAL.................GFD.......VK....K....ADVLKI..........................
ENSBTAP00000017036  FRQFFGLK.................NLSp......WA....S....QYVEQM..........................
ENSBTAP00000003213  VLQLLHKL.................NVN.......LP....R....QRVKQM..........................
ENSBTAP00000055444  VLQLLHKL.................NVN.......LP....R....QRVKQM..........................
ENSBTAP00000024550  LQKCLTQS.................GISgtysp..FS....L....ETCRIM..........................
ENSBTAP00000015248  LHDMLASM.................GKN.......PT....D....EYLEGM..........................
ENSBTAP00000021328  LHDMLASL.................GKN.......PT....D....EYLDAM..........................
ENSBTAP00000037091  LHDMLASL.................GKN.......PT....D....AYLEAM..........................
ENSBTAP00000029967  LGACMRTL.................GYM.......PT....E....MELIEI..........................
ENSBTAP00000021449  LGNLMRTM.................GYM.......PT....E....MELIEL..........................
ENSBTAP00000053176  --------.................---.......--....-....------..........................
ENSBTAP00000042361  LGNCMRTM.................GYM.......PT....E....MELIEL..........................
ENSBTAP00000016509  FKRFFKVP.................DNE.......EA....T....QYVEAM..........................
ENSBTAP00000026714  LGNCMRTM.................GYM.......PT....E....MELIEL..........................
ENSBTAP00000004690  LQKLLNKVvsrfknfk.........TKG.......FS....L....DVCRCM..........................
ENSBTAP00000010858  -------F.................---.......--....-....------..........................
ENSBTAP00000013117  AVQCIRNL.................NPG.......LK....T....SKIELK..........................
ENSBTAP00000017574  ALKLLEKL.................DIQ.......CN....T....IHVKYI..........................
ENSBTAP00000004885  LQEGLKSL.................GIP.......LG....Q....DAEEKI..........................
ENSBTAP00000008961  FRQALHEV.................HPI.......SS....G....LEAMAL..........................
ENSBTAP00000028063  LETVISSI.................YYQ.......LN....K....RL----..........................
ENSBTAP00000012740  --------.................---.......--....-....------..........................
ENSBTAP00000006283  LGECMRTL.................GYM.......PT....E....MELIEV..........................
ENSBTAP00000014306  CGDVMRAL.................GQN.......PT....N....AEVLKV..........................
ENSBTAP00000053252  SVELIKQL.................NPT.......LK....E....SKIRLK..........................
ENSBTAP00000014304  CGDVMRAL.................GQN.......PT....N....AEVLKV..........................
ENSBTAP00000045669  --------.................---.......--....-....------..........................
ENSBTAP00000041264  FEAVLCIC.................HPV.......EP....G....STALAL..........................
ENSBTAP00000006711  --------.................---.......--....-....------..........................
ENSBTAP00000017358  FRQCLHEV.................HQI.......SS....G....LEAMAL..........................
ENSBTAP00000053274  --------.................---.......--....-....------..........................
ENSBTAP00000055296  FRQCLHEV.................HQI.......SS....G....LEAMAL..........................
ENSBTAP00000016852  FVKGLNDY.................AVV.......ME....K....EEAEEL..........................
ENSBTAP00000036380  LLTVMRCL.................GAS.......PT....P....GEAQRH..........................
ENSBTAP00000041719  CGDVMRAL.................GQN.......PT....N....AEVLRV..........................
ENSBTAP00000049636  VGDVLRAL.................GTN.......PT....N....AEVKKV..........................
ENSBTAP00000024444  LRDTFAAL.................GRVn......VK....N....EEIDEM..........................
ENSBTAP00000004556  --------.................---.......--....-....------..........................
ENSBTAP00000038767  FQRIPELA.................INP.......LG....D....RIINAF..........................
ENSBTAP00000031285  --------.................---.......--....-....------..........................
ENSBTAP00000011457  FRNILHMT.................FGM.......TD....D....MIMDRV..........................
ENSBTAP00000011047  CGDVLRAL.................GQN.......PT....Q....AEVLRV..........................
ENSBTAP00000002564  --------.................---.......--....-....------..........................
ENSBTAP00000037104  LRDTFAAP.................GCRin.....VK....N....EELEAM..........................
ENSBTAP00000002672  LRETYSQL.................GKVn......VP....E....EELDAM..........................
ENSBTAP00000028269  LRDTFAAM.................GRLn......VK....N....EELDAM..........................
ENSBTAP00000016647  LQQIGALA.................VNP.......LG....D....RIIDSF..........................
ENSBTAP00000004536  LRQGLARL.................GGGd......PD....R....GAQQGI..........................
ENSBTAP00000042177  --------.................---.......--....-....------..........................
ENSBTAP00000028063  FDQFLKEV.................---.......--....-....------..........................
ENSBTAP00000050283  CGDVLRAL.................GQN.......PT....N....AEVLRV..........................
ENSBTAP00000048539  FANYLKLP.................---.......-I....S....KPLQQL..........................
ENSBTAP00000045669  --------.................---.......--....-....------..........................
ENSBTAP00000007972  LQRGLAEL.................GLV.......LD....T....AEMEGV..........................
ENSBTAP00000040815  --------.................---.......-E....E....RVVHWY..........................
ENSBTAP00000025661  FAEYLKLP.................---.......-V....S....DVLRQL..........................
ENSBTAP00000028350  --------.................---.......-F....K....ERICKV..........................
ENSBTAP00000053274  --------.................---.......--....-....------..........................
ENSBTAP00000021537  --------.................---.......--....N....PFRQRI..........................
ENSBTAP00000055481  ARTILMQS.................SL-.......-P....Q....AQLASI..........................
ENSBTAP00000039155  LGTVLWPL.................GPN.......PT....K....AELQKV..........................
ENSBTAP00000029333  ARTILMQS.................SL-.......-P....Q....AQLASI..........................
ENSBTAP00000016315  AKNFFTKS.................KL-.......-S....I....PELSYI..........................
ENSBTAP00000021091  LQNILNHMpwsglgsk.........QPL.......FS....L....EACQGI..........................
ENSBTAP00000021618  ---FAESL.................GLK.......PQ....D....MFVQSM..........................
ENSBTAP00000055520  LFQALQEMfqkvrvekpgqm.....HPR.......AS....E....LTLSLL..........................
ENSBTAP00000055624  LFQALQEMfqkvrvekpgqm.....HPR.......AS....E....LTLSLL..........................
ENSBTAP00000016319  AKEFFTKS.................KL-.......-P....I....LELSHI..........................
ENSBTAP00000034078  VGTIIRSL.................GCC.......PS....E....GELHDL..........................
ENSBTAP00000006645  --------.................---.......--....-....------..........................
ENSBTAP00000021909  FTAFLHPE.................EYDy......MK....D....IVVQET..........................
ENSBTAP00000001426  LENFFQELekarkgsgmvs......KSD.......NL....G....EKMKEF..........................
ENSBTAP00000015802  --------.................---.......--....R....QWKQKI..........................
ENSBTAP00000032680  --------.................---.......--....R....QWKQKI..........................
ENSBTAP00000055007  LGTVMRML.................GQT.......PT....K....EELDAI..........................
ENSBTAP00000020148  FLIFMNTElgaft............KNQ.......KD....P....GVLDRM..........................
ENSBTAP00000052345  VREIFLKT.................GL-.......-P....S....ALLAHI..........................
ENSBTAP00000029334  ARNALLQS.................NL-.......-S....Q....TQLATI..........................
ENSBTAP00000052345  --------.................---.......--....-....------..........................
ENSBTAP00000056127  FTAFLHPE.................EFEh......MK....E....IVVLET..........................
ENSBTAP00000012557  WAFSMENVl................GLN.......LP....W....RSLSSH..........................
ENSBTAP00000011888  LQKALTLL.................IHG.......SP....M....DKLKFL..........................
ENSBTAP00000017060  --------.................---.......--....-....------..........................
ENSBTAP00000031854  LSRYNDQA.................---.......SS....N....RIIERI..........................
ENSBTAP00000031823  LTAFLHPE.................EFPh......MR....D....IVIAET..........................
ENSBTAP00000021603  ---FAESL.................GLK.......PQ....D....MFVESM..........................
ENSBTAP00000010838  LLRLMKDN.................FPNflgacekRG....R....DYLSNI..........................
ENSBTAP00000014575  --------.................---.......--....-....--KERI..........................
ENSBTAP00000011215  LSRYNDQA.................---.......SS....N....RIIERI..........................
ENSBTAP00000053698  LGMAMRSL.................GYM.......PS....E....VELAII..........................
ENSBTAP00000006806  LKELLQTElsgfl............DAQ.......KD....A....DAVDKV..........................
ENSBTAP00000029334  ARTFFLQS.................GL-.......-P....A....PVLAEI..........................
ENSBTAP00000044105  LLRLMKEN.................FPNflsacekRG....R....QYLSDI..........................
ENSBTAP00000026904  LKMLLQREltefl............SCQ.......KD....P....ELVDKI..........................
ENSBTAP00000017060  VKEIFMHS.................GL-.......-T....Q....NLLAHI..........................
ENSBTAP00000055520  --------.................---.......--....-....------..........................
ENSBTAP00000044226  LKELLQTElsgfl............DAQ.......KD....A....DAVDKV..........................
ENSBTAP00000055624  --------.................---.......--....-....------..........................
ENSBTAP00000042182  --------.................---.......--....-....RTCEQL..........................
ENSBTAP00000010796  FLALVEKF.................NLD.......IS....R....DECQQL..........................
ENSBTAP00000021174  LQNLIQELqqarkka..........GLE.......LS....-....PEMKTF..........................
ENSBTAP00000006275  LKELINNE.................LSHfleei..KE....Q....EVVDKV..........................
ENSBTAP00000020950  FIAFEHPE.................EVDy......MT....E....FVIQEA..........................
ENSBTAP00000053738  FLALVEKF.................NLD.......IS....R....DECQQL..........................
ENSBTAP00000004963  FRVILHSI.................FGM.......TD....D....VLMNRV..........................
ENSBTAP00000023774  LGTAMRSL.................GYM.......PN....E....VELEVI..........................
ENSBTAP00000020395  FKSCLRSL.................GYDlpmveegEP....D....PEFEAI..........................
ENSBTAP00000020150  --------.................---.......--....-....------..........................
ENSBTAP00000025561  LKELLTRElpsfl............GKR.......TD....E....TAFQKL..........................
ENSBTAP00000053738  LHRLLQHL.................LFN.......LK....D....EEFERL..........................
ENSBTAP00000034009  LKQLITKElpktl............QNT.......KD....Q....PTIDKI..........................
ENSBTAP00000020539  WAAAVESVlhl..............GLP.......WR....M....LR-PQL..........................
ENSBTAP00000020778  FLSFLHPE.................HSRg......ML....Q....FMVKEI..........................
ENSBTAP00000017461  FKVAVVMLf................GYK.......PS....K....IEADSV..........................
ENSBTAP00000044096  LPNFLKK-.................-QK.......KN....E....AAINEI..........................
ENSBTAP00000008523  LPNFLKK-.................-QK.......KN....E....AAINEI..........................
ENSBTAP00000035196  LNFFQRIC.................FNTplap...QA....L....EDVKNV..........................
ENSBTAP00000041997  --------.................---.......--....-....------..........................
ENSBTAP00000025499  --------.................---.......--....-....------..........................
ENSBTAP00000055481  IEKLFFQS.................GL-.......-P....Q....PVLAQI..........................
ENSBTAP00000002174  --------.................---.......--....-....------..........................
ENSBTAP00000000589  --------.................---.......--....-....------..........................
ENSBTAP00000028239  ----M--V.................GTK.......LP....N....SVLGRI..........................
ENSBTAP00000014894  FKACLISL.................GYDvendr..QG....D....AEFNRI..........................
ENSBTAP00000026544  LCNFLRDL.................FLHhkka...ISeaklE....EYTGTM..........................
ENSBTAP00000029333  IEKLFFQS.................GL-.......-P....Q....PVLAQI..........................
ENSBTAP00000041966  LQSLLNREflrgpp...........GDP.......FS....L....DECRSL..........................
ENSBTAP00000008933  --------.................---.......--....-....------..........................
ENSBTAP00000056088  LKQLITKElpktlq...........QNT.......KD....Q....PTIDKI..........................
ENSBTAP00000033794  LKALLMDNvprfmetl.........GR-.......KE....P....YYITQL..........................
ENSBTAP00000012786  FRACLISM.................GYD.......LG....E....AEFARI..........................
ENSBTAP00000030018  FRACLISM.................GYD.......LG....E....VEFARI..........................
ENSBTAP00000040233  LRRVITTF.................LLP.......LT....R....EQFQDV..........................
ENSBTAP00000003365  LYLALQHA.................GRN.......PS....Q....KTINKY..........................
ENSBTAP00000053176  --------.................---.......--....-....------..........................
ENSBTAP00000024301  FKACLISL.................GYDigndp..QG....E....AEFARI..........................
ENSBTAP00000022292  FVQRYLGLyn...............DPN.......SN....P....KIVQLL..........................
ENSBTAP00000015611  LKELLEKEfrpil............KNP.......DD....P....DTVDVI..........................
ENSBTAP00000012770  LSRYGTAT.................---.......MT....N....VFLDRV..........................
ENSBTAP00000000847  --------.................---.......--....-....------..........................
ENSBTAP00000053738  LRRVITTF.................LLP.......LT....R....EQFQDV..........................
ENSBTAP00000054975  --------.................---.......--....-....------..........................
ENSBTAP00000046639  FKQALKLF.................RLE.......VS....E....NDFESF..........................
ENSBTAP00000052345  AAVFLKKS.................GL-.......-P....D....LVLGKI..........................
ENSBTAP00000053164  LQEACDQA.................CLH.......LD....E....KLLDQL..........................
ENSBTAP00000016774  LKQLLETE.................CPKf......MK....K....KDADTW..........................
ENSBTAP00000022630  LKLLLQTE.................FPSll.....KG....P....STLDEL..........................
ENSBTAP00000010796  FGQVLKDF.................CYK.......LT....D....NQYHYF..........................
ENSBTAP00000021909  AKTF-DQL.................TPE.......ES....K....ERLGMI..........................
ENSBTAP00000033974  LEWLVSLL.................GIN.......ST....K....SELAST..........................
ENSBTAP00000006711  --------.................---.......--....-....------..........................
ENSBTAP00000010796  MKNALYGF.................DIP.......LT....P....REFEKL..........................
ENSBTAP00000004912  FVTRYLNI.................FGEsq.....PN....P....KTVELL..........................
ENSBTAP00000005979  LNAFQTSCf................GHP.......LA....P....QALEDV..........................
ENSBTAP00000053738  FGQVLKDF.................CYK.......LT....D....NQYHYF..........................
ENSBTAP00000053746  --------.................---.......--....-....------..........................
ENSBTAP00000023221  LEALFTKElekvy............D--.......PK....N....EEDDMVemeeerlrmrehv.............
ENSBTAP00000019429  LKLMMEKL.................GAP.......QT....H....LGLKSM..........................
ENSBTAP00000052019  LKQLLLAEfgdil............RRP.......ND....P....ETVETI..........................
ENSBTAP00000042244  LKLMMEKL.................GAP.......QT....H....LGLKNM..........................
ENSBTAP00000053738  LQRILNCM.................VVK.......IS....D....SEFREL..........................
ENSBTAP00000018877  --------.................---.......--....-....------..........................
ENSBTAP00000053019  LQDLFKEA.................SLP.......LP....GykvrEIVEKI..........................
ENSBTAP00000003073  LEALFTKElekvy............DPK.......NE....D....DDMREMeeerlrmrehv...............
ENSBTAP00000012886  VQRVLESI.................GVQ.......MD....E....NTLHEI..........................
ENSBTAP00000044222  FKELLEKElptwa............PTT.......LR....E....CDYKQF..........................
ENSBTAP00000028499  FKELVTQQ.................LPHll.....KD....V....GSLDEK..........................
ENSBTAP00000047378  LTQLCLKL.................HL-.......-E....K....QLPVLL..........................
ENSBTAP00000009308  LNDLFKAA.................CLP.......LP....G....YRVREI..........................
ENSBTAP00000017060  AALFLKKS.................GL-.......-S....D....IILGKI..........................
ENSBTAP00000050406  LHELFKEA.................NMP.......LP....G....YKVREI..........................
ENSBTAP00000031879  LHELFKEA.................NMP.......LP....G....YKVREI..........................
ENSBTAP00000031854  MGKIAKAC.................GC-.......-P....L....YWKAPM..........................
ENSBTAP00000001250  --------.................---.......PE....S....ESLEDL..........................
ENSBTAP00000026035  LKRLLEKEfadvi............VKP.......HD....P....ATVDEV..........................
ENSBTAP00000011215  MGKIAKAC.................GC-.......-P....L....YWKAPM..........................
ENSBTAP00000002128  LQSILPSI.................GIT.......LS....D....KEFKKI..........................
ENSBTAP00000053194  FRSCLRGL.................NYYlpmveegEP....E....PKFEKF..........................
ENSBTAP00000056127  LKTWIKRV.................QKR.......YI....Y....DNVAKV..........................
ENSBTAP00000033188  FIDGILAS.................KFP.......TT....K....LEMTAV..........................
ENSBTAP00000053548  --------.................---.......--....-....------..........................
ENSBTAP00000011687  FYHFLHHV.................T-D.......LT....R....NQITVV..........................
ENSBTAP00000007636  FEQVQSIIrsqtsmgmrhrdrstt.GNT.......LK....S....GLCSAL..........................
ENSBTAP00000020950  LSSWIQMS.................FKH.......YA....M....QEAKQQ..........................
ENSBTAP00000009115  MMCTLAKL.................GMN.......LT....K....HDVHNE..........................
ENSBTAP00000023873  --------.................--K.......FT....K....KELQSL..........................
ENSBTAP00000054471  MQRLHKEL.................PL-.......-S....L....EDLEDV..........................
ENSBTAP00000039694  FAHILLRYt................NVE.......NT....S....VFLENV..........................
ENSBTAP00000025205  MQRLHKEL.................PL-.......-S....L....EDLEDV..........................
ENSBTAP00000047882  --------.................---.......--....-....------..........................
ENSBTAP00000001368  --------.................---.......-I....E....KMVESV..........................
ENSBTAP00000029786  FKGMFALL.................FPWacgt...HS....D....VLASRL..........................
ENSBTAP00000028993  FRALCAEL.................RV-.......-R....P....ADAEAV..........................
ENSBTAP00000023678  --------.................---.......--....-....------..........................
ENSBTAP00000034710  MKAALSNV.................GVQ.......LS....P....QEMCEA..........................
ENSBTAP00000031823  LRSWIAHT.................QQR.......HI....R....DSVSAA..........................
ENSBTAP00000038002  --------.................---.......--....-....------..........................
ENSBTAP00000021074  LKQLIQSEfedi.............FQP.......CA....I....HAVERN..........................
ENSBTAP00000026544  LDAFFYHMltkl.............GVDda.....VK....E....ENVQKM..........................
ENSBTAP00000007217  LKPLLFEI.................PGF.......LS....D....EECRLV..........................
ENSBTAP00000029792  FRELFASL.................TPWacga...HT....P....VLAGRM..........................
ENSBTAP00000044088  FFKLQKIIskqddlktaitdetecqE--.......--....-....-----Qtvqepeinttlq..............
ENSBTAP00000017319  AKNLLQTQ.................FKNfaegq..ET....K....ARYKDL..........................
ENSBTAP00000044100  --------.................---.......--....-....KLVESV..........................
ENSBTAP00000033594  VKVYLKK-.................---.......--....-....------..........................
ENSBTAP00000026766  ISCGLSAC.................C--.......--....-....------..........................
ENSBTAP00000055894  LKRMMEKL.................GVP.......KT....H....LEMKKM..........................
ENSBTAP00000015220  --------.................---.......--....-....-----L..........................
ENSBTAP00000033613  --------.................---.......--....-....----NL..........................
ENSBTAP00000056320  LAR---HN.................DHA.......IS....T....KMIDRI..........................
ENSBTAP00000025249  --------.................---.......--....-....------..........................
ENSBTAP00000029159  --------.................---.......--....-....-MVDSV..........................
ENSBTAP00000044088  FRRFMENL.................QAE.......VQ....E....MEFLQFskglsfmrkedfaewllfftdtenkd
ENSBTAP00000016319  RVLELFRA.................--Aq......LP....N....DVVLQI..........................
ENSBTAP00000017662  LENILLLV.................GIS.......LT....T....AQVEGA..........................
ENSBTAP00000012479  LSHLFLRL.................EVP.......LQ....L....PTVKIL..........................
ENSBTAP00000029886  --------.................---.......--....-....EILDKY..........................
ENSBTAP00000027388  LKRMMEKL.................GVP.......KT....H....LELKKL..........................
ENSBTAP00000039694  --------.................---.......--....-....------..........................
ENSBTAP00000023673  --------.................---.......--....-....------..........................
ENSBTAP00000041488  --------.................---.......--....-....------..........................
ENSBTAP00000001452  ISHYLKKEfekdekpr.........DQS.......YQ....T....AVLEDF..........................
ENSBTAP00000028498  LRDLVTQQ.................LPHlm.....PS....N....CGLEEK..........................
ENSBTAP00000001426  --------.................---.......--....-....------..........................
ENSBTAP00000020240  --------.................---.......--....-....------..........................
ENSBTAP00000053650  --------.................---.......--....-....------..........................
ENSBTAP00000041651  --------.................---.......--....-....------..........................
ENSBTAP00000005154  FQNYFADG.................VL-.......-S....P....GELREL..........................
ENSBTAP00000021174  --------.................---.......--....-....------..........................
ENSBTAP00000022068  FVQFATVY.................GA-.......--....-....EQVTDL..........................
ENSBTAP00000026682  --------.................---.......--....-....------..........................
ENSBTAP00000007636  FGGMLLAY.................SGV.......QS....-....KKLTAM..........................
ENSBTAP00000027954  --------.................---.......--....-....------..........................
ENSBTAP00000020778  --------.................---.......--....-....------..........................
ENSBTAP00000013601  --------.................---.......--....-....------..........................
ENSBTAP00000005477  LPFVMRAI.................GFY.......PS....E....GEIEDM..........................
ENSBTAP00000055305  --------.................---.......--....-....------..........................
ENSBTAP00000036054  --------.................---.......--....-....------..........................
ENSBTAP00000004912  FRDIMVTI.................RPHv......LT....P....FVEECL..........................
ENSBTAP00000022292  --------.................---.......--....-....------..........................
ENSBTAP00000002717  LKTILPLV.................NFKv......SS....A....KFLKDK..........................
ENSBTAP00000036015  LKVLSHNL.................YTVl......HI....P....HDPVAL..........................
ENSBTAP00000051638  --------.................---.......--....-....------..........................
ENSBTAP00000026766  --------.................---.......--....-....------..........................
ENSBTAP00000053738  --------.................---.......--....-....------..........................
ENSBTAP00000016306  --------.................---.......--....-....------..........................
ENSBTAP00000013714  LEDVMKAL.................DLV.......SD....P....EYINLM..........................
ENSBTAP00000036550  FARLFQLV.................SPWtcga...HT....E....ILAERT..........................
ENSBTAP00000053738  --------.................---.......--....-....------..........................
ENSBTAP00000023383  LKNMLSQV.................NYRv......PN....M....RFLRER..........................
ENSBTAP00000027030  LVSICEQY.................GLQn......VD....G....EMLEEV..........................
ENSBTAP00000053270  LVSICEQY.................GLQn......VD....G....EMLEEV..........................
ENSBTAP00000054640  LVSICEQY.................GLQn......VD....G....EMLEEV..........................
ENSBTAP00000012770  FLKVGEKA.................GPK.......CK....Q....FFTAKV..........................
ENSBTAP00000009967  FADLLLDLvtlnlgtnnfpss....WMN.......LT....Q....PELQEL..........................
ENSBTAP00000015183  FVQRMTEI.................VGW.......GT....E....EEYGEL..........................
ENSBTAP00000014222  --------.................---.......--....-....--VQKV..........................
ENSBTAP00000026288  --------.................---.......--....-....------..........................
ENSBTAP00000002128  --------.................---.......--....-....------..........................
ENSBTAP00000003365  --------.................---.......--....-....------..........................
ENSBTAP00000053738  LKIVLDTF.................VYR.......LP....R....RIFIQL..........................
ENSBTAP00000009228  --------.................---.......--....-....------..........................
ENSBTAP00000026785  --------.................---.......--....-....------..........................
ENSBTAP00000002578  LKVLSHNL.................CTVl......KV....P....HDPVAL..........................
ENSBTAP00000000106  IEDTLESV.................GPE.......PE....-....-----R..........................
ENSBTAP00000028840  FIVALKAI.................GVP.......LK....N....QEVEDI..........................
ENSBTAP00000053594  --------.................---.......--....-....------..........................
ENSBTAP00000055414  --------.................---.......--....-....------..........................
ENSBTAP00000026698  FAKQLQLS.................---.......-D....S....QTVAGA..........................
ENSBTAP00000017015  FLRYRHQTakrgnsdra........LSE.......EQ....E....EQAARQ..........................
ENSBTAP00000049908  --------.................---.......--....-....------..........................
ENSBTAP00000021395  LEMALNYL.................GIQ.......PT....K....EQHQAL..........................
ENSBTAP00000007194  --------.................---.......--....-....------..........................
ENSBTAP00000025455  --------.................---.......--....-....------..........................


                        50                  60             70                           80          
                         |                   |              |                            |          
d1br1b_               ..LGNP......KSD...E.MNLKT.....LKFEQFLPMMQTIAK.........NKD..........QGCFE......
ENSBTAP00000019411  ..INEV......DAD...-.-GNGT.....IDFPEFLTMMARKM-.........-KD..........TDSEE......
ENSBTAP00000036057  ..INEV......DAD...-.-GNGT.....IDFPEFLTMMARKM-.........-KD..........TDSEE......
ENSBTAP00000038404  ..FRTF......DAN...-.-GDGT.....IDFREFIIALSVT--.........-SR..........GKLEQ......
ENSBTAP00000010971  ..FRTF......DTN...-.-SDGT.....IDFREFIIALSVT--.........-SR..........GRLEQ......
ENSBTAP00000019803  ..VAVM......DSD...-.-TTGK.....LGFEEFKYLWNNIK-.........---..........-----......
ENSBTAP00000014038  ..IDIF......DTD...-.-GNGE.....VDFKEFIEGVSQFS-.........-VK..........GDKEQ......
ENSBTAP00000002055  ..INEV......DAD...-.-GNGT.....IDFPEFLTMMARKM-.........-KD..........TDSEE......
ENSBTAP00000049731  ..INEV......DAD...-.-GNGT.....IDFPEFLTMMARKM-.........-KD..........TDSEE......
ENSBTAP00000005577  ..FRTF......DTN...-.-GDGT.....IDFREFIIALSVT--.........-SR..........GKLEQ......
ENSBTAP00000034949  ..FRSF......DAN...-.-SDGT.....LDFKEYVIALHMT--.........-SA..........GKTNQ......
ENSBTAP00000017447  ..LKEL......GLP...S.GKNDEiepaaFTYEKFYELT-----.........-QK..........ICPRT......
ENSBTAP00000010858  ..YDRL......EQE...-.-HNNL.....VNVPLCVDMCLNW--.........---..........-----......
ENSBTAP00000046644  ..LEAC......SLP...S.SRNDS.....IPQEDFTPEVYRVFL.........-NN..........LCPRP......
ENSBTAP00000022814  ..FRTF......DKN...-.-GDGT.....IDFREFICALSIT--.........-SR..........GSFEQ......
ENSBTAP00000019758  ..----......---...-.-IDGY.....LSHTELAPLRAPLI-.........---..........-PMEH......
ENSBTAP00000019321  ..FRTF......DKN...-.-GDGT.....IDFREFICALSVT--.........-SR..........GSFEQ......
ENSBTAP00000011677  ..IALM......DTD...-.-GSGR.....LNLQEFHHLWKKIK-.........---..........-----......
ENSBTAP00000011680  ..IALM......DTD...-.-GSGR.....LNLQEFHHLWKKIK-.........---..........-----......
ENSBTAP00000021742  ..FNAF......DTN...-.-HDGS.....VSFEDFVAGLSVI--.........-LR..........GTTDD......
ENSBTAP00000005348  ..----......---...-.-RDRV.....LTHSELAPLRASLV-.........---..........-PMEH......
ENSBTAP00000016609  ..LESC......GLN...F.NRSES.....IRPDEFSLEIFERFL.........-NK..........LCLRP......
ENSBTAP00000012740  ..FEQH......KLN...Q.-NDQL.....LSVPDVINCLTTTYD.........GLE..........QM--Hknlvnv
ENSBTAP00000018403  ..ISQL......DTD...-.-KNGS.....ISFQEFLEAMAAG--.........-LQ..........TSDTE......
ENSBTAP00000026407  ..FSKV......KAK...-.-SARV.....INYEEFKKALEELA-.........-PK..........RFKGK......
ENSBTAP00000052557  ..IADV......DKE...-.-GTGK.....ISFNDFLAVMTQKM-.........-AE..........KDTKE......
ENSBTAP00000054167  ..FNAF......DTD...-.-HNGA.....VSFEDFIKGLSIL--.........-LR..........GTVQE......
ENSBTAP00000010319  ..ISEI......DKE...-.-GTGK.....MNFSDFLTVMTQKM-.........-SE..........KDTKE......
ENSBTAP00000041545  ..FQTA......DTS...-.-QSGT.....LEGEEFVEFYKSL--.........---..........-TQRP......
ENSBTAP00000055204  ..ISMF......DRE...-.-NKAG.....VNFSEFTGVWKYIT-.........---..........-----......
ENSBTAP00000003718  ..FHAF......DTT...-.-QTGS.....VKFEDFVTALSIL--.........-LR..........GTVHE......
ENSBTAP00000011676  ..ISLM......DSN...-.-GTGS.....LELVEFKTLWLKIR-.........---..........-----......
ENSBTAP00000049395  ..FKEC......DHS...-.-QTDS.....LEDEEIETFYKILT-.........-QR..........KEIDR......
ENSBTAP00000054983  ..FSKI......KGK...-.-SCRT.....ITFEQFKEALEELA-.........-KK..........RFKDK......
ENSBTAP00000052219  ..VSML......DRD...-.-MSGT.....MGFNEFKELWAVLN-.........---..........-----......
ENSBTAP00000025402  ..LSAC......HLP...K.GKNDA.....INPEDFPESVYKSFL.........-MS..........LCPRP......
ENSBTAP00000011678  ..VNLM......DRD...-.-GNGK.....LGLVEFNILWNRIR-.........---..........-----......
ENSBTAP00000000433  ..FSKV......KAK...-.-NART.....ITFQQFQEAMKELGQkr.......FKG..........KSPDE......
ENSBTAP00000021491  ..IAET......DKE...-.-GIGT.....ISFEKFFAIMSVKM-.........-SE..........KDEKE......
ENSBTAP00000044733  ..VDML......DSD...-.-GSGK.....LGLKEFYILWTKIQ-.........---..........-----......
ENSBTAP00000010937  ..FQEA......DTD...E.-NQGT.....LTFEEFCVFYKMMS-.........---..........--LRR......
ENSBTAP00000056439  ..FQEA......DTD...E.-NQGT.....LTFEEFCVFYKMMS-.........---..........--LRR......
ENSBTAP00000055780  ..IDEV......DED...-.-GSGT.....VDFDEFLVMMVRCMKd........DSK..........GKSEE......
ENSBTAP00000038002  ..FEDG......EMA...EyLQGDA.....IGYEGFQQFLKIYLE.........-VD..........NVPDH......
ENSBTAP00000034705  ..FKEC......DRS...-.-KNER.....LEGPEIEEFLRRLL-.........---..........--KRP......
ENSBTAP00000035936  ..FRAF......DTN...-.-GDNT.....IDFLEYVAALNLV--.........-LR..........GTLEH......
ENSBTAP00000013699  ..INMF......DKT...-.-KSGR.....IDVYGFSALWKFIQ-.........---..........-----......
ENSBTAP00000002564  ..----......---...-.-----.....---------------.........---..........LVTLT......
ENSBTAP00000011496  ..FNVF......DEN...-.-KDGR.....IEFSEFIQALSVT--.........-SR..........GTLDE......
ENSBTAP00000019111  ..LKDY......DRE...-.-ATGK.....ITFEDFNEVVTDWI-.........-LE..........RDPHE......
ENSBTAP00000017036  ..FETF......DFN...-.-KDGY.....IDFMEYVAALSLV--.........-LK..........GKVEQ......
ENSBTAP00000003213  ..FKEA......DTD...D.-HQGT.....LGFEEFCAFYKMMS-.........---..........--TRR......
ENSBTAP00000055444  ..FKEA......DTD...D.-HQGT.....LGFEEFCAFYKMMS-.........---..........--TRR......
ENSBTAP00000024550  ..IAML......DRD...-.-YSGK.....MGFNEFKELWAALN-.........---..........-----......
ENSBTAP00000015248  ..MSE-......---...-.-APGP.....INFTMFLTMFGEKL-.........-NG..........TDPED......
ENSBTAP00000021328  ..MNE-......---...-.-APGP.....INFTMFLTMFGEKL-.........-NG..........TDPED......
ENSBTAP00000037091  ..MNE-......---...-.-APGP.....INFTMFLTMFGEKL-.........-NG..........TDPED......
ENSBTAP00000029967  ..SQQI......---...-.-SGGK.....VDFEDFVELMGPKLLae.......TAD..........MIGVR......
ENSBTAP00000021449  ..GQQI......RMN...-.-LGGR.....VDFDDFVELMTPKLLae.......TAG..........MIGVQ......
ENSBTAP00000053176  ..----......---...-.-LNQT.....IDFEGFKLFMKTFL-.........-EA..........ELPDD......
ENSBTAP00000042361  ..SQQI......NMN...-.-LGGH.....VDFDDFVELMGPKLLae.......TAD..........MIGVK......
ENSBTAP00000016509  ..FRAF......DTN...-.-GDNT.....IDFLEYVAALNLV--.........-LR..........GTLEH......
ENSBTAP00000026714  ..SQQI......NMN...-.-LGGH.....VDFDDFVELMGPKLLae.......TAD..........MIGVK......
ENSBTAP00000004690  ..VNLL......DKD...-.-GSGK.....LGLREFQVLWRKIK-.........---..........-----......
ENSBTAP00000010858  ..----......---...-.-----.....---------------.........---..........-----......
ENSBTAP00000013117  ..FKEL......HKS...R.DKTGTd....VIKEEFVEVFHELC-.........---..........--TRP......
ENSBTAP00000017574  ..FKDN......DRL...-.-KQGR.....ITIEEFRTIYRIIT-.........---..........--YRE......
ENSBTAP00000004885  ..FTTG......DVN...-.-KDGK.....LDFEEFMKYLKDH--.........---..........---EK......
ENSBTAP00000008961  ..KSTI......DLT...-.-CNDY.....ISVFEFDIFTRLFQ-.........---..........-----......
ENSBTAP00000028063  ..----......--P...-.-STHQ.....ISVEQSISLLLNFM-.........---..........-----......
ENSBTAP00000012740  ..----......---...-.-NKPE.....ISVKEFIDWMR----.........---..........-----......
ENSBTAP00000006283  ..SQHV......KMR...-.-MGGR.....VDFEEFVEMMGPKLRee.......TAH..........MLGLR......
ENSBTAP00000014306  ..LGNP......KSD...E.MNVKV.....LDFEHFLPMLQTVAK.........NKD..........QGTYE......
ENSBTAP00000053252  ..FKEI......QKSk..E.KLTTR.....VTEEEFCEAFCELC-.........---..........--TRP......
ENSBTAP00000014304  ..LGNP......KSD...E.MNVKV.....LDFEHFLPMLQTVAK.........NKD..........QGTYE......
ENSBTAP00000045669  ..----......---...-.-----.....IQVEQSISLLLN---.........---..........-----......
ENSBTAP00000041264  ..RSTI......DLT...-.-CSGH.....VSIFEFDIFTRLFQ-.........---..........-----......
ENSBTAP00000006711  ..----......---...-.---EP.....ISYDVFKLFMKAY--.........---..........-----......
ENSBTAP00000017358  ..KSTI......DLT...-.-CNDY.....ISVFEFDIFTRLFQ-.........---..........-----......
ENSBTAP00000053274  ..----......---...-.-----.....IQVEQSISLLLN---.........---..........-----......
ENSBTAP00000055296  ..KSTI......DLT...-.-CNDY.....ISVFEFDIFTRLFQ-.........---..........-----......
ENSBTAP00000016852  ..FRRF......DKD...-.-GNGT.....IDFNEFLLTLRPP--.........-MS..........RARKE......
ENSBTAP00000036380  ..LQTH......RID...-.-RNGE.....LDFSTFLTIMHMQI-.........-KQ..........EDPKK......
ENSBTAP00000041719  ..LGYP......KSD...E.LKSRR.....VDFETFLPMLQAVAK.........LPD..........RGSYQ......
ENSBTAP00000049636  ..LGNP......SNE...E.MNAKK.....IEFEQFLPMLQAISN.........NKD..........QGTYE......
ENSBTAP00000024444  ..LKE-......---...-.-APGP.....INFTVFLQMFGEKL-.........-KG..........ADPEE......
ENSBTAP00000004556  ..----......---...-.-----.....---------QGRFDT.........SIL..........PICKD......
ENSBTAP00000038767  ..FPE-......---...-.-GEDQ.....VNFRGFMRTLAHFRP.........IED..........--NEKskdvng
ENSBTAP00000031285  ..----......---...-.-----.....---------------.........---..........-----......
ENSBTAP00000011457  ..FRGF......DKD...-.-NDGC.....ISVTEWVYGLSVF--.........-LR..........GTLEE......
ENSBTAP00000011047  ..LGKP......KQE...E.LNSKM.....MDFDTFLPMLQHISK.........NKD..........TGTYE......
ENSBTAP00000002564  ..----......---...-.-GKPV.....IEASQFLE-------.........---..........-----......
ENSBTAP00000037104  ..VKE-......---...-.-APGP.....INFTVFLTMFGEKL-.........-KG..........TDPEE......
ENSBTAP00000002672  ..LQE-......---...-.-GKGP.....INFTVFLTLFGEKL-.........-NG..........TDPEE......
ENSBTAP00000028269  ..MKE-......---...-.-ASGP.....INFTVFLNMFGEKL-.........-KG..........ADPED......
ENSBTAP00000016647  ..FPD-......---...-.-GSLR.....LDFPGFVRVLAHFR-.........--P..........VDEEDdgnrdp
ENSBTAP00000004536  ..SPEG......DTD...-.-PDGG.....LDLEEFILYLQER--.........---..........---EQ......
ENSBTAP00000042177  ..----......---...-.-----.....---------------.........---..........-----......
ENSBTAP00000028063  ..----......---...-.-----.....---------------.........---..........-----......
ENSBTAP00000050283  ..LGKP......KPE...E.MNSKM.....LDFETFLPILQHISR.........NKE..........QGTYE......
ENSBTAP00000048539  ..FALF......DRN...-.-NDGT.....IDFREYVIGLTVLC-.........-NP..........VNTEK......
ENSBTAP00000045669  ..----......---...-.-----.....---------------.........---..........-----......
ENSBTAP00000007972  ..CRRW......DRD...-.-GSGT.....LDLEEFLRALRPP--.........-MS..........QAREA......
ENSBTAP00000040815  ..FSQL......DSN...-.-SSSD.....INKREMKPFKRYVK-.........-KK..........AKPKK......
ENSBTAP00000025661  ..FALF......DRN...-.-HDGS.....IDFREYVIGLAVLC-.........-NP..........ANTEE......
ENSBTAP00000028350  ..FSTS......P--...-.-SRDS.....LSFEDFLDLLSVFS-.........-DT..........ATPDI......
ENSBTAP00000053274  ..----......---...-.-----.....---------------.........---..........-----......
ENSBTAP00000021537  ..AQVF......SED...-.-GDGH.....MTLDNFLDMFSVMS-.........-EM..........APRDL......
ENSBTAP00000055481  ..WNLS......DID...-.-QDGK.....LTAEEFILAMHLID-.........---..........-----......
ENSBTAP00000039155  ..VGEL......DCD...-.-GRGP.....VGFPELLGLMAWKV-.........-KA..........GDSED......
ENSBTAP00000029333  ..WNLS......DID...-.-QDGK.....LTAEEFILAMHLID-.........---..........-----......
ENSBTAP00000016315  ..WELS......DAD...-.-CDGA.....LTLPEFCAAFHLIVA.........RK-..........-----......
ENSBTAP00000021091  ..LALL......DLN...-.-ASGT.....VSIQEFRDLWKQLM-.........---..........-----......
ENSBTAP00000021618  ..FSLA......DKD...-.-GNGY.....LSFREFLDILVVF--.........-MK..........GSPEE......
ENSBTAP00000055520  ..TTMY......DST...-.-GTGF.....IKL------------.........---..........-----......
ENSBTAP00000055624  ..TTMY......DST...-.-GTGF.....IKL------------.........---..........-----......
ENSBTAP00000016319  ..WELS......DFD...-.-KDGA.....LTLDEFCAAFHLVVA.........---..........-----......
ENSBTAP00000034078  ..IAEV......EEE...E.-PTGY.....IRFEKFLPVMTEVLLer.......RYR..........PIPED......
ENSBTAP00000006645  ..--VF......S--...-.-HNNV.....FSFEDVLGMASVFS-.........-EQ..........ACPSL......
ENSBTAP00000021909  ..MEDI......DKN...-.-ADGF.....IDLEEYIGDMYSHD-.........-GN..........ADEPEwvkt..
ENSBTAP00000001426  ..MQKY......DKN...-.-SDGK.....IEMAELAQILPTEENfllcf....RQH..........VGSST......
ENSBTAP00000015802  ..VQAG......DKD...-.-LDGQ.....LDFEEFVHYLQDH--.........---..........---EK......
ENSBTAP00000032680  ..VQAG......DKD...-.-LDGQ.....LDFEEFVHYLQDH--.........---..........---EK......
ENSBTAP00000055007  ..IEEV......DED...-.-GSGT.....IDFEEFLVMMVRQMKe........DAK..........GKTEE......
ENSBTAP00000020148  ..MKKL......DLN...-.-SDGQ.....LDFQEFLNLI-----.........---..........-----......
ENSBTAP00000052345  ..WALC......DTK...-.-NCGK.....LSKDQFALAFHLIN-.........---..........-----......
ENSBTAP00000029334  ..WTLA......DID...-.-GDGQ.....LKAEEFILAMHLT--.........---..........-----......
ENSBTAP00000052345  ..----......---...-.-----.....---------------.........---..........-----......
ENSBTAP00000056127  ..LEDI......DKN...-.-GDGF.....VDQDEYIADMFSHE-.........-ES..........GPEPDwvl...
ENSBTAP00000012557  ..LVTT......DKD...-.---GN.....IDYMSGFQDVHIQKP.........VK-..........----Evqssli
ENSBTAP00000011888  ..FQVY......DVD...-.-GKHP.....LW-------------.........---..........----Dgrrtqr
ENSBTAP00000017060  ..----......---...-.-----.....---------------.........---..........-----......
ENSBTAP00000031854  ..FSGAvtr...GKT...V.QKEGR.....MSYADFVWFLISE--.........-ED..........KRNPT......
ENSBTAP00000031823  ..LEDL......DRN...-.-KDGY.....VQVEEYIADLYTAEPg........EEE..........PAWVQ......
ENSBTAP00000021603  ..FSLA......DKD...-.-GNGY.....LSFREFLDVLVVF--.........-MK..........GSPED......
ENSBTAP00000010838  ..FEKQ......DKN...-.-KDRK.....IDFSEFLSLLADIA-.........---..........-----......
ENSBTAP00000014575  ..VEAF......SED...-.-GEGN.....LTFNDFVDMFSVLC-.........-ES..........APREL......
ENSBTAP00000011215  ..FSGAvtr...GKT...V.QKEGR.....MSYADFVWFLISE--.........-ED..........KRNPT......
ENSBTAP00000053698  ..MQRL......DMD...-.-GDGQ.....VDFDEFMTILGPKLVsse......GRD..........GFLGN......
ENSBTAP00000006806  ..MKEL......DEN...-.-GDGE.....VDFQEYVVLVA----.........---..........-----......
ENSBTAP00000029334  ..WALS......DLN...-.-KDGK.....MDQQEFSIAMKLIK-.........---..........-----......
ENSBTAP00000044105  ..FEKK......DKN...-.-KDKK.....IDFSEFLSLLADIA-.........---..........-----......
ENSBTAP00000026904  ..MQDL......DAN...-.-KDNE.....VDFNEFVVMVAALT-.........---..........-----......
ENSBTAP00000017060  ..WALA......DTR...-.-QTGK.....LSKDQFALAMYFIQ-.........---..........-----......
ENSBTAP00000055520  ..----......---...-.-----.....---------------.........---..........-----......
ENSBTAP00000044226  ..MKEL......DEN...-.-GDGE.....VDFQEYVVLVA----.........---..........-----......
ENSBTAP00000055624  ..----......---...-.-----.....---------------.........---..........-----......
ENSBTAP00000042182  ..LQCF......G--...-.-HGGS.....LDLYHFQQLWGHLL-.........---..........-----......
ENSBTAP00000010796  ..LIKY......DLK...-.-NNGK.....FAYCSFIQSCVLLLK.........AKE..........TSLMQrmkiqn
ENSBTAP00000021174  ..VDQY......GQR...-.-DDGK.....IGIVELAHVLPTEENflllfr...CQQ..........LKSCE......
ENSBTAP00000006275  ..METL......DSD...-.-GDGE.....CDFQEFMAFVAMIT-.........---..........-----......
ENSBTAP00000020950  ..LEEH......DKD...-.-GDGF.....VSLEEFLGDYRRDPTas.......EDP..........EWILV......
ENSBTAP00000053738  ..LIKY......DLK...-.-NNGK.....FAYCSFIQSCVLLLK.........AKE..........TSLMQrmkiqn
ENSBTAP00000004963  ..FFAF......DKD...-.-NDNY.....INVKEWVKGLSVF--.........-LR..........GTFEE......
ENSBTAP00000023774  ..IQRL......DMD...-.-GDGQ.....VDFEEFVTLLGPKLS.........TSG..........IPEKFhgt...
ENSBTAP00000020395  ..LDTV......DPN...-.-RDGH.....VSLQEYMAFMISRET.........-EN..........VKSSE......
ENSBTAP00000020150  ..----......---...-.-----.....---------------.........---..........----E......
ENSBTAP00000025561  ..MSNL......DCN...-.-KDNE.....VDFQEYCVFLSCIA-.........---..........-----......
ENSBTAP00000053738  ..LGLL......GLR...-.-LSIT.....LNFREFRNLCEKRSF.........--S..........ADDDApqrlpr
ENSBTAP00000034009  ..FQDL......DAD...-.-KDGA.....VSFEEFVVLVSRVL-.........---..........-----......
ENSBTAP00000020539  ..VSSL......---...-.-TDNK.....LAYKSWLENLAKEKL.........SQQ..........--NIQssllet
ENSBTAP00000020778  ..IRDL......DQD...-.-GDKK.....LSLSEFISLPVGTVEnqqgqd...VDD..........SWVRD......
ENSBTAP00000017461  ..MSSV......DPN...-.--TSG.....IRLKEFLDIVRKKK-.........-EA..........QLYRN......
ENSBTAP00000044096  ..MEDL......DTN...-.-VDKQ.....LSFEEFIMLVARL--.........---..........-----......
ENSBTAP00000008523  ..MEDL......DTN...-.-VDKQ.....LSFEEFIMLVARL--.........---..........-----......
ENSBTAP00000035196  ..VRKH......ISD...G.VADGG.....LTLKGFLFLHTLFI-.........-QR..........-GRHEttwtvl
ENSBTAP00000041997  ..----......---...-.-----.....---------------.........---..........-----......
ENSBTAP00000025499  ..----......---...-.-----.....-DHKKFFQMVGLK--.........---..........KKSPE......
ENSBTAP00000055481  ..WALA......DMN...-.-NDGR.....MDQVEFSIAMKLI--.........---..........-----......
ENSBTAP00000002174  ..----......---...-.-----.....---------------.........---..........-----......
ENSBTAP00000000589  ..----......---...-.-----.....---------------.........---..........-----......
ENSBTAP00000028239  ..WKLS......DVD...-.-RDGM.....LDDEEFAL-------.........---..........-----......
ENSBTAP00000014894  ..MSVV......DPN...-.-HSGL.....VTFQAFIDFMSRET-.........-TD..........TDTAD......
ENSBTAP00000026544  ..MKIF......DKN...-.-KDGR.....LDLNDLARILALQENfllqfkmdaCSS..........EERKR......
ENSBTAP00000029333  ..WALA......DMN...-.-NDGR.....MDQVEFSIAMKLI--.........---..........-----......
ENSBTAP00000041966  ..VALM......DLK...-.-VNGR.....LDQEEFSRLWSRLV-.........---..........-----......
ENSBTAP00000008933  ..----......---...-.-----.....---------------.........---..........-----......
ENSBTAP00000056088  ..FQDL......DAD...-.-KDGA.....VSFEEFVVLVSRVL-.........---..........-----......
ENSBTAP00000033794  ..FRAA......DKN...-.-QDNQ.....ICFEEFLYILGKLV-.........---..........-----......
ENSBTAP00000012786  ..MTLV......DPN...-.-GQGT.....VTFQSFIDFMTRET-.........-AD..........TDTAE......
ENSBTAP00000030018  ..MTMV......DPN...-.-AAGV.....VTFQAFIDFMTRET-.........-AE..........TDTAE......
ENSBTAP00000040233  ..LAQI......PLT...-.-SSGA.....VPYLVFLSRFGGIDL.........NIN..........VI--Krggene
ENSBTAP00000003365  ..WTS-......---...-.-QTAK.....LNFDDFCIILRK---.........-EK..........PTSKA......
ENSBTAP00000053176  ..----......---...-.-----.....IHLKDIVCYLSLL--.........-ER..........GRPED......
ENSBTAP00000024301  ..MSIV......DPN...-.-RLGV.....VTFQAFIDFMSRET-.........-AD..........TDTAD......
ENSBTAP00000022292  ..AGVA......DQT...-.-KDGL.....ISYQEFLAFESVLC-.........---..........-APDS......
ENSBTAP00000015611  ..MHIL......DRD...-.-HDRR.....LDFTEFLLMVFKL--.........---..........-----......
ENSBTAP00000012770  ..FQEC......LT-...-.-YDGE.....MDYKTYLDFVLAL--.........-EN..........RKEPA......
ENSBTAP00000000847  ..----......---...-.-----.....---------------.........---..........-----......
ENSBTAP00000053738  ..LAQI......PLT...-.-SSGA.....VPYLVFLSRFGGIDL.........NIN..........VI--Krggene
ENSBTAP00000054975  ..----......---...-.-----.....---------------.........---..........--SAS......
ENSBTAP00000046639  ..WLIL......NSS...-.-GNGR.....ADYGEFKRAIIGE--.........-MN..........EYRKS......
ENSBTAP00000052345  ..WDLA......DTD...-.-GKGI.....LNKQEFFVALRLVA-.........---..........-----......
ENSBTAP00000053164  ..FEYC......DVD...-.-KDGL.....INYLEFANFLTWK--.........-DK..........TPLKEyeekvl
ENSBTAP00000016774  ..FKEL......DIN...-.-QDGG.....INFEEFLVLVIKV--.........---..........-----......
ENSBTAP00000022630  ..FEEL......DKN...-.-GDGE.....VSFEEFQVLVK----.........---..........-----......
ENSBTAP00000010796  ..LRKL......RLH...-.-LTPY.....INWKYFLQNFSSYV-.........--E..........ETAVEwaekmp
ENSBTAP00000021909  ..VDKI......DAD...-.-KDGF.....VTEGELKSWIKHA--.........-QK..........KYIYD......
ENSBTAP00000033974  ..AKDV......DRV...-.-KKGF.....FNCSNLLALMGLYWE.........-KA..........QNQEG......
ENSBTAP00000006711  ..----......---...-.-----.....-----VVCYLSLL--.........-ES..........GRPQD......
ENSBTAP00000010796  ..WMRY......DSE...-.-GRGH.....ITYQEFLQKLGINYS.........---..........ADIHRpyaeey
ENSBTAP00000004912  ..SGVV......DQT...-.-KDGL.....ISFQEFVAFESVLC-.........---..........-APDA......
ENSBTAP00000005979  ..KMVV......SKNvvgG.VRDDQ.....LTLDGFLFLNTLFI-.........--Q..........RGRHEttwtil
ENSBTAP00000053738  ..LRKL......RLH...-.-LTPY.....INWKYFLQNFSSYV-.........--E..........ETAVEwaekmp
ENSBTAP00000053746  ..----......---...-.---DE.....INFEDFLTIMSYFRP.........IDT..........TMDEEqvqlcr
ENSBTAP00000023221  ..MNEV......DTN...-.-KDRL.....VTLDEFLK-------.........---..........-----......
ENSBTAP00000019429  ..IKEV......DED...-.-FDGK.....LSFREFLLIFHK---.........---..........-----......
ENSBTAP00000052019  ..LSLL......DRN...-.-RNEH.....VDFHEYLLMVFQL--.........---..........-----......
ENSBTAP00000042244  ..IKEV......DED...-.-FDSK.....LSFREFLLIFRKA--.........---..........-----......
ENSBTAP00000053738  ..MRIL......DPG...-.-CTGC.....VNVSRFIELIEESPK.........LHK..........IPAYKdtkmpl
ENSBTAP00000018877  ..----......---...-.-----.....---------------.........---..........-----......
ENSBTAP00000053019  ..LAVA......DNN...-.-KDSR.....ISFEEFVSLMQEL--.........-KS..........KDIS-......
ENSBTAP00000003073  ..MKNV......DTN...-.-QDRL.....VTLEEFL--------.........---..........-----......
ENSBTAP00000012886  ..LNEV......DLN...-.-KNGQ.....VELNEFLQLMSAIQ-.........---..........-----......
ENSBTAP00000044222  ..ISVL......DTN...-.-KDCQ.....VDFVEYMRLLACLC-.........---..........-----......
ENSBTAP00000028499  ..MKSL......DVN...-.-QDSE.....LKFSEYWRLI-----.........---..........-----......
ENSBTAP00000047378  ..HTLL......GNN...-.-QFAR.....VNFEEFKDGFIAVLS.........SQS..........GL--Assdeds
ENSBTAP00000009308  ..TENLmttg..DLD...-.-QDGK.....ISFDEFIKVFHGLK-.........---..........-----......
ENSBTAP00000017060  ..WDLA......DPE...-.-GKGY.....LDKQGFYVALRLVA-.........---..........-----......
ENSBTAP00000050406  ..IQKLmldg..DRN...-.-KDGK.....ISFDEFVYIFQEV--.........-KS..........SDIAK......
ENSBTAP00000031879  ..IQKLmldg..DRN...-.-KDGK.....ISFDEFVYIFQEV--.........-KS..........SDIAK......
ENSBTAP00000031854  ..FRAA......GGE...-.-RTGF.....VSAQSFITIWRKLL-.........-SN..........HHDDAskficl
ENSBTAP00000001250  ..FSLF......DEG...-.-GGGE.....VDLREYVVALSVVC-.........-RP..........ARTLD......
ENSBTAP00000026035  ..LRLL......DED...-.-DTGT.....VEFKEFLVLVFKV--.........---..........-----......
ENSBTAP00000011215  ..FRAA......GGE...-.-RTGF.....VSAQSFITIWRKLL-.........-SN..........HHDDAskficl
ENSBTAP00000002128  ..VTDT......ARN...-.-ENGM.....VKLDDFVSAVSKE--.........-QN..........LPEYD......
ENSBTAP00000053194  ..LDAV......DPE...-.-RKGY.....ISKDEYIDFLTDKES.........-EN..........IRSSD......
ENSBTAP00000056127  ..WKDY......DRD...-.-KDDK.....ISWEEYKQATYGYYL.........GNP..........TEFQDtsdhht
ENSBTAP00000033188  ..ADIF......DRD...-.-GDGY.....IDYYEFVAALH----.........---..........-----......
ENSBTAP00000053548  ..----......---...-.-----.....---------------.........---..........----S......
ENSBTAP00000011687  ..FNML......DWN...-.-AVGE.....IGFDQFYMLVCILLAqenh.....LEE..........QFIFR......
ENSBTAP00000007636  ..TTYFf.....GAD...-.-LKGK.....LTIKNFLEFQRKLQ-.........-HD..........VLKLEferhdp
ENSBTAP00000020950  ..FIEY......DKN...-.-SDGS.....VSWDEYNIQMYDRVIdf.......VEN..........TALDD......
ENSBTAP00000009115  ..LRCA......DID...-.-QDGK.....VNFSDFLKVL-----.........---..........-----......
ENSBTAP00000023873  ..YRGF......KNE...C.-PTGL.....VDEDTFKLIYSQFF-.........-PQ..........GDATT......
ENSBTAP00000054471  ..FDTL......DAD...-.-GNGF.....LTPEEFTTGFSHFF-.........---..........-----......
ENSBTAP00000039694  ..RYSI......PEE...-.---KG.....ITFDEFRSFFQFLN-.........---..........--NLE......
ENSBTAP00000025205  ..FDTL......DAD...-.-GNGF.....LTPEEFTTGFSHFF-.........---..........-----......
ENSBTAP00000047882  ..----......---...-.-----.....---------------.........---..........MSPQE......
ENSBTAP00000001368  ..FRNF......DVD...-.-GDGH.....ISQEEFQIIRGNF--.........---..........-----......
ENSBTAP00000029786  ..FQLL......DEN...-.-GDSL.....INFREFVSGLSAA--.........-CH..........GDLTE......
ENSBTAP00000028993  ..FQRL......DAD...-.-RDGA.....ITFQEFAR-------.........---..........-----......
ENSBTAP00000023678  ..----......---...-.-----.....-DLEALIDTIQKQL-.........-KD..........RPCRD......
ENSBTAP00000034710  ..LRQA......DLD...-.-GDGT.....VSFKDFLGVLTDSH-.........---..........-----......
ENSBTAP00000031823  ..WNTY......DTD...-.-RDGR.....VGWEELRNATYGHYE.........--P..........GEEFHdvedae
ENSBTAP00000038002  ..----......---...-.-----.....---------------.........-EG..........GRPED......
ENSBTAP00000021074  ..LNLL......NID...-.-SNGA.....ISFDEFVLAIFSFL-.........---..........-----......
ENSBTAP00000026544  ..KQQFmaph..NVS...-.-KDGC.....IQMKELAGMFLSEDE.........--NflllfrqetpLDSSV......
ENSBTAP00000007217  ..IHLAqmk...GLQ...-.-RSQI.....LPTEEYEEAMGTMQI.........---..........-----......
ENSBTAP00000029792  ..FRLL......DEN...-.-KDSL.....INFKEFVTGMSGM--.........-YH..........GDLTE......
ENSBTAP00000044088  ..IRFF......GKR...-.-GERK.....LHYKEFRRFMENLQ-.........-AE..........VQEMEflqfsk
ENSBTAP00000017319  ..LSEL......DEH...-.-TENK.....LDFEDFMVLLLSV--.........---..........-----......
ENSBTAP00000044100  ..FRNY......DHD...-.-HDGY.....ISQEDFESIAANF--.........---..........-----......
ENSBTAP00000033594  ..----......---...-.-----.....---------------.........---..........-----......
ENSBTAP00000026766  ..----......---...-.-----.....---------------.........--R..........G----......
ENSBTAP00000055894  ..ISEV......TGG...-.-VSDT.....ISYRDFVNMM-----.........---..........-----......
ENSBTAP00000015220  ..FEHM......DLN...-.-KDGE.....VPVEEFSTFIKAQVSegkgrl...LPG..........QDPEK......
ENSBTAP00000033613  ..FEEI......DKD...-.-GDGE.....VLLEEFSEYIHAQVAsgkgkl...APG..........FDAEM......
ENSBTAP00000056320  ..FSGAvtrgk.KVQ...-.-KEGK.....ISYADFVWFLISE--.........-ED..........KKTPT......
ENSBTAP00000025249  ..----......---...-.-----.....---------------.........---..........-----......
ENSBTAP00000029159  ..FKNY......DHD...-.-QDGY.....ISQEEFEKIAASFP-.........---..........-----......
ENSBTAP00000044088  vyWKNV......REK...L.SAGEN.....ISLEEFKSFCHFAT-.........---..........--HLE......
ENSBTAP00000016319  ..MELC......GAT...-.-RLGY.....FGRSQFYIALKLVA-.........---..........-----......
ENSBTAP00000017662  ..LRSA......DID...-.-GDGH.....VNFKDFLTVMTDT--.........---..........-----......
ENSBTAP00000012479  ..CQRF......SRG...S.-SPEM.....VNYEKLLWFLKVA--.........-AS..........EDTEQnkgved
ENSBTAP00000029886  ..FKNF......DN-...-.-GDSR.....LDSSEFLKFVEQNE-.........---..........-----......
ENSBTAP00000027388  ..IMEV......SSG...-.-PGET.....FSYSDFLKMM-----.........---..........-----......
ENSBTAP00000039694  ..FRN-......-LK...-.-EKGV.....ISYTEYLFLLCILT-.........---..........-KPHA......
ENSBTAP00000023673  ..----......---...-.-----.....---------------.........---..........-----......
ENSBTAP00000041488  ..----......---...-.-----.....---------------.........---..........-----......
ENSBTAP00000001452  ..FKKN......DHD...-.-GDGF.....ISSKEY---------.........---..........-----......
ENSBTAP00000028498  ..IANL......GNC...-.-NDSK.....LEFGSFWEL------.........---..........-----......
ENSBTAP00000001426  ..----......---...-.-----.....---------------.........---..........-----......
ENSBTAP00000020240  ..----......---...-.-----.....---------------.........---..........-----......
ENSBTAP00000053650  ..----......---...-.-----.....---------------.........---..........-----......
ENSBTAP00000041651  ..----......---...-.-----.....---------------.........---..........-SREQ......
ENSBTAP00000005154  ..FSGV......DGH...-.-PADN.....LETEKLCDYFSEH--.........---..........-----......
ENSBTAP00000021174  ..----......---...-.-----.....---------------.........---..........----K......
ENSBTAP00000022068  ..TRYL......DPS...-.-GLGV.....ISFEDFYRGIEAI--.........---..........-----......
ENSBTAP00000026682  ..----......---...-.-----.....---------------.........---..........KNTVD......
ENSBTAP00000007636  ..QKQL......KKH...F.KEGKG.....LTFQEVENFFTFL--.........-KN..........INDVD......
ENSBTAP00000027954  ..----......---...-.-----.....---------------.........---..........-----......
ENSBTAP00000020778  ..----......DLN...-.-TDRR.....ISAKEMQKWIMQKTA.........EHF..........QEAVA......
ENSBTAP00000013601  ..----......---...-.-----.....---------------.........-SS..........GLPRE......
ENSBTAP00000005477  ..FNEIrfseyvDTG...K.-LTDK.....INLPDFFKVYLNHRP.........-PF..........GNTMS......
ENSBTAP00000055305  ..----......---...-.-----.....---------------.........---..........-----......
ENSBTAP00000036054  ..----......---...-.-----.....---------------.........---..........-----......
ENSBTAP00000004912  ..VAAA......GGT...-.-TSHQ.....VSFSYFNGFNSLLN-.........---..........--NME......
ENSBTAP00000022292  ..----......---...-.-RKKH.....LNYTEFTQFLQELQ-.........---..........---LE......
ENSBTAP00000002717  ..FLEI......GA-...-.-HKDE.....LSFEQFHLFYKKLMF.........EQQ..........KSILD......
ENSBTAP00000036015  ..EEHF......RDD...-.-DDGP.....VSSQGYMPYLNKYI-.........-LD..........KVE--......
ENSBTAP00000051638  ..FRLL......DEN...-.-SDCL.....INFKEFSSAIDIM--.........-YN..........GSFTE......
ENSBTAP00000026766  ..----......---...-.-----.....-HFNNLIVGLVLL--.........-TR..........GRDEE......
ENSBTAP00000053738  ..----......---...-.-----.....---------------.........---..........-DHDQ......
ENSBTAP00000016306  ..----......---...-.-----.....-----------VE--.........---..........--EDS......
ENSBTAP00000013714  ..KNKL......DPE...-.-GLGI.....ILLGPFL--------.........---..........-----......
ENSBTAP00000036550  ..FRLL......DEN...-.-MDHL.....IEFKAFVSCLDIM--.........-YN..........GEMNE......
ENSBTAP00000053738  ..----......---...-.-----.....---------------.........---..........--QDP......
ENSBTAP00000023383  ..LTDL......EQ-...-.-RTSD.....ITYGQFAQLYRSLMY.........---..........-----......
ENSBTAP00000027030  ..FHNL......DPD...-.---GM.....MSVEDFFYGLFKN--.........-GK..........PLTPSastpyr
ENSBTAP00000053270  ..FHNL......DPD...-.---GM.....MSVEDFFYGLFKN--.........-GK..........PLTPSastpyr
ENSBTAP00000054640  ..FHNL......DPD...-.---GM.....MSVEDFFYGLFKN--.........-GK..........PLTPSastpyr
ENSBTAP00000012770  ..FAKLl.....HTD...-.-SYGR.....ISIMQFFNYVMRKV-.........---..........--WLH......
ENSBTAP00000009967  ..ASLL......VT-...-.-NSES.....VDWRKFLLVVALP--.........-WP..........IPLEE......
ENSBTAP00000015183  ..FDKV......DVA...-.-QEGF.....INWDKLTSFLLLT--.........---..........-----......
ENSBTAP00000014222  ..LQA-......---...-.-GEQE.....IQFEDFTNTLRELE-.........-HT..........EHETT......
ENSBTAP00000026288  ..----......---...-.-----.....---------------.........---..........--HET......
ENSBTAP00000002128  ..----......---...-.-----.....--------CLKIF--.........-LY..........ILYFA......
ENSBTAP00000003365  ..----......---...-.-----.....---------------.........---..........-----......
ENSBTAP00000053738  ..MKRF......GLK...-.-TTTK.....VNWKQFLT-------.........---..........-----......
ENSBTAP00000009228  ..----......---...-.-----.....---------------.........---..........-----......
ENSBTAP00000026785  ..----......---...-.----V.....ISVSELINAMKQI--.........--K..........HIPES......
ENSBTAP00000002578  ..EEHF......RDD...-.-DEGP.....VSNQGYMPYLNKFIL.........EKV..........QDNFDkiefnr
ENSBTAP00000000106  ..LREF......DSD...-.-GDGR.....YSFLELRA-------.........---..........-----......
ENSBTAP00000028840  ..VVYL......SSL...G.-KHNS.....ITMDN----------.........---..........-----......
ENSBTAP00000053594  ..----......---...-.----S.....VTLEQFGELLEAR--.........-GA..........GFSGE......
ENSBTAP00000055414  ..----......---...-.-----.....---------------.........---..........----Tdmrrqm
ENSBTAP00000026698  ..FSYF......QQD...-.-ADGL.....VDFRDVALALAALS-.........-GG..........RSLEE......
ENSBTAP00000017015  ..FAAL......DPE...-.-HRGH.....VEWPDFLSHES----.........---..........-----......
ENSBTAP00000049908  ..----......---...-.-----.....---------------.........---..........-----......
ENSBTAP00000021395  ..RQQV......QVD...-.-TKGT.....VSFGDFVHVAR----.........---..........-----......
ENSBTAP00000007194  ..----......---...-.-----.....---------------.........---..........---PV......
ENSBTAP00000025455  ..----......---...-.-----.....---------------.........---..........-----......


                                                                                                    
                                                                                                    
d1br1b_               ..............................................................................
ENSBTAP00000019411  ..............................................................................
ENSBTAP00000036057  ..............................................................................
ENSBTAP00000038404  ..............................................................................
ENSBTAP00000010971  ..............................................................................
ENSBTAP00000019803  ..............................................................................
ENSBTAP00000014038  ..............................................................................
ENSBTAP00000002055  ..............................................................................
ENSBTAP00000049731  ..............................................................................
ENSBTAP00000005577  ..............................................................................
ENSBTAP00000034949  ..............................................................................
ENSBTAP00000017447  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000046644  ..............................................................................
ENSBTAP00000022814  ..............................................................................
ENSBTAP00000019758  ..............................................................................
ENSBTAP00000019321  ..............................................................................
ENSBTAP00000011677  ..............................................................................
ENSBTAP00000011680  ..............................................................................
ENSBTAP00000021742  ..............................................................................
ENSBTAP00000005348  ..............................................................................
ENSBTAP00000016609  ..............................................................................
ENSBTAP00000012740  plcvdm........................................................................
ENSBTAP00000018403  ..............................................................................
ENSBTAP00000026407  ..............................................................................
ENSBTAP00000052557  ..............................................................................
ENSBTAP00000054167  ..............................................................................
ENSBTAP00000010319  ..............................................................................
ENSBTAP00000041545  ..............................................................................
ENSBTAP00000055204  ..............................................................................
ENSBTAP00000003718  ..............................................................................
ENSBTAP00000011676  ..............................................................................
ENSBTAP00000049395  ..............................................................................
ENSBTAP00000054983  ..............................................................................
ENSBTAP00000052219  ..............................................................................
ENSBTAP00000025402  ..............................................................................
ENSBTAP00000011678  ..............................................................................
ENSBTAP00000000433  ..............................................................................
ENSBTAP00000021491  ..............................................................................
ENSBTAP00000044733  ..............................................................................
ENSBTAP00000010937  ..............................................................................
ENSBTAP00000056439  ..............................................................................
ENSBTAP00000055780  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000034705  ..............................................................................
ENSBTAP00000035936  ..............................................................................
ENSBTAP00000013699  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000011496  ..............................................................................
ENSBTAP00000019111  ..............................................................................
ENSBTAP00000017036  ..............................................................................
ENSBTAP00000003213  ..............................................................................
ENSBTAP00000055444  ..............................................................................
ENSBTAP00000024550  ..............................................................................
ENSBTAP00000015248  ..............................................................................
ENSBTAP00000021328  ..............................................................................
ENSBTAP00000037091  ..............................................................................
ENSBTAP00000029967  ..............................................................................
ENSBTAP00000021449  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000042361  ..............................................................................
ENSBTAP00000016509  ..............................................................................
ENSBTAP00000026714  ..............................................................................
ENSBTAP00000004690  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000013117  ..............................................................................
ENSBTAP00000017574  ..............................................................................
ENSBTAP00000004885  ..............................................................................
ENSBTAP00000008961  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000006283  ..............................................................................
ENSBTAP00000014306  ..............................................................................
ENSBTAP00000053252  ..............................................................................
ENSBTAP00000014304  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000041264  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000017358  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000055296  ..............................................................................
ENSBTAP00000016852  ..............................................................................
ENSBTAP00000036380  ..............................................................................
ENSBTAP00000041719  ..............................................................................
ENSBTAP00000049636  ..............................................................................
ENSBTAP00000024444  ..............................................................................
ENSBTAP00000004556  ..............................................................................
ENSBTAP00000038767  peplnsrsn.....................................................................
ENSBTAP00000031285  ..............................................................................
ENSBTAP00000011457  ..............................................................................
ENSBTAP00000011047  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000037104  ..............................................................................
ENSBTAP00000002672  ..............................................................................
ENSBTAP00000028269  ..............................................................................
ENSBTAP00000016647  kepeplnsrmn...................................................................
ENSBTAP00000004536  ..............................................................................
ENSBTAP00000042177  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000050283  ..............................................................................
ENSBTAP00000048539  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000007972  ..............................................................................
ENSBTAP00000040815  ..............................................................................
ENSBTAP00000025661  ..............................................................................
ENSBTAP00000028350  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000021537  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000039155  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000016315  ..............................................................................
ENSBTAP00000021091  ..............................................................................
ENSBTAP00000021618  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000034078  ..............................................................................
ENSBTAP00000006645  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000015802  ..............................................................................
ENSBTAP00000032680  ..............................................................................
ENSBTAP00000055007  ..............................................................................
ENSBTAP00000020148  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000012557  etvyryrs......................................................................
ENSBTAP00000011888  egqrerpvsv....................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000021603  ..............................................................................
ENSBTAP00000010838  ..............................................................................
ENSBTAP00000014575  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000053698  ..............................................................................
ENSBTAP00000006806  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000044105  ..............................................................................
ENSBTAP00000026904  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000044226  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000042182  ..............................................................................
ENSBTAP00000010796  ankmkeagaetcsfysallriqpkivhcwr................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000006275  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000053738  ankmkeagaetcsfysallriqpkivhcwr................................................
ENSBTAP00000004963  ..............................................................................
ENSBTAP00000023774  ..............................................................................
ENSBTAP00000020395  ..............................................................................
ENSBTAP00000020150  ..............................................................................
ENSBTAP00000025561  ..............................................................................
ENSBTAP00000053738  pkqkvadselaceqahqylvtkaktrws..................................................
ENSBTAP00000034009  ..............................................................................
ENSBTAP00000020539  lyrnrs........................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000017461  ..............................................................................
ENSBTAP00000044096  ..............................................................................
ENSBTAP00000008523  ..............................................................................
ENSBTAP00000035196  rrfgydddldltpeylfpllkippdcttelnhhayl..........................................
ENSBTAP00000041997  ..............................................................................
ENSBTAP00000025499  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000002174  ..............................................................................
ENSBTAP00000000589  ..............................................................................
ENSBTAP00000028239  ..............................................................................
ENSBTAP00000014894  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000041966  ..............................................................................
ENSBTAP00000008933  ..............................................................................
ENSBTAP00000056088  ..............................................................................
ENSBTAP00000033794  ..............................................................................
ENSBTAP00000012786  ..............................................................................
ENSBTAP00000030018  ..............................................................................
ENSBTAP00000040233  mngcrtlkdleaqvgekifknik.......................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000024301  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000015611  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000000847  ..............................................................................
ENSBTAP00000053738  mngcrtlkdleaqvgekifknik.......................................................
ENSBTAP00000054975  ..............................................................................
ENSBTAP00000046639  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000053164  ikgrkadcanpaeanveesepalllkpedivlkepgssektlrtllrpsdkvsnhykttsseisavvgavpstcypty
ENSBTAP00000016774  ..............................................................................
ENSBTAP00000022630  ..............................................................................
ENSBTAP00000010796  rgprplspkemanqellarlhkavtshyh.................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000033974  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000010796  fnfmghftkpqqvqeelkelqqstekampardklkdhdq.......................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000005979  rrfgygdsleltadylcpplrvppgcsaelnhrgyq..........................................
ENSBTAP00000053738  rgprplspkemanqellarlhkavtshyh.................................................
ENSBTAP00000053746  ke............................................................................
ENSBTAP00000023221  ..............................................................................
ENSBTAP00000019429  ..............................................................................
ENSBTAP00000052019  ..............................................................................
ENSBTAP00000042244  ..............................................................................
ENSBTAP00000053738  flawdsveeiihdsiaknls..........................................................
ENSBTAP00000018877  ..............................................................................
ENSBTAP00000053019  ..............................................................................
ENSBTAP00000003073  ..............................................................................
ENSBTAP00000012886  ..............................................................................
ENSBTAP00000044222  ..............................................................................
ENSBTAP00000028499  ..............................................................................
ENSBTAP00000047378  gslesvasravppkyvsgskwygrrshpepcgaaggapglleqparpsarsklrrsaslesveslksdeeadsakepq
ENSBTAP00000009308  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000050406  ..............................................................................
ENSBTAP00000031879  ..............................................................................
ENSBTAP00000031854  lakpscssleqddfipllqdvvdthpgltflkdapefhsryitt..................................
ENSBTAP00000001250  ..............................................................................
ENSBTAP00000026035  ..............................................................................
ENSBTAP00000011215  lakpscssleqddfipllqdvvdthpgltflkdapefhsryitt..................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000053194  ..............................................................................
ENSBTAP00000056127  fkkmlp........................................................................
ENSBTAP00000033188  ..............................................................................
ENSBTAP00000053548  ..............................................................................
ENSBTAP00000011687  ..............................................................................
ENSBTAP00000007636  vdgriterqfggmllaysgvqskkltamqkqlkkhfkegkgltfqevenfftflknin....................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000009115  ..............................................................................
ENSBTAP00000023873  ..............................................................................
ENSBTAP00000054471  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000025205  ..............................................................................
ENSBTAP00000047882  ..............................................................................
ENSBTAP00000001368  ..............................................................................
ENSBTAP00000029786  ..............................................................................
ENSBTAP00000028993  ..............................................................................
ENSBTAP00000023678  ..............................................................................
ENSBTAP00000034710  ..............................................................................
ENSBTAP00000031823  tykkmla.......................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000021074  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000007217  ..............................................................................
ENSBTAP00000029792  ..............................................................................
ENSBTAP00000044088  glsfmrkedfaewllfftdtenkdvywknvreklsagenisleefksfchfathle......................
ENSBTAP00000017319  ..............................................................................
ENSBTAP00000044100  ..............................................................................
ENSBTAP00000033594  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000055894  ..............................................................................
ENSBTAP00000015220  ..............................................................................
ENSBTAP00000033613  ..............................................................................
ENSBTAP00000056320  ..............................................................................
ENSBTAP00000025249  ..............................................................................
ENSBTAP00000029159  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000017662  ..............................................................................
ENSBTAP00000012479  snvketqssshqssiapqdynsqsevnesllevlkmalratkaklnie..............................
ENSBTAP00000029886  ..............................................................................
ENSBTAP00000027388  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000023673  ..............................................................................
ENSBTAP00000041488  ..............................................................................
ENSBTAP00000001452  ..............................................................................
ENSBTAP00000028498  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000020240  ..............................................................................
ENSBTAP00000053650  ..............................................................................
ENSBTAP00000041651  ..............................................................................
ENSBTAP00000005154  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000022068  ..............................................................................
ENSBTAP00000026682  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000027954  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000013601  ..............................................................................
ENSBTAP00000005477  ..............................................................................
ENSBTAP00000055305  ..............................................................................
ENSBTAP00000036054  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000002717  ..............................................................................
ENSBTAP00000036015  ..............................................................................
ENSBTAP00000051638  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000016306  ..............................................................................
ENSBTAP00000013714  ..............................................................................
ENSBTAP00000036550  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000023383  ..............................................................................
ENSBTAP00000027030  qlkrhismqsfdesgrrttapsammst...................................................
ENSBTAP00000053270  qlkrhismqsfdesgrrttapsammst...................................................
ENSBTAP00000054640  qlkrhismqsfdesgrrttapsammst...................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000009967  ..............................................................................
ENSBTAP00000015183  ..............................................................................
ENSBTAP00000014222  ..............................................................................
ENSBTAP00000026288  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000009228  ..............................................................................
ENSBTAP00000026785  ..............................................................................
ENSBTAP00000002578  mcwtlcvkknltknplfiteedaf......................................................
ENSBTAP00000000106  ..............................................................................
ENSBTAP00000028840  ..............................................................................
ENSBTAP00000053594  ..............................................................................
ENSBTAP00000055414  fadlflhcdrgkvgfldrqrtlalletfydqsskvlrgtlrnprqwpfvefgeidlpefwgdmdnqkhiyedfdnvll
ENSBTAP00000026698  ..............................................................................
ENSBTAP00000017015  ..............................................................................
ENSBTAP00000049908  ..............................................................................
ENSBTAP00000021395  ..............................................................................
ENSBTAP00000007194  ..............................................................................
ENSBTAP00000025455  ..............................................................................


                                                                                                    
                                                                                                    
d1br1b_               ..............................................................................
ENSBTAP00000019411  ..............................................................................
ENSBTAP00000036057  ..............................................................................
ENSBTAP00000038404  ..............................................................................
ENSBTAP00000010971  ..............................................................................
ENSBTAP00000019803  ..............................................................................
ENSBTAP00000014038  ..............................................................................
ENSBTAP00000002055  ..............................................................................
ENSBTAP00000049731  ..............................................................................
ENSBTAP00000005577  ..............................................................................
ENSBTAP00000034949  ..............................................................................
ENSBTAP00000017447  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000046644  ..............................................................................
ENSBTAP00000022814  ..............................................................................
ENSBTAP00000019758  ..............................................................................
ENSBTAP00000019321  ..............................................................................
ENSBTAP00000011677  ..............................................................................
ENSBTAP00000011680  ..............................................................................
ENSBTAP00000021742  ..............................................................................
ENSBTAP00000005348  ..............................................................................
ENSBTAP00000016609  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000018403  ..............................................................................
ENSBTAP00000026407  ..............................................................................
ENSBTAP00000052557  ..............................................................................
ENSBTAP00000054167  ..............................................................................
ENSBTAP00000010319  ..............................................................................
ENSBTAP00000041545  ..............................................................................
ENSBTAP00000055204  ..............................................................................
ENSBTAP00000003718  ..............................................................................
ENSBTAP00000011676  ..............................................................................
ENSBTAP00000049395  ..............................................................................
ENSBTAP00000054983  ..............................................................................
ENSBTAP00000052219  ..............................................................................
ENSBTAP00000025402  ..............................................................................
ENSBTAP00000011678  ..............................................................................
ENSBTAP00000000433  ..............................................................................
ENSBTAP00000021491  ..............................................................................
ENSBTAP00000044733  ..............................................................................
ENSBTAP00000010937  ..............................................................................
ENSBTAP00000056439  ..............................................................................
ENSBTAP00000055780  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000034705  ..............................................................................
ENSBTAP00000035936  ..............................................................................
ENSBTAP00000013699  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000011496  ..............................................................................
ENSBTAP00000019111  ..............................................................................
ENSBTAP00000017036  ..............................................................................
ENSBTAP00000003213  ..............................................................................
ENSBTAP00000055444  ..............................................................................
ENSBTAP00000024550  ..............................................................................
ENSBTAP00000015248  ..............................................................................
ENSBTAP00000021328  ..............................................................................
ENSBTAP00000037091  ..............................................................................
ENSBTAP00000029967  ..............................................................................
ENSBTAP00000021449  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000042361  ..............................................................................
ENSBTAP00000016509  ..............................................................................
ENSBTAP00000026714  ..............................................................................
ENSBTAP00000004690  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000013117  ..............................................................................
ENSBTAP00000017574  ..............................................................................
ENSBTAP00000004885  ..............................................................................
ENSBTAP00000008961  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000006283  ..............................................................................
ENSBTAP00000014306  ..............................................................................
ENSBTAP00000053252  ..............................................................................
ENSBTAP00000014304  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000041264  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000017358  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000055296  ..............................................................................
ENSBTAP00000016852  ..............................................................................
ENSBTAP00000036380  ..............................................................................
ENSBTAP00000041719  ..............................................................................
ENSBTAP00000049636  ..............................................................................
ENSBTAP00000024444  ..............................................................................
ENSBTAP00000004556  ..............................................................................
ENSBTAP00000038767  ..............................................................................
ENSBTAP00000031285  ..............................................................................
ENSBTAP00000011457  ..............................................................................
ENSBTAP00000011047  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000037104  ..............................................................................
ENSBTAP00000002672  ..............................................................................
ENSBTAP00000028269  ..............................................................................
ENSBTAP00000016647  ..............................................................................
ENSBTAP00000004536  ..............................................................................
ENSBTAP00000042177  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000050283  ..............................................................................
ENSBTAP00000048539  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000007972  ..............................................................................
ENSBTAP00000040815  ..............................................................................
ENSBTAP00000025661  ..............................................................................
ENSBTAP00000028350  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000021537  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000039155  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000016315  ..............................................................................
ENSBTAP00000021091  ..............................................................................
ENSBTAP00000021618  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000034078  ..............................................................................
ENSBTAP00000006645  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000015802  ..............................................................................
ENSBTAP00000032680  ..............................................................................
ENSBTAP00000055007  ..............................................................................
ENSBTAP00000020148  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000012557  ..............................................................................
ENSBTAP00000011888  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000021603  ..............................................................................
ENSBTAP00000010838  ..............................................................................
ENSBTAP00000014575  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000053698  ..............................................................................
ENSBTAP00000006806  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000044105  ..............................................................................
ENSBTAP00000026904  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000044226  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000042182  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000006275  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000004963  ..............................................................................
ENSBTAP00000023774  ..............................................................................
ENSBTAP00000020395  ..............................................................................
ENSBTAP00000020150  ..............................................................................
ENSBTAP00000025561  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000034009  ..............................................................................
ENSBTAP00000020539  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000017461  ..............................................................................
ENSBTAP00000044096  ..............................................................................
ENSBTAP00000008523  ..............................................................................
ENSBTAP00000035196  ..............................................................................
ENSBTAP00000041997  ..............................................................................
ENSBTAP00000025499  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000002174  ..............................................................................
ENSBTAP00000000589  ..............................................................................
ENSBTAP00000028239  ..............................................................................
ENSBTAP00000014894  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000041966  ..............................................................................
ENSBTAP00000008933  ..............................................................................
ENSBTAP00000056088  ..............................................................................
ENSBTAP00000033794  ..............................................................................
ENSBTAP00000012786  ..............................................................................
ENSBTAP00000030018  ..............................................................................
ENSBTAP00000040233  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000024301  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000015611  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000000847  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000054975  ..............................................................................
ENSBTAP00000046639  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000053164  gvptirsdipaplirrvsdrtsygeegnaysllhptifaqkgv...................................
ENSBTAP00000016774  ..............................................................................
ENSBTAP00000022630  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000033974  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000005979  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000053746  ..............................................................................
ENSBTAP00000023221  ..............................................................................
ENSBTAP00000019429  ..............................................................................
ENSBTAP00000052019  ..............................................................................
ENSBTAP00000042244  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000018877  ..............................................................................
ENSBTAP00000053019  ..............................................................................
ENSBTAP00000003073  ..............................................................................
ENSBTAP00000012886  ..............................................................................
ENSBTAP00000044222  ..............................................................................
ENSBTAP00000028499  ..............................................................................
ENSBTAP00000047378  nelfeaqgqlptwgsevfgsarkprshsfdtpet............................................
ENSBTAP00000009308  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000050406  ..............................................................................
ENSBTAP00000031879  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000001250  ..............................................................................
ENSBTAP00000026035  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000053194  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000033188  ..............................................................................
ENSBTAP00000053548  ..............................................................................
ENSBTAP00000011687  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000009115  ..............................................................................
ENSBTAP00000023873  ..............................................................................
ENSBTAP00000054471  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000025205  ..............................................................................
ENSBTAP00000047882  ..............................................................................
ENSBTAP00000001368  ..............................................................................
ENSBTAP00000029786  ..............................................................................
ENSBTAP00000028993  ..............................................................................
ENSBTAP00000023678  ..............................................................................
ENSBTAP00000034710  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000021074  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000007217  ..............................................................................
ENSBTAP00000029792  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000017319  ..............................................................................
ENSBTAP00000044100  ..............................................................................
ENSBTAP00000033594  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000055894  ..............................................................................
ENSBTAP00000015220  ..............................................................................
ENSBTAP00000033613  ..............................................................................
ENSBTAP00000056320  ..............................................................................
ENSBTAP00000025249  ..............................................................................
ENSBTAP00000029159  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000017662  ..............................................................................
ENSBTAP00000012479  ..............................................................................
ENSBTAP00000029886  ..............................................................................
ENSBTAP00000027388  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000023673  ..............................................................................
ENSBTAP00000041488  ..............................................................................
ENSBTAP00000001452  ..............................................................................
ENSBTAP00000028498  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000020240  ..............................................................................
ENSBTAP00000053650  ..............................................................................
ENSBTAP00000041651  ..............................................................................
ENSBTAP00000005154  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000022068  ..............................................................................
ENSBTAP00000026682  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000027954  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000013601  ..............................................................................
ENSBTAP00000005477  ..............................................................................
ENSBTAP00000055305  ..............................................................................
ENSBTAP00000036054  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000002717  ..............................................................................
ENSBTAP00000036015  ..............................................................................
ENSBTAP00000051638  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000016306  ..............................................................................
ENSBTAP00000013714  ..............................................................................
ENSBTAP00000036550  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000023383  ..............................................................................
ENSBTAP00000027030  ..............................................................................
ENSBTAP00000053270  ..............................................................................
ENSBTAP00000054640  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000009967  ..............................................................................
ENSBTAP00000015183  ..............................................................................
ENSBTAP00000014222  ..............................................................................
ENSBTAP00000026288  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000009228  ..............................................................................
ENSBTAP00000026785  ..............................................................................
ENSBTAP00000002578  ..............................................................................
ENSBTAP00000000106  ..............................................................................
ENSBTAP00000028840  ..............................................................................
ENSBTAP00000053594  ..............................................................................
ENSBTAP00000055414  emntlpsekhfsktqskllaspedqhehyrestlpqsppeqqrgatveqgpngistreqeqpeestgeqelneesvsk
ENSBTAP00000026698  ..............................................................................
ENSBTAP00000017015  ..............................................................................
ENSBTAP00000049908  ..............................................................................
ENSBTAP00000021395  ..............................................................................
ENSBTAP00000007194  ..............................................................................
ENSBTAP00000025455  ..............................................................................


                                                                                                    
                                                                                                    
d1br1b_               ..............................................................................
ENSBTAP00000019411  ..............................................................................
ENSBTAP00000036057  ..............................................................................
ENSBTAP00000038404  ..............................................................................
ENSBTAP00000010971  ..............................................................................
ENSBTAP00000019803  ..............................................................................
ENSBTAP00000014038  ..............................................................................
ENSBTAP00000002055  ..............................................................................
ENSBTAP00000049731  ..............................................................................
ENSBTAP00000005577  ..............................................................................
ENSBTAP00000034949  ..............................................................................
ENSBTAP00000017447  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000046644  ..............................................................................
ENSBTAP00000022814  ..............................................................................
ENSBTAP00000019758  ..............................................................................
ENSBTAP00000019321  ..............................................................................
ENSBTAP00000011677  ..............................................................................
ENSBTAP00000011680  ..............................................................................
ENSBTAP00000021742  ..............................................................................
ENSBTAP00000005348  ..............................................................................
ENSBTAP00000016609  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000018403  ..............................................................................
ENSBTAP00000026407  ..............................................................................
ENSBTAP00000052557  ..............................................................................
ENSBTAP00000054167  ..............................................................................
ENSBTAP00000010319  ..............................................................................
ENSBTAP00000041545  ..............................................................................
ENSBTAP00000055204  ..............................................................................
ENSBTAP00000003718  ..............................................................................
ENSBTAP00000011676  ..............................................................................
ENSBTAP00000049395  ..............................................................................
ENSBTAP00000054983  ..............................................................................
ENSBTAP00000052219  ..............................................................................
ENSBTAP00000025402  ..............................................................................
ENSBTAP00000011678  ..............................................................................
ENSBTAP00000000433  ..............................................................................
ENSBTAP00000021491  ..............................................................................
ENSBTAP00000044733  ..............................................................................
ENSBTAP00000010937  ..............................................................................
ENSBTAP00000056439  ..............................................................................
ENSBTAP00000055780  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000034705  ..............................................................................
ENSBTAP00000035936  ..............................................................................
ENSBTAP00000013699  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000011496  ..............................................................................
ENSBTAP00000019111  ..............................................................................
ENSBTAP00000017036  ..............................................................................
ENSBTAP00000003213  ..............................................................................
ENSBTAP00000055444  ..............................................................................
ENSBTAP00000024550  ..............................................................................
ENSBTAP00000015248  ..............................................................................
ENSBTAP00000021328  ..............................................................................
ENSBTAP00000037091  ..............................................................................
ENSBTAP00000029967  ..............................................................................
ENSBTAP00000021449  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000042361  ..............................................................................
ENSBTAP00000016509  ..............................................................................
ENSBTAP00000026714  ..............................................................................
ENSBTAP00000004690  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000013117  ..............................................................................
ENSBTAP00000017574  ..............................................................................
ENSBTAP00000004885  ..............................................................................
ENSBTAP00000008961  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000006283  ..............................................................................
ENSBTAP00000014306  ..............................................................................
ENSBTAP00000053252  ..............................................................................
ENSBTAP00000014304  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000041264  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000017358  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000055296  ..............................................................................
ENSBTAP00000016852  ..............................................................................
ENSBTAP00000036380  ..............................................................................
ENSBTAP00000041719  ..............................................................................
ENSBTAP00000049636  ..............................................................................
ENSBTAP00000024444  ..............................................................................
ENSBTAP00000004556  ..............................................................................
ENSBTAP00000038767  ..............................................................................
ENSBTAP00000031285  ..............................................................................
ENSBTAP00000011457  ..............................................................................
ENSBTAP00000011047  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000037104  ..............................................................................
ENSBTAP00000002672  ..............................................................................
ENSBTAP00000028269  ..............................................................................
ENSBTAP00000016647  ..............................................................................
ENSBTAP00000004536  ..............................................................................
ENSBTAP00000042177  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000050283  ..............................................................................
ENSBTAP00000048539  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000007972  ..............................................................................
ENSBTAP00000040815  ..............................................................................
ENSBTAP00000025661  ..............................................................................
ENSBTAP00000028350  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000021537  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000039155  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000016315  ..............................................................................
ENSBTAP00000021091  ..............................................................................
ENSBTAP00000021618  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000034078  ..............................................................................
ENSBTAP00000006645  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000015802  ..............................................................................
ENSBTAP00000032680  ..............................................................................
ENSBTAP00000055007  ..............................................................................
ENSBTAP00000020148  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000012557  ..............................................................................
ENSBTAP00000011888  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000021603  ..............................................................................
ENSBTAP00000010838  ..............................................................................
ENSBTAP00000014575  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000053698  ..............................................................................
ENSBTAP00000006806  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000044105  ..............................................................................
ENSBTAP00000026904  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000044226  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000042182  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000006275  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000004963  ..............................................................................
ENSBTAP00000023774  ..............................................................................
ENSBTAP00000020395  ..............................................................................
ENSBTAP00000020150  ..............................................................................
ENSBTAP00000025561  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000034009  ..............................................................................
ENSBTAP00000020539  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000017461  ..............................................................................
ENSBTAP00000044096  ..............................................................................
ENSBTAP00000008523  ..............................................................................
ENSBTAP00000035196  ..............................................................................
ENSBTAP00000041997  ..............................................................................
ENSBTAP00000025499  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000002174  ..............................................................................
ENSBTAP00000000589  ..............................................................................
ENSBTAP00000028239  ..............................................................................
ENSBTAP00000014894  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000041966  ..............................................................................
ENSBTAP00000008933  ..............................................................................
ENSBTAP00000056088  ..............................................................................
ENSBTAP00000033794  ..............................................................................
ENSBTAP00000012786  ..............................................................................
ENSBTAP00000030018  ..............................................................................
ENSBTAP00000040233  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000024301  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000015611  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000000847  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000054975  ..............................................................................
ENSBTAP00000046639  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000053164  ..............................................................................
ENSBTAP00000016774  ..............................................................................
ENSBTAP00000022630  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000033974  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000005979  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000053746  ..............................................................................
ENSBTAP00000023221  ..............................................................................
ENSBTAP00000019429  ..............................................................................
ENSBTAP00000052019  ..............................................................................
ENSBTAP00000042244  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000018877  ..............................................................................
ENSBTAP00000053019  ..............................................................................
ENSBTAP00000003073  ..............................................................................
ENSBTAP00000012886  ..............................................................................
ENSBTAP00000044222  ..............................................................................
ENSBTAP00000028499  ..............................................................................
ENSBTAP00000047378  ..............................................................................
ENSBTAP00000009308  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000050406  ..............................................................................
ENSBTAP00000031879  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000001250  ..............................................................................
ENSBTAP00000026035  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000053194  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000033188  ..............................................................................
ENSBTAP00000053548  ..............................................................................
ENSBTAP00000011687  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000009115  ..............................................................................
ENSBTAP00000023873  ..............................................................................
ENSBTAP00000054471  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000025205  ..............................................................................
ENSBTAP00000047882  ..............................................................................
ENSBTAP00000001368  ..............................................................................
ENSBTAP00000029786  ..............................................................................
ENSBTAP00000028993  ..............................................................................
ENSBTAP00000023678  ..............................................................................
ENSBTAP00000034710  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000021074  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000007217  ..............................................................................
ENSBTAP00000029792  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000017319  ..............................................................................
ENSBTAP00000044100  ..............................................................................
ENSBTAP00000033594  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000055894  ..............................................................................
ENSBTAP00000015220  ..............................................................................
ENSBTAP00000033613  ..............................................................................
ENSBTAP00000056320  ..............................................................................
ENSBTAP00000025249  ..............................................................................
ENSBTAP00000029159  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000017662  ..............................................................................
ENSBTAP00000012479  ..............................................................................
ENSBTAP00000029886  ..............................................................................
ENSBTAP00000027388  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000023673  ..............................................................................
ENSBTAP00000041488  ..............................................................................
ENSBTAP00000001452  ..............................................................................
ENSBTAP00000028498  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000020240  ..............................................................................
ENSBTAP00000053650  ..............................................................................
ENSBTAP00000041651  ..............................................................................
ENSBTAP00000005154  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000022068  ..............................................................................
ENSBTAP00000026682  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000027954  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000013601  ..............................................................................
ENSBTAP00000005477  ..............................................................................
ENSBTAP00000055305  ..............................................................................
ENSBTAP00000036054  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000002717  ..............................................................................
ENSBTAP00000036015  ..............................................................................
ENSBTAP00000051638  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000016306  ..............................................................................
ENSBTAP00000013714  ..............................................................................
ENSBTAP00000036550  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000023383  ..............................................................................
ENSBTAP00000027030  ..............................................................................
ENSBTAP00000053270  ..............................................................................
ENSBTAP00000054640  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000009967  ..............................................................................
ENSBTAP00000015183  ..............................................................................
ENSBTAP00000014222  ..............................................................................
ENSBTAP00000026288  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000009228  ..............................................................................
ENSBTAP00000026785  ..............................................................................
ENSBTAP00000002578  ..............................................................................
ENSBTAP00000000106  ..............................................................................
ENSBTAP00000028840  ..............................................................................
ENSBTAP00000053594  ..............................................................................
ENSBTAP00000055414  egtytgstpeqrssreliteqrphhepiteqgvpqgthiestaeqglseesittegqhegsttgqgshgksteeqgsr
ENSBTAP00000026698  ..............................................................................
ENSBTAP00000017015  ..............................................................................
ENSBTAP00000049908  ..............................................................................
ENSBTAP00000021395  ..............................................................................
ENSBTAP00000007194  ..............................................................................
ENSBTAP00000025455  ..............................................................................


                                                                                                    
                                                                                                    
d1br1b_               ..............................................................................
ENSBTAP00000019411  ..............................................................................
ENSBTAP00000036057  ..............................................................................
ENSBTAP00000038404  ..............................................................................
ENSBTAP00000010971  ..............................................................................
ENSBTAP00000019803  ..............................................................................
ENSBTAP00000014038  ..............................................................................
ENSBTAP00000002055  ..............................................................................
ENSBTAP00000049731  ..............................................................................
ENSBTAP00000005577  ..............................................................................
ENSBTAP00000034949  ..............................................................................
ENSBTAP00000017447  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000046644  ..............................................................................
ENSBTAP00000022814  ..............................................................................
ENSBTAP00000019758  ..............................................................................
ENSBTAP00000019321  ..............................................................................
ENSBTAP00000011677  ..............................................................................
ENSBTAP00000011680  ..............................................................................
ENSBTAP00000021742  ..............................................................................
ENSBTAP00000005348  ..............................................................................
ENSBTAP00000016609  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000018403  ..............................................................................
ENSBTAP00000026407  ..............................................................................
ENSBTAP00000052557  ..............................................................................
ENSBTAP00000054167  ..............................................................................
ENSBTAP00000010319  ..............................................................................
ENSBTAP00000041545  ..............................................................................
ENSBTAP00000055204  ..............................................................................
ENSBTAP00000003718  ..............................................................................
ENSBTAP00000011676  ..............................................................................
ENSBTAP00000049395  ..............................................................................
ENSBTAP00000054983  ..............................................................................
ENSBTAP00000052219  ..............................................................................
ENSBTAP00000025402  ..............................................................................
ENSBTAP00000011678  ..............................................................................
ENSBTAP00000000433  ..............................................................................
ENSBTAP00000021491  ..............................................................................
ENSBTAP00000044733  ..............................................................................
ENSBTAP00000010937  ..............................................................................
ENSBTAP00000056439  ..............................................................................
ENSBTAP00000055780  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000034705  ..............................................................................
ENSBTAP00000035936  ..............................................................................
ENSBTAP00000013699  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000011496  ..............................................................................
ENSBTAP00000019111  ..............................................................................
ENSBTAP00000017036  ..............................................................................
ENSBTAP00000003213  ..............................................................................
ENSBTAP00000055444  ..............................................................................
ENSBTAP00000024550  ..............................................................................
ENSBTAP00000015248  ..............................................................................
ENSBTAP00000021328  ..............................................................................
ENSBTAP00000037091  ..............................................................................
ENSBTAP00000029967  ..............................................................................
ENSBTAP00000021449  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000042361  ..............................................................................
ENSBTAP00000016509  ..............................................................................
ENSBTAP00000026714  ..............................................................................
ENSBTAP00000004690  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000013117  ..............................................................................
ENSBTAP00000017574  ..............................................................................
ENSBTAP00000004885  ..............................................................................
ENSBTAP00000008961  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000006283  ..............................................................................
ENSBTAP00000014306  ..............................................................................
ENSBTAP00000053252  ..............................................................................
ENSBTAP00000014304  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000041264  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000017358  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000055296  ..............................................................................
ENSBTAP00000016852  ..............................................................................
ENSBTAP00000036380  ..............................................................................
ENSBTAP00000041719  ..............................................................................
ENSBTAP00000049636  ..............................................................................
ENSBTAP00000024444  ..............................................................................
ENSBTAP00000004556  ..............................................................................
ENSBTAP00000038767  ..............................................................................
ENSBTAP00000031285  ..............................................................................
ENSBTAP00000011457  ..............................................................................
ENSBTAP00000011047  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000037104  ..............................................................................
ENSBTAP00000002672  ..............................................................................
ENSBTAP00000028269  ..............................................................................
ENSBTAP00000016647  ..............................................................................
ENSBTAP00000004536  ..............................................................................
ENSBTAP00000042177  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000050283  ..............................................................................
ENSBTAP00000048539  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000007972  ..............................................................................
ENSBTAP00000040815  ..............................................................................
ENSBTAP00000025661  ..............................................................................
ENSBTAP00000028350  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000021537  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000039155  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000016315  ..............................................................................
ENSBTAP00000021091  ..............................................................................
ENSBTAP00000021618  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000034078  ..............................................................................
ENSBTAP00000006645  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000015802  ..............................................................................
ENSBTAP00000032680  ..............................................................................
ENSBTAP00000055007  ..............................................................................
ENSBTAP00000020148  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000012557  ..............................................................................
ENSBTAP00000011888  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000021603  ..............................................................................
ENSBTAP00000010838  ..............................................................................
ENSBTAP00000014575  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000053698  ..............................................................................
ENSBTAP00000006806  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000044105  ..............................................................................
ENSBTAP00000026904  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000044226  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000042182  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000006275  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000004963  ..............................................................................
ENSBTAP00000023774  ..............................................................................
ENSBTAP00000020395  ..............................................................................
ENSBTAP00000020150  ..............................................................................
ENSBTAP00000025561  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000034009  ..............................................................................
ENSBTAP00000020539  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000017461  ..............................................................................
ENSBTAP00000044096  ..............................................................................
ENSBTAP00000008523  ..............................................................................
ENSBTAP00000035196  ..............................................................................
ENSBTAP00000041997  ..............................................................................
ENSBTAP00000025499  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000002174  ..............................................................................
ENSBTAP00000000589  ..............................................................................
ENSBTAP00000028239  ..............................................................................
ENSBTAP00000014894  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000041966  ..............................................................................
ENSBTAP00000008933  ..............................................................................
ENSBTAP00000056088  ..............................................................................
ENSBTAP00000033794  ..............................................................................
ENSBTAP00000012786  ..............................................................................
ENSBTAP00000030018  ..............................................................................
ENSBTAP00000040233  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000024301  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000015611  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000000847  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000054975  ..............................................................................
ENSBTAP00000046639  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000053164  ..............................................................................
ENSBTAP00000016774  ..............................................................................
ENSBTAP00000022630  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000033974  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000005979  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000053746  ..............................................................................
ENSBTAP00000023221  ..............................................................................
ENSBTAP00000019429  ..............................................................................
ENSBTAP00000052019  ..............................................................................
ENSBTAP00000042244  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000018877  ..............................................................................
ENSBTAP00000053019  ..............................................................................
ENSBTAP00000003073  ..............................................................................
ENSBTAP00000012886  ..............................................................................
ENSBTAP00000044222  ..............................................................................
ENSBTAP00000028499  ..............................................................................
ENSBTAP00000047378  ..............................................................................
ENSBTAP00000009308  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000050406  ..............................................................................
ENSBTAP00000031879  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000001250  ..............................................................................
ENSBTAP00000026035  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000053194  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000033188  ..............................................................................
ENSBTAP00000053548  ..............................................................................
ENSBTAP00000011687  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000009115  ..............................................................................
ENSBTAP00000023873  ..............................................................................
ENSBTAP00000054471  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000025205  ..............................................................................
ENSBTAP00000047882  ..............................................................................
ENSBTAP00000001368  ..............................................................................
ENSBTAP00000029786  ..............................................................................
ENSBTAP00000028993  ..............................................................................
ENSBTAP00000023678  ..............................................................................
ENSBTAP00000034710  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000021074  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000007217  ..............................................................................
ENSBTAP00000029792  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000017319  ..............................................................................
ENSBTAP00000044100  ..............................................................................
ENSBTAP00000033594  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000055894  ..............................................................................
ENSBTAP00000015220  ..............................................................................
ENSBTAP00000033613  ..............................................................................
ENSBTAP00000056320  ..............................................................................
ENSBTAP00000025249  ..............................................................................
ENSBTAP00000029159  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000017662  ..............................................................................
ENSBTAP00000012479  ..............................................................................
ENSBTAP00000029886  ..............................................................................
ENSBTAP00000027388  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000023673  ..............................................................................
ENSBTAP00000041488  ..............................................................................
ENSBTAP00000001452  ..............................................................................
ENSBTAP00000028498  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000020240  ..............................................................................
ENSBTAP00000053650  ..............................................................................
ENSBTAP00000041651  ..............................................................................
ENSBTAP00000005154  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000022068  ..............................................................................
ENSBTAP00000026682  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000027954  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000013601  ..............................................................................
ENSBTAP00000005477  ..............................................................................
ENSBTAP00000055305  ..............................................................................
ENSBTAP00000036054  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000002717  ..............................................................................
ENSBTAP00000036015  ..............................................................................
ENSBTAP00000051638  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000016306  ..............................................................................
ENSBTAP00000013714  ..............................................................................
ENSBTAP00000036550  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000023383  ..............................................................................
ENSBTAP00000027030  ..............................................................................
ENSBTAP00000053270  ..............................................................................
ENSBTAP00000054640  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000009967  ..............................................................................
ENSBTAP00000015183  ..............................................................................
ENSBTAP00000014222  ..............................................................................
ENSBTAP00000026288  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000009228  ..............................................................................
ENSBTAP00000026785  ..............................................................................
ENSBTAP00000002578  ..............................................................................
ENSBTAP00000000106  ..............................................................................
ENSBTAP00000028840  ..............................................................................
ENSBTAP00000053594  ..............................................................................
ENSBTAP00000055414  resqsdqgqpretmaeqeahresqsdqgphggetileeqqdtdltsqsrkgsltgesktsresisfehteippqegrt
ENSBTAP00000026698  ..............................................................................
ENSBTAP00000017015  ..............................................................................
ENSBTAP00000049908  ..............................................................................
ENSBTAP00000021395  ..............................................................................
ENSBTAP00000007194  ..............................................................................
ENSBTAP00000025455  ..............................................................................


                                                                                                    
                                                                                                    
d1br1b_               ..............................................................................
ENSBTAP00000019411  ..............................................................................
ENSBTAP00000036057  ..............................................................................
ENSBTAP00000038404  ..............................................................................
ENSBTAP00000010971  ..............................................................................
ENSBTAP00000019803  ..............................................................................
ENSBTAP00000014038  ..............................................................................
ENSBTAP00000002055  ..............................................................................
ENSBTAP00000049731  ..............................................................................
ENSBTAP00000005577  ..............................................................................
ENSBTAP00000034949  ..............................................................................
ENSBTAP00000017447  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000046644  ..............................................................................
ENSBTAP00000022814  ..............................................................................
ENSBTAP00000019758  ..............................................................................
ENSBTAP00000019321  ..............................................................................
ENSBTAP00000011677  ..............................................................................
ENSBTAP00000011680  ..............................................................................
ENSBTAP00000021742  ..............................................................................
ENSBTAP00000005348  ..............................................................................
ENSBTAP00000016609  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000018403  ..............................................................................
ENSBTAP00000026407  ..............................................................................
ENSBTAP00000052557  ..............................................................................
ENSBTAP00000054167  ..............................................................................
ENSBTAP00000010319  ..............................................................................
ENSBTAP00000041545  ..............................................................................
ENSBTAP00000055204  ..............................................................................
ENSBTAP00000003718  ..............................................................................
ENSBTAP00000011676  ..............................................................................
ENSBTAP00000049395  ..............................................................................
ENSBTAP00000054983  ..............................................................................
ENSBTAP00000052219  ..............................................................................
ENSBTAP00000025402  ..............................................................................
ENSBTAP00000011678  ..............................................................................
ENSBTAP00000000433  ..............................................................................
ENSBTAP00000021491  ..............................................................................
ENSBTAP00000044733  ..............................................................................
ENSBTAP00000010937  ..............................................................................
ENSBTAP00000056439  ..............................................................................
ENSBTAP00000055780  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000034705  ..............................................................................
ENSBTAP00000035936  ..............................................................................
ENSBTAP00000013699  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000011496  ..............................................................................
ENSBTAP00000019111  ..............................................................................
ENSBTAP00000017036  ..............................................................................
ENSBTAP00000003213  ..............................................................................
ENSBTAP00000055444  ..............................................................................
ENSBTAP00000024550  ..............................................................................
ENSBTAP00000015248  ..............................................................................
ENSBTAP00000021328  ..............................................................................
ENSBTAP00000037091  ..............................................................................
ENSBTAP00000029967  ..............................................................................
ENSBTAP00000021449  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000042361  ..............................................................................
ENSBTAP00000016509  ..............................................................................
ENSBTAP00000026714  ..............................................................................
ENSBTAP00000004690  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000013117  ..............................................................................
ENSBTAP00000017574  ..............................................................................
ENSBTAP00000004885  ..............................................................................
ENSBTAP00000008961  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000006283  ..............................................................................
ENSBTAP00000014306  ..............................................................................
ENSBTAP00000053252  ..............................................................................
ENSBTAP00000014304  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000041264  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000017358  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000055296  ..............................................................................
ENSBTAP00000016852  ..............................................................................
ENSBTAP00000036380  ..............................................................................
ENSBTAP00000041719  ..............................................................................
ENSBTAP00000049636  ..............................................................................
ENSBTAP00000024444  ..............................................................................
ENSBTAP00000004556  ..............................................................................
ENSBTAP00000038767  ..............................................................................
ENSBTAP00000031285  ..............................................................................
ENSBTAP00000011457  ..............................................................................
ENSBTAP00000011047  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000037104  ..............................................................................
ENSBTAP00000002672  ..............................................................................
ENSBTAP00000028269  ..............................................................................
ENSBTAP00000016647  ..............................................................................
ENSBTAP00000004536  ..............................................................................
ENSBTAP00000042177  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000050283  ..............................................................................
ENSBTAP00000048539  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000007972  ..............................................................................
ENSBTAP00000040815  ..............................................................................
ENSBTAP00000025661  ..............................................................................
ENSBTAP00000028350  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000021537  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000039155  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000016315  ..............................................................................
ENSBTAP00000021091  ..............................................................................
ENSBTAP00000021618  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000034078  ..............................................................................
ENSBTAP00000006645  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000015802  ..............................................................................
ENSBTAP00000032680  ..............................................................................
ENSBTAP00000055007  ..............................................................................
ENSBTAP00000020148  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000012557  ..............................................................................
ENSBTAP00000011888  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000021603  ..............................................................................
ENSBTAP00000010838  ..............................................................................
ENSBTAP00000014575  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000053698  ..............................................................................
ENSBTAP00000006806  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000044105  ..............................................................................
ENSBTAP00000026904  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000044226  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000042182  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000006275  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000004963  ..............................................................................
ENSBTAP00000023774  ..............................................................................
ENSBTAP00000020395  ..............................................................................
ENSBTAP00000020150  ..............................................................................
ENSBTAP00000025561  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000034009  ..............................................................................
ENSBTAP00000020539  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000017461  ..............................................................................
ENSBTAP00000044096  ..............................................................................
ENSBTAP00000008523  ..............................................................................
ENSBTAP00000035196  ..............................................................................
ENSBTAP00000041997  ..............................................................................
ENSBTAP00000025499  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000002174  ..............................................................................
ENSBTAP00000000589  ..............................................................................
ENSBTAP00000028239  ..............................................................................
ENSBTAP00000014894  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000041966  ..............................................................................
ENSBTAP00000008933  ..............................................................................
ENSBTAP00000056088  ..............................................................................
ENSBTAP00000033794  ..............................................................................
ENSBTAP00000012786  ..............................................................................
ENSBTAP00000030018  ..............................................................................
ENSBTAP00000040233  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000024301  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000015611  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000000847  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000054975  ..............................................................................
ENSBTAP00000046639  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000053164  ..............................................................................
ENSBTAP00000016774  ..............................................................................
ENSBTAP00000022630  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000033974  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000005979  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000053746  ..............................................................................
ENSBTAP00000023221  ..............................................................................
ENSBTAP00000019429  ..............................................................................
ENSBTAP00000052019  ..............................................................................
ENSBTAP00000042244  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000018877  ..............................................................................
ENSBTAP00000053019  ..............................................................................
ENSBTAP00000003073  ..............................................................................
ENSBTAP00000012886  ..............................................................................
ENSBTAP00000044222  ..............................................................................
ENSBTAP00000028499  ..............................................................................
ENSBTAP00000047378  ..............................................................................
ENSBTAP00000009308  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000050406  ..............................................................................
ENSBTAP00000031879  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000001250  ..............................................................................
ENSBTAP00000026035  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000053194  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000033188  ..............................................................................
ENSBTAP00000053548  ..............................................................................
ENSBTAP00000011687  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000009115  ..............................................................................
ENSBTAP00000023873  ..............................................................................
ENSBTAP00000054471  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000025205  ..............................................................................
ENSBTAP00000047882  ..............................................................................
ENSBTAP00000001368  ..............................................................................
ENSBTAP00000029786  ..............................................................................
ENSBTAP00000028993  ..............................................................................
ENSBTAP00000023678  ..............................................................................
ENSBTAP00000034710  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000021074  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000007217  ..............................................................................
ENSBTAP00000029792  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000017319  ..............................................................................
ENSBTAP00000044100  ..............................................................................
ENSBTAP00000033594  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000055894  ..............................................................................
ENSBTAP00000015220  ..............................................................................
ENSBTAP00000033613  ..............................................................................
ENSBTAP00000056320  ..............................................................................
ENSBTAP00000025249  ..............................................................................
ENSBTAP00000029159  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000017662  ..............................................................................
ENSBTAP00000012479  ..............................................................................
ENSBTAP00000029886  ..............................................................................
ENSBTAP00000027388  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000023673  ..............................................................................
ENSBTAP00000041488  ..............................................................................
ENSBTAP00000001452  ..............................................................................
ENSBTAP00000028498  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000020240  ..............................................................................
ENSBTAP00000053650  ..............................................................................
ENSBTAP00000041651  ..............................................................................
ENSBTAP00000005154  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000022068  ..............................................................................
ENSBTAP00000026682  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000027954  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000013601  ..............................................................................
ENSBTAP00000005477  ..............................................................................
ENSBTAP00000055305  ..............................................................................
ENSBTAP00000036054  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000002717  ..............................................................................
ENSBTAP00000036015  ..............................................................................
ENSBTAP00000051638  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000016306  ..............................................................................
ENSBTAP00000013714  ..............................................................................
ENSBTAP00000036550  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000023383  ..............................................................................
ENSBTAP00000027030  ..............................................................................
ENSBTAP00000053270  ..............................................................................
ENSBTAP00000054640  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000009967  ..............................................................................
ENSBTAP00000015183  ..............................................................................
ENSBTAP00000014222  ..............................................................................
ENSBTAP00000026288  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000009228  ..............................................................................
ENSBTAP00000026785  ..............................................................................
ENSBTAP00000002578  ..............................................................................
ENSBTAP00000000106  ..............................................................................
ENSBTAP00000028840  ..............................................................................
ENSBTAP00000053594  ..............................................................................
ENSBTAP00000055414  qahayeellfvspelqaktgvsipedhlsepakkevqkdkscepksqkiegkswtgelltcnwnmkyakhedeeqahl
ENSBTAP00000026698  ..............................................................................
ENSBTAP00000017015  ..............................................................................
ENSBTAP00000049908  ..............................................................................
ENSBTAP00000021395  ..............................................................................
ENSBTAP00000007194  ..............................................................................
ENSBTAP00000025455  ..............................................................................


                                                                                                    
                                                                                                    
d1br1b_               ..............................................................................
ENSBTAP00000019411  ..............................................................................
ENSBTAP00000036057  ..............................................................................
ENSBTAP00000038404  ..............................................................................
ENSBTAP00000010971  ..............................................................................
ENSBTAP00000019803  ..............................................................................
ENSBTAP00000014038  ..............................................................................
ENSBTAP00000002055  ..............................................................................
ENSBTAP00000049731  ..............................................................................
ENSBTAP00000005577  ..............................................................................
ENSBTAP00000034949  ..............................................................................
ENSBTAP00000017447  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000046644  ..............................................................................
ENSBTAP00000022814  ..............................................................................
ENSBTAP00000019758  ..............................................................................
ENSBTAP00000019321  ..............................................................................
ENSBTAP00000011677  ..............................................................................
ENSBTAP00000011680  ..............................................................................
ENSBTAP00000021742  ..............................................................................
ENSBTAP00000005348  ..............................................................................
ENSBTAP00000016609  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000018403  ..............................................................................
ENSBTAP00000026407  ..............................................................................
ENSBTAP00000052557  ..............................................................................
ENSBTAP00000054167  ..............................................................................
ENSBTAP00000010319  ..............................................................................
ENSBTAP00000041545  ..............................................................................
ENSBTAP00000055204  ..............................................................................
ENSBTAP00000003718  ..............................................................................
ENSBTAP00000011676  ..............................................................................
ENSBTAP00000049395  ..............................................................................
ENSBTAP00000054983  ..............................................................................
ENSBTAP00000052219  ..............................................................................
ENSBTAP00000025402  ..............................................................................
ENSBTAP00000011678  ..............................................................................
ENSBTAP00000000433  ..............................................................................
ENSBTAP00000021491  ..............................................................................
ENSBTAP00000044733  ..............................................................................
ENSBTAP00000010937  ..............................................................................
ENSBTAP00000056439  ..............................................................................
ENSBTAP00000055780  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000034705  ..............................................................................
ENSBTAP00000035936  ..............................................................................
ENSBTAP00000013699  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000011496  ..............................................................................
ENSBTAP00000019111  ..............................................................................
ENSBTAP00000017036  ..............................................................................
ENSBTAP00000003213  ..............................................................................
ENSBTAP00000055444  ..............................................................................
ENSBTAP00000024550  ..............................................................................
ENSBTAP00000015248  ..............................................................................
ENSBTAP00000021328  ..............................................................................
ENSBTAP00000037091  ..............................................................................
ENSBTAP00000029967  ..............................................................................
ENSBTAP00000021449  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000042361  ..............................................................................
ENSBTAP00000016509  ..............................................................................
ENSBTAP00000026714  ..............................................................................
ENSBTAP00000004690  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000013117  ..............................................................................
ENSBTAP00000017574  ..............................................................................
ENSBTAP00000004885  ..............................................................................
ENSBTAP00000008961  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000006283  ..............................................................................
ENSBTAP00000014306  ..............................................................................
ENSBTAP00000053252  ..............................................................................
ENSBTAP00000014304  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000041264  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000017358  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000055296  ..............................................................................
ENSBTAP00000016852  ..............................................................................
ENSBTAP00000036380  ..............................................................................
ENSBTAP00000041719  ..............................................................................
ENSBTAP00000049636  ..............................................................................
ENSBTAP00000024444  ..............................................................................
ENSBTAP00000004556  ..............................................................................
ENSBTAP00000038767  ..............................................................................
ENSBTAP00000031285  ..............................................................................
ENSBTAP00000011457  ..............................................................................
ENSBTAP00000011047  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000037104  ..............................................................................
ENSBTAP00000002672  ..............................................................................
ENSBTAP00000028269  ..............................................................................
ENSBTAP00000016647  ..............................................................................
ENSBTAP00000004536  ..............................................................................
ENSBTAP00000042177  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000050283  ..............................................................................
ENSBTAP00000048539  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000007972  ..............................................................................
ENSBTAP00000040815  ..............................................................................
ENSBTAP00000025661  ..............................................................................
ENSBTAP00000028350  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000021537  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000039155  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000016315  ..............................................................................
ENSBTAP00000021091  ..............................................................................
ENSBTAP00000021618  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000034078  ..............................................................................
ENSBTAP00000006645  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000015802  ..............................................................................
ENSBTAP00000032680  ..............................................................................
ENSBTAP00000055007  ..............................................................................
ENSBTAP00000020148  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000012557  ..............................................................................
ENSBTAP00000011888  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000021603  ..............................................................................
ENSBTAP00000010838  ..............................................................................
ENSBTAP00000014575  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000053698  ..............................................................................
ENSBTAP00000006806  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000044105  ..............................................................................
ENSBTAP00000026904  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000044226  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000042182  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000006275  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000004963  ..............................................................................
ENSBTAP00000023774  ..............................................................................
ENSBTAP00000020395  ..............................................................................
ENSBTAP00000020150  ..............................................................................
ENSBTAP00000025561  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000034009  ..............................................................................
ENSBTAP00000020539  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000017461  ..............................................................................
ENSBTAP00000044096  ..............................................................................
ENSBTAP00000008523  ..............................................................................
ENSBTAP00000035196  ..............................................................................
ENSBTAP00000041997  ..............................................................................
ENSBTAP00000025499  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000002174  ..............................................................................
ENSBTAP00000000589  ..............................................................................
ENSBTAP00000028239  ..............................................................................
ENSBTAP00000014894  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000041966  ..............................................................................
ENSBTAP00000008933  ..............................................................................
ENSBTAP00000056088  ..............................................................................
ENSBTAP00000033794  ..............................................................................
ENSBTAP00000012786  ..............................................................................
ENSBTAP00000030018  ..............................................................................
ENSBTAP00000040233  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000024301  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000015611  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000000847  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000054975  ..............................................................................
ENSBTAP00000046639  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000053164  ..............................................................................
ENSBTAP00000016774  ..............................................................................
ENSBTAP00000022630  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000033974  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000005979  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000053746  ..............................................................................
ENSBTAP00000023221  ..............................................................................
ENSBTAP00000019429  ..............................................................................
ENSBTAP00000052019  ..............................................................................
ENSBTAP00000042244  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000018877  ..............................................................................
ENSBTAP00000053019  ..............................................................................
ENSBTAP00000003073  ..............................................................................
ENSBTAP00000012886  ..............................................................................
ENSBTAP00000044222  ..............................................................................
ENSBTAP00000028499  ..............................................................................
ENSBTAP00000047378  ..............................................................................
ENSBTAP00000009308  ..............................................................................
ENSBTAP00000017060  ..............................................................................
ENSBTAP00000050406  ..............................................................................
ENSBTAP00000031879  ..............................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000001250  ..............................................................................
ENSBTAP00000026035  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000053194  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000033188  ..............................................................................
ENSBTAP00000053548  ..............................................................................
ENSBTAP00000011687  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000009115  ..............................................................................
ENSBTAP00000023873  ..............................................................................
ENSBTAP00000054471  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000025205  ..............................................................................
ENSBTAP00000047882  ..............................................................................
ENSBTAP00000001368  ..............................................................................
ENSBTAP00000029786  ..............................................................................
ENSBTAP00000028993  ..............................................................................
ENSBTAP00000023678  ..............................................................................
ENSBTAP00000034710  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000021074  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000007217  ..............................................................................
ENSBTAP00000029792  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000017319  ..............................................................................
ENSBTAP00000044100  ..............................................................................
ENSBTAP00000033594  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000055894  ..............................................................................
ENSBTAP00000015220  ..............................................................................
ENSBTAP00000033613  ..............................................................................
ENSBTAP00000056320  ..............................................................................
ENSBTAP00000025249  ..............................................................................
ENSBTAP00000029159  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000017662  ..............................................................................
ENSBTAP00000012479  ..............................................................................
ENSBTAP00000029886  ..............................................................................
ENSBTAP00000027388  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000023673  ..............................................................................
ENSBTAP00000041488  ..............................................................................
ENSBTAP00000001452  ..............................................................................
ENSBTAP00000028498  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000020240  ..............................................................................
ENSBTAP00000053650  ..............................................................................
ENSBTAP00000041651  ..............................................................................
ENSBTAP00000005154  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000022068  ..............................................................................
ENSBTAP00000026682  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000027954  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000013601  ..............................................................................
ENSBTAP00000005477  ..............................................................................
ENSBTAP00000055305  ..............................................................................
ENSBTAP00000036054  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000002717  ..............................................................................
ENSBTAP00000036015  ..............................................................................
ENSBTAP00000051638  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000016306  ..............................................................................
ENSBTAP00000013714  ..............................................................................
ENSBTAP00000036550  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000023383  ..............................................................................
ENSBTAP00000027030  ..............................................................................
ENSBTAP00000053270  ..............................................................................
ENSBTAP00000054640  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000009967  ..............................................................................
ENSBTAP00000015183  ..............................................................................
ENSBTAP00000014222  ..............................................................................
ENSBTAP00000026288  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000009228  ..............................................................................
ENSBTAP00000026785  ..............................................................................
ENSBTAP00000002578  ..............................................................................
ENSBTAP00000000106  ..............................................................................
ENSBTAP00000028840  ..............................................................................
ENSBTAP00000053594  ..............................................................................
ENSBTAP00000055414  iydnsrftdlhsiirniqsykeikgrstfngvsvnllqfvqlletfvgedsplsvsealtsffrkgfvetkeekmsgl
ENSBTAP00000026698  ..............................................................................
ENSBTAP00000017015  ..............................................................................
ENSBTAP00000049908  ..............................................................................
ENSBTAP00000021395  ..............................................................................
ENSBTAP00000007194  ..............................................................................
ENSBTAP00000025455  ..............................................................................


                                           90                   100        110                      
                                            |                     |          |                      
d1br1b_               ..............DYVEG...LRVF...........DKEGNG.TV.MGAEIRHVLVTL.................GE
ENSBTAP00000019411  ..............EIREA...FRVF...........DKDGNG.YI.SAAELRHVMTNL.................GE
ENSBTAP00000036057  ..............EIREA...FRVF...........DKDGNG.YI.SAAELRHVMTNL.................GE
ENSBTAP00000038404  ..............KLKWA...FSMY...........DLDGNG.YI.SKAEMLEIVQAIykmvssvmkmpe.....DE
ENSBTAP00000010971  ..............KLMWA...FSMY...........DLDGNG.YI.SREEMLEIVQAIykmvssvmkmpe.....DE
ENSBTAP00000019803  ..............KWQAV...YKQF...........DVDRSG.TI.GSSELPGAFEAA.................GF
ENSBTAP00000014038  ..............KLRFA...FRIY...........DMDKDG.YI.SNGELFQVLKMMv................GN
ENSBTAP00000002055  ..............EIREA...FRVF...........DKDGNG.YI.SAAELRHVMTNL.................GE
ENSBTAP00000049731  ..............EIREA...FRVF...........DKDGNG.YI.SAAELRHVMTNL.................GE
ENSBTAP00000005577  ..............KLKWA...FSMY...........DLDGNG.YI.SRSEMLEIVQAIykmvssvmkmpe.....DE
ENSBTAP00000034949  ..............KLEWA...FSLY...........DVDGNG.TI.SKNEVLEIVTAIfkmispedtkhlpe...DE
ENSBTAP00000017447  ..............DIEDL...FKKI...........NGDKTD.YL.TVDQLVSFLNEHqrdprl...........N-
ENSBTAP00000010858  ..............----L...LNVY...........DTGRTG.RI.RVLSFKT-----.................--
ENSBTAP00000046644  ..............EIDNI...FSEF...........GAKSKP.YL.TVDQMMDFINLKqrdprlneil.......YP
ENSBTAP00000022814  ..............KLNWA...FNMY...........DLDGDG.KI.TRVEMLEIIEAIykmvgtvimmkmn....ED
ENSBTAP00000019758  ..............CTTRF...FETC...........DLDNDK.YI.ALDEWAGCF---.................--
ENSBTAP00000019321  ..............KLNWA...FEMY...........DLDGDG.RI.TRLEMLEIIEAIykmvgtvimmrmn....QD
ENSBTAP00000011677  ..............TWQKI...FKHY...........DTDQSG.TI.NSYEMRNAVKDA.................GF
ENSBTAP00000011680  ..............TWQKI...FKHY...........DTDQSG.TI.NSYEMRNAVKDA.................GF
ENSBTAP00000021742  ..............RLNWA...FNLY...........DLNKDG.CI.TKEEMLDIMKSIydmmgkytypal.....RE
ENSBTAP00000005348  ..............CITRF...FEEC...........DPNKDK.HI.TLQEWGHCFEIK.................EE
ENSBTAP00000016609  ..............DIDKI...LLEI...........GAKGKP.YL.TLEQLMDFINQKqrdprlnevl.......YP
ENSBTAP00000012740  ..............CLNWL...LNVY...........DTGRTG.KI.RVQSLKIGLI--.................--
ENSBTAP00000018403  ..............GLREI...FRAF...........DQDDDG.YI.SVDELRQATSQL.................GE
ENSBTAP00000026407  ..............SK---...----...........------.--.------------.................--
ENSBTAP00000052557  ..............EILKA...FRLF...........DDDETG.KI.SFKNLKRVAKEL.................GE
ENSBTAP00000054167  ..............KLNWA...FNLY...........DINKDG.YI.TKEEMLDIMKAIydmmgkctypvl.....KE
ENSBTAP00000010319  ..............EILKA...FKLF...........DDDETG.KI.SFKNLKRVAKEL.................GE
ENSBTAP00000041545  ..............EVQEL...FEKF...........SSDG-Q.KL.TLLEFVDFLQEEqke..............GE
ENSBTAP00000055204  ..............DWQNV...FRTY...........DRDNSG.MI.DKNELKQALSGF.................GY
ENSBTAP00000003718  ..............KLRWT...FNLY...........DINKDG.YI.NKEEMMDIVKAIydmmgkytypvl.....KE
ENSBTAP00000011676  ..............KYLDI...FRET...........DHNHSG.TI.DAHEMRTALKKA.................GF
ENSBTAP00000049395  ..............TFEEA...----...........-TGSKE.TL.SVDQLVTFLQHQ.................--
ENSBTAP00000054983  ..............SA---...----...........------.--.------------.................--
ENSBTAP00000052219  ..............GWRQH...FISF...........DSDRSG.TV.DPQELQKALTTM.................GF
ENSBTAP00000025402  ..............EIDEI...FTSY...........HSKAKP.YM.TKEHLAKFINQK.................--
ENSBTAP00000011678  ..............NYLSI...FRKF...........DLDKSG.SM.SAYEMRMAIEFA.................GF
ENSBTAP00000000433  ..............ALENI...YKL-...........------.--.------------.................--
ENSBTAP00000021491  ..............EILKA...FKLF...........DDDDTG.SI.SLNNIKRVAKEL.................GE
ENSBTAP00000044733  ..............KYQKI...YREI...........DVDRSG.TM.NSYEMRKALEEA.................GF
ENSBTAP00000010937  ..............DLYLL...LLSY...........-SDKKD.HL.TVEELAQFLKVE.................QK
ENSBTAP00000056439  ..............DLYLL...LLSY...........-SDKKD.HL.TVEELAQFLKVE.................QK
ENSBTAP00000055780  ..............ELSDL...FRMF...........DKNADG.YI.DLEELKIMLQAT.................GE
ENSBTAP00000038002  ..............LSQAL...FQ--...........------.--.------------.................--
ENSBTAP00000034705  ..............ELEEI...FHRY...........-SGEDR.VL.SASELLEFLEDQ.................GE
ENSBTAP00000035936  ..............KLKWT...FKIY...........DKDRNG.CI.DRQELLDIVESIyklkkacsveveaeqqgKL
ENSBTAP00000013699  ..............QWKNL...FQQY...........DRDCSG.SI.SYTELQQALSQM.................GY
ENSBTAP00000002564  ..............TALEI...FNEH...........DLQASEhVM.DVVEVIHCLTAL.................YE
ENSBTAP00000011496  ..............KLRWA...FKLY...........DLDNDG.YI.TRNEMLDIVDAIyqmvgntvelpe.....EE
ENSBTAP00000019111  ..............EILKA...FKLF...........DDDDSG.KI.SLRNLRRVAREL.................GE
ENSBTAP00000017036  ..............KLRWY...FKLY...........DVDGNG.CI.DRDELLTIIRAIrainpcs..........DS
ENSBTAP00000003213  ..............DLYLL...MLTY...........-SNHKD.HL.DATDLLRFLEVE.................QK
ENSBTAP00000055444  ..............DLYLL...MLTY...........-SNHKD.HL.DATDLLRFLEVE.................QK
ENSBTAP00000024550  ..............SWKQN...FITV...........DKDGSG.SV.EHHELNQAIAAM.................GY
ENSBTAP00000015248  ..............VIRNA...FACF...........DEEASG.FI.HEDHLRELLTTM.................GD
ENSBTAP00000021328  ..............VIRNA...FACF...........DEEATG.TI.QEDYLRELLTTM.................GD
ENSBTAP00000037091  ..............VIRNA...FACF...........DEEATG.TI.QEDYLRELLTTM.................GD
ENSBTAP00000029967  ..............ELRDA...FREF...........DTNGDG.CI.SLGELRAALKALl................GE
ENSBTAP00000021449  ..............EMRDA...FKEF...........DANGDG.EI.TLGELQQAMQRLl................GD
ENSBTAP00000053176  ..............FTTHL...FMSF...........------.--.------------.................--
ENSBTAP00000042361  ..............ELRDA...FREF...........DTNGDG.EI.STSELREAMRKLl................GH
ENSBTAP00000016509  ..............KLKWT...FKIY...........DKDRNG.CI.DRQELLDIVEVKrpwgppqg.........KL
ENSBTAP00000026714  ..............ELRDA...FREF...........DTNGDG.EI.STSELREAMRKLl................GH
ENSBTAP00000004690  ..............KWTDI...FREC...........DQDQSG.TL.NSYEMRLAVEKA.................GI
ENSBTAP00000010858  ..............-----...----...........------.--.------------.................--
ENSBTAP00000013117  ..............EIYFL...LVQF...........SS-NKE.FL.DTKDLMMFLEAEq................GV
ENSBTAP00000017574  ..............EIIEI...FNTY...........SENRKI.LL.EKNLVEFLMREQy................TL
ENSBTAP00000004885  ..............KMKLA...FKSL...........DKNNDG.KI.EASEIVQSLQIL.................GL
ENSBTAP00000008961  ..............-----...----...........------.--.------------.................--
ENSBTAP00000028063  ..............-----...IAAY...........DSEGRG.KL.TVFSVKAMLATM.................--
ENSBTAP00000012740  ..............-----...----...........------.--.------------.................--
ENSBTAP00000006283  ..............ELRIA...FREF...........DRDRDG.RI.TVAELREAAPALl................GE
ENSBTAP00000014306  ..............DYVEG...LRVF...........DKEGNG.TV.MGAEIRHVLVTL.................GE
ENSBTAP00000053252  ..............EVYFL...LVQI...........SKN-KE.YL.DANDLMLFLEAEq................GV
ENSBTAP00000014304  ..............DYVEG...LRVF...........DKEGNG.TV.MGAEIRHVLVTL.................GE
ENSBTAP00000045669  ..............---FL...LAAF...........DPEGHG.KI.SVFAVKMALATL.................--
ENSBTAP00000041264  ..............-----...----...........------.--.------------.................--
ENSBTAP00000006711  ..............-----...----...........------.--.------------.................--
ENSBTAP00000017358  ..............-----...----...........------.--.------------.................--
ENSBTAP00000053274  ..............---FL...LAAF...........DPEGHG.KI.SVFAVKMALATL.................--
ENSBTAP00000055296  ..............-----...----...........------.--.------------.................--
ENSBTAP00000016852  ..............VIMQA...FRKL...........DKTGDG.VI.TIEDLREVYNAKhhpkyqn..........GE
ENSBTAP00000036380  ..............EILLA...MLMA...........DKEKKG.YI.MASELRSKLMQL.................GE
ENSBTAP00000041719  ..............DYLEG...LRVF...........DKEQNG.KV.MGAELRHVLTTL.................GE
ENSBTAP00000049636  ..............DFVEG...LRVF...........DKEGNG.TV.MGAELRHVLATL.................GE
ENSBTAP00000024444  ..............TILNA...FKVF...........DPEGKG.VL.KADYIKEMLTTQ.................AE
ENSBTAP00000004556  ..............SLGWM...FNKL...........DMNYDL.LL.DHSEINAIYLDK.................--
ENSBTAP00000038767  ..............KLHFA...FRLY...........DLDKDD.KI.SRDELLQVLRMMv................GV
ENSBTAP00000031285  ..............SIGWM...FSKL...........DTSADL.FL.DQTELAAINL--.................--
ENSBTAP00000011457  ..............KMKYC...FEVF...........DLNGDS.FI.SKEEMFHMLKNSllkqp............S-
ENSBTAP00000011047  ..............DFVEG...LRVF...........DKEGNG.TV.MGAELRHVLATL.................GE
ENSBTAP00000002564  ..............-----...----...........------.--.------------.................--
ENSBTAP00000037104  ..............TILHA...FKVF...........DTEGKG.FV.KADFIKEKLMTQ.................AD
ENSBTAP00000002672  ..............AILSA...FRLF...........DPSGKG.VV.NKDEFRQLLLTQ.................AD
ENSBTAP00000028269  ..............VITGA...FKVL...........DPEGKG.TI.KKKFLEELLTTQ.................CD
ENSBTAP00000016647  ..............KLRFA...FQLY...........DLDRDG.KI.SRHEMLQALRLMv................GV
ENSBTAP00000004536  ..............RLLLL...FHSL...........DRNQDG.QI.DVSEIQQSFRAL.................GI
ENSBTAP00000042177  ..............VVHWY...FKLL...........DKNNSG.DI.GKKEIKPFKRFLr................KK
ENSBTAP00000028063  ..............-----...----...........------.--.------------.................--
ENSBTAP00000050283  ..............DFVEG...LRVF...........DKESNG.TV.MGAELRHVLATL.................GE
ENSBTAP00000048539  ..............ILQMS...FKLF...........DLDKDG.FI.TEQELAAILRAA.................-F
ENSBTAP00000045669  ..............-----...----...........------.--.------------.................--
ENSBTAP00000007972  ..............VVTAA...FAKL...........DRSGDG.VV.TVDDLRGVYSGRthpkvrs..........GE
ENSBTAP00000040815  ..............CARRF...TDYC...........DLNKDK.VI.SLPELKGCL---.................--
ENSBTAP00000025661  ..............IIQVA...FKLF...........DVDEDG.FI.TEEEFSTILQASl................G-
ENSBTAP00000028350  ..............KSHYA...FRIF...........DFDDDG.TL.NREDLSQLVNCLtgese............DT
ENSBTAP00000053274  ..............-----...----...........------.--.------------.................--
ENSBTAP00000021537  ..............KAYYA...FKIY...........DFNNDD.YI.CAWDLEQTVTKLtr...............GE
ENSBTAP00000055481  ..............-----...----...........------.--.------------.................--
ENSBTAP00000039155  ..............HIWEA...FHVF...........DKDSKI.LV.STAKRRHAMTWL.................GK
ENSBTAP00000029333  ..............-----...----...........------.--.------------.................--
ENSBTAP00000016315  ..............-----...----...........------.--.------------.................--
ENSBTAP00000021091  ..............FYQEV...FHKQ...........DTNRSG.SL.NWAQLRAAMREA.................GI
ENSBTAP00000021618  ..............KSRLM...FRMY...........DFDGNG.LI.SKDEFIRMLRSFieis.............NN
ENSBTAP00000055520  ..............-----...----...........------.--.------------.................--
ENSBTAP00000055624  ..............-----...----...........------.--.------------.................--
ENSBTAP00000016319  ..............-----...----...........------.--.------------.................--
ENSBTAP00000034078  ..............ILLRA...FEVL...........DPAKRG.FL.SKDELIKYMTEE.................GE
ENSBTAP00000006645  ..............KIEYA...FRIY...........DFNENG.FI.DEEDLQRIILRLln...............SD
ENSBTAP00000021909  ..............EREQF...VEFR...........DKNRDG.KM.DKEETKDWILPS.................DY
ENSBTAP00000001426  ..............EFMEA...WRKY...........DTDRSG.YI.EANELKGFLSDLlkkanrpy.........DE
ENSBTAP00000015802  ..............KLRLV...FKSL...........DKKNDG.RI.DAQEIMQSLRDL.................GV
ENSBTAP00000032680  ..............KLRLV...FKSL...........DKKNDG.RI.DAQEIMQSLRDL.................GV
ENSBTAP00000055007  ..............ELAEC...FRIF...........DR----.--.------------.................--
ENSBTAP00000020148  ..............-----...----...........------.--.------------.................--
ENSBTAP00000052345  ..............-----...----...........------.--.------------.................--
ENSBTAP00000029334  ..............-----...----...........------.--.------------.................--
ENSBTAP00000052345  ..............-----...----...........----NG.FL.SGDKVKPVLLNS.................--
ENSBTAP00000056127  ..............SEREQ...FNEFr..........DLNKDG.KL.DKDEISHWILPQ.................DY
ENSBTAP00000012557  ..............DLQII...FNII...........DSDHSG.LI.SMEEFRSMWRLFkshy.............SV
ENSBTAP00000011888  ..............TAQHW...ASSS...........PETGSG.SI.DADELRTVLQSClyes.............AI
ENSBTAP00000017060  ..............-----...----...........------.LL.SGDKVKPVLMNS.................--
ENSBTAP00000031854  ..............SIEYW...FRCM...........DVDGDG.VL.SMYELEYFYEEQ.................CE
ENSBTAP00000031823  ..............TEREQ...FRDFr..........DLNKDG.KL.NGSEVGHWVLPP.................AQ
ENSBTAP00000021603  ..............KSRLM...FTMY...........DLDGNG.FL.SKDEFFTMMRVPptpr.............P-
ENSBTAP00000010838  ..............-----...----...........------.--.------------.................--
ENSBTAP00000014575  ..............KASYA...FKIY...........DFNTDN.FI.CKEDLQLTLARLt................KS
ENSBTAP00000011215  ..............SIEYW...FRCM...........DVDGDG.VL.SMYELEYFYEEQ.................CE
ENSBTAP00000053698  ..............TIDSI...FWQF...........DMQR--.-I.TLEELKHILYHAf................RD
ENSBTAP00000006806  ..............-----...----...........------.--.------------.................--
ENSBTAP00000029334  ..............-----...----...........------.--.------------.................--
ENSBTAP00000044105  ..............-----...----...........------.--.------------.................--
ENSBTAP00000026904  ..............-----...----...........------.--.------------.................--
ENSBTAP00000017060  ..............-----...----...........------.--.------------.................--
ENSBTAP00000055520  ..............-----...----...........------.--.------------.................--
ENSBTAP00000044226  ..............-----...----...........------.--.------------.................--
ENSBTAP00000055624  ..............-----...----...........------.--.------------.................--
ENSBTAP00000042182  ..............EWQAT...FDKF...........DEDASG.TM.NSYELRLALNAA.................GF
ENSBTAP00000010796  ..............PMRRT...FKAY...........DEGGTG.LL.SVADFRKVLRQY.................SI
ENSBTAP00000021174  ..............EFMKT...WRKY...........DTDHSG.FI.ETEELKNFLKDLlekanktv.........DD
ENSBTAP00000006275  ..............-----...----...........------.--.------------.................--
ENSBTAP00000020950  ..............EKDRF...MNDY...........DRDADG.RL.DPQELLSWVVPN.................NQ
ENSBTAP00000053738  ..............PMRRT...FKAY...........DEGGTG.LL.SVADFRKVLRQY.................SI
ENSBTAP00000004963  ..............KLKFC...FEVY...........YFNGDG.YI.SRERIYDMLKNS.................--
ENSBTAP00000023774  ..............DFDTV...FWKC...........DM---Q.KL.TVDELKRLLYDTf................CE
ENSBTAP00000020395  ..............EIESA...FRAL...........SSEGKP.YV.TKEELYQ-----.................--
ENSBTAP00000020150  ..............TMMFT...FHKF...........AGD-KG.YL.TKEDLRVLMEKEfpgfl............EN
ENSBTAP00000025561  ..............-----...----...........------.--.------------.................--
ENSBTAP00000053738  ..............DLSKN...FIET...........DSEGNG.IL.RRRDMKNALYGF.................DI
ENSBTAP00000034009  ..............-----...----...........------.--.------------.................--
ENSBTAP00000020539  ..............NLETI...FRII...........DSDHSG.SI.SLDEFRHTWKLFsshm.............NI
ENSBTAP00000020778  ..............RKREF...EELI...........DANHDG.IV.TMAELEDYMDPM.................NE
ENSBTAP00000017461  ..............EVRHI...FTAF...........DRHYRG.YL.TLEDFKKAFKQV.................AP
ENSBTAP00000044096  ..............-----...----...........------.--.------------.................--
ENSBTAP00000008523  ..............-----...----...........------.--.------------.................--
ENSBTAP00000035196  ..............FLQST...FDKH...........DLDRDC.AL.SPDELKDLFKVFpyipw............G-
ENSBTAP00000041997  ..............-----...----...........------.--.-----KKEMVRS.................--
ENSBTAP00000025499  ..............DVKKV...FHIL...........DKDKSG.FI.EEEELGFILKGFspd..............AR
ENSBTAP00000055481  ..............-----...----...........------.--.------------.................--
ENSBTAP00000002174  ..............-----...----...........------.--.------------.................--
ENSBTAP00000000589  ..............-----...----...........------.KL.SKGEMKELLHKElpsfv............GE
ENSBTAP00000028239  ..............-----...----...........------.--.------------.................--
ENSBTAP00000014894  ..............QVIAS...FKVL...........AGDK-N.FI.TAEELRREL---.................--
ENSBTAP00000026544  ..............DFEKI...FAHY...........DVSKTG.AL.EGPEVDGFVKDMmelvqpsir........GV
ENSBTAP00000029333  ..............-----...----...........------.--.------------.................--
ENSBTAP00000041966  ..............HCQSV...FQNS...........PKNA-G.VF.LSSDLWKAIRDTdfla.............GI
ENSBTAP00000008933  ..............-----...----...........------.--.------------.................--
ENSBTAP00000056088  ..............-----...----...........------.--.------------.................--
ENSBTAP00000033794  ..............-----...----...........------.--.------------.................--
ENSBTAP00000012786  ..............QVIAS...FRIL...........ASDK-P.YI.LAEELRRE----.................--
ENSBTAP00000030018  ..............QVVAS...FKIL...........AGDK-N.YI.TAEELRREL---.................--
ENSBTAP00000040233  ..............TVIKA...LMLI...........DVNTTG.LV.QPHELRRVLETF.................CL
ENSBTAP00000003365  ..............ELLKS...FKQL...........DVNDNG.SI.LHTDLYKLLTKK.................GE
ENSBTAP00000053176  ..............KLEFM...FRLY...........DTDGNG.FL.DSSELENIISQMmhvaeylew........DV
ENSBTAP00000024301  ..............QVMAS...FKIL...........AGDK-N.YI.TVDELRREL---.................--
ENSBTAP00000022292  ..............MFIVA...FQLF...........DKSGNG.EV.TFENVKEIFGQTti...............HH
ENSBTAP00000015611  ..............-----...----...........------.--.------------.................--
ENSBTAP00000012770  ..............ALQYI...FKLL...........DIENKG.YL.NVFSLNYFFRAIqelmkihg.........QD
ENSBTAP00000000847  ..............-----...----...........------.TL.SRKELKELIKKElcl..............GE
ENSBTAP00000053738  ..............TVIKA...LMLI...........DVNTTG.LV.QPHELRRVLETF.................CL
ENSBTAP00000054975  ..............QVKDV...FRFI...........DNDQSG.YL.DEEELKFFLQKFesg..............AR
ENSBTAP00000046639  ..............FVRKA...FMKL...........DFNKTG.SV.SIIDIRKCYCAKmhprvis..........GH
ENSBTAP00000052345  ..............-----...----...........------.--.------------.................--
ENSBTAP00000053164  ..............FERDF...FKTR...........------.--.SKQEISEILCNI.................GV
ENSBTAP00000016774  ..............-----...----...........------.--.------------.................--
ENSBTAP00000022630  ..............-----...----...........------.--.------------.................--
ENSBTAP00000010796  ..............AIAQE...FENF...........DTMKTN.TA.SRDEFRSICTRH.................VQ
ENSBTAP00000021909  ..............NVENQ...WQEF...........DLNQDG.LI.SWDEYRNVTYGTylddpdpdd........GF
ENSBTAP00000033974  ..............ELRAA...LCIF...........DKEARG.YI.DWDTLKYVLMNV.................GE
ENSBTAP00000006711  ..............KLEFM...FRLY...........DSDENG.LL.DQAEMDRIVSQMlhiaq............YL
ENSBTAP00000010796  ..............DISKA...LAKL...........DKSRTG.YI.SLGRLQRLLQEC.................GC
ENSBTAP00000004912  ..............LFMVA...FQLF...........DKAGKG.EV.TFEDVKQVFGQTti...............HQ
ENSBTAP00000005979  ..............FVQRM...FEKH...........DQDRDG.AL.SPAELQSLFSVF.................--
ENSBTAP00000053738  ..............AIAQE...FENF...........DTMKTN.TA.SRDEFRSICTRH.................VQ
ENSBTAP00000053746  ..............KLRFL...FHMY...........DSDSDG.RI.TLEEYRNVVEELlsg..............NP
ENSBTAP00000023221  ..............-----...----...........------.--.------------.................--
ENSBTAP00000019429  ..............-----...----...........------.--.------------.................--
ENSBTAP00000052019  ..............-----...----...........------.--.------------.................--
ENSBTAP00000042244  ..............-----...----...........------.--.------------.................--
ENSBTAP00000053738  ..............AFCNM...LRSY...........DLGDTG.LI.GRNNFKKIMRVF.................CP
ENSBTAP00000018877  ..............-----...----...........-----N.KI.SKSSFRKMLQKElnhml............TD
ENSBTAP00000053019  ..............-----...----...........------.--.------------.................--
ENSBTAP00000003073  ..............-----...----...........------.--.------------.................--
ENSBTAP00000012886  ..............-----...----...........------.--.------------.................--
ENSBTAP00000044222  ..............-----...----...........------.--.------------.................--
ENSBTAP00000028499  ..............-----...----...........------.--.------------.................--
ENSBTAP00000047378  ..............RVWGL...WEEL...........GVGSSG.HL.TEQELALVCQSI.................GL
ENSBTAP00000009308  ..............-----...----...........------.--.------------.................--
ENSBTAP00000017060  ..............-----...----...........------.--.------------.................--
ENSBTAP00000050406  ..............TFRKA...----...........------.--.------------.................--
ENSBTAP00000031879  ..............TFRKA...----...........------.--.------------.................--
ENSBTAP00000031854  ..............VIQRI...FYTV...........NRSWSG.KI.TATEIRK-----.................--
ENSBTAP00000001250  ..............TIQLA...FKMF...........-GSQDG.SV.EEHALSSILKTAl................G-
ENSBTAP00000026035  ..............-----...----...........------.--.------------.................--
ENSBTAP00000011215  ..............VIQRI...FYTV...........NRSWSG.KI.TATEIRK-----.................--
ENSBTAP00000002128  ..............VLTDV...VKAI...........DKIKDE.NI.DYGDLNTCLQNL.................GV
ENSBTAP00000053194  ..............ELEDS...FQAL...........-AEGKA.YI.TKEDMKQALT--.................--
ENSBTAP00000056127  ..............RDERR...FKAA...........DLDSDQ.TA.TREEFTAFL---.................--
ENSBTAP00000033188  ..............-----...----...........------.--.------------.................--
ENSBTAP00000053548  ..............RVMDF...FRRI...........DKDQDG.KI.TRQEFIDGILSS.................KF
ENSBTAP00000011687  ..............HSRPV...FELL...........DLDGEL.KI.GPDHLHMYNFLF.................--
ENSBTAP00000007636  ..............DVDTA...LSFY...........HMAG-A.SL.DKVTMQQVARTVa................KV
ENSBTAP00000020950  ..............AEEES...FRQL...........HLKD--.--.------------.................--
ENSBTAP00000009115  ..............-----...----...........------.--.------------.................--
ENSBTAP00000023873  ..............YAHFL...FNAF...........DADGNG.AI.RF----------.................--
ENSBTAP00000054471  ..............-----...----...........------.--.------------.................--
ENSBTAP00000039694  ..............DFAIA...LNMY...........NFA-SR.SI.GQDEFKRAVYVAt................GL
ENSBTAP00000025205  ..............-----...----...........------.--.------------.................--
ENSBTAP00000047882  ..............LQLHY...FKMH...........DYDGNN.LL.DGLELSTAITHVhkeegse..........QA
ENSBTAP00000001368  ..............PYLSA...FGDL...........DQNQDG.CI.SKEEMVSYFL--.................--
ENSBTAP00000029786  ..............KLKLL...YKM-...........------.--.------------.................--
ENSBTAP00000028993  ..............-----...----...........------.--.------------.................--
ENSBTAP00000023678  ..............NIREA...FQIY...........DKEASG.YV.DRETFFKICGSY.................QL
ENSBTAP00000034710  ..............-----...----...........------.--.------------.................--
ENSBTAP00000031823  ..............RDERR...FRVA...........DQDGDS.MA.TREELTAF----.................--
ENSBTAP00000038002  ..............KLEFT...FKLY...........DTDRNG.IL.DSSEVDRIIIQMmrmaeyl..........D-
ENSBTAP00000021074  ..............-----...----...........------.--.------------.................--
ENSBTAP00000026544  ..............EFMRI...WRKY...........DADSSG.FI.SAAELCNFLRDL.................--
ENSBTAP00000007217  ..............SPLDL...FQLL...........DQNHDG.RL.QLREVLAQNRLGn................GR
ENSBTAP00000029792  ..............KLKVL...YKL-...........------.--.------------.................--
ENSBTAP00000044088  ..............DFAIA...MQMF...........SLAH-R.PV.RLAEFKRAVKVAt................GQ
ENSBTAP00000017319  ..............-----...----...........------.--.------------.................--
ENSBTAP00000044100  ..............PFLDS...FCVL...........DKDQDG.LI.SKDEMMAYFLRA.................--
ENSBTAP00000033594  ..............-----...----...........------.--.-----------Efekhgavv.........NE
ENSBTAP00000026766  ..............-----...----...........------.--.------------.................--
ENSBTAP00000055894  ..............-----...----...........------.--.------------.................--
ENSBTAP00000015220  ..............TIGDM...FQNQ...........DRNQDG.KI.TAEELK------.................--
ENSBTAP00000033613  ..............IVKNM...FTNQ...........DRNGDG.KV.TAEEFK------.................--
ENSBTAP00000056320  ..............SIEYW...FR-M...........DLDGDV.AL.FMFELEYFYEEQ.................SR
ENSBTAP00000025249  ..............-----...----...........------.--.-------FLVNCq................GE
ENSBTAP00000029159  ..............---FS...FCVM...........DKDREG.LI.SRDEITAYFM--.................--
ENSBTAP00000044088  ..............DFAIA...MQMF...........SLAH-R.PV.RLAEFKRAVKVAt................GQ
ENSBTAP00000016319  ..............-----...----...........------.--.------------.................--
ENSBTAP00000017662  ..............-----...----...........------.--.------------.................--
ENSBTAP00000012479  ..............KLNLS...FRKE...........DRSFSG.CL.PPPKVRAICGKH.................GL
ENSBTAP00000029886  ..............TAINI...TTYA...........DQENNK.L-.------------.................--
ENSBTAP00000027388  ..............-----...----...........------.--.------------.................--
ENSBTAP00000039694  ..............GFRIA...FNMF...........DTDGNE.MV.DKKEFLVLQEIF.................RK
ENSBTAP00000023673  ..............QAQEL...FLLC...........DKEAKG.FI.TRHDLQGLQSDL.................--
ENSBTAP00000041488  ..............QAQEL...FLLC...........DKEAKG.FI.TRHDLQGLQSDL.................--
ENSBTAP00000001452  ..............-----...----...........------.--.------------.................--
ENSBTAP00000028498  ..............-----...----...........------.--.------------.................--
ENSBTAP00000001426  ..............-----...-RMF...........DLNGDG.KL.GLSEMSRLLPVQenfllkfq.........GM
ENSBTAP00000020240  ..............--SDT...FKEY...........DPDGKG.VI.SKRDFHKAMESH.................K-
ENSBTAP00000053650  ..............--SDT...FKEY...........DPDGKG.VI.SKRDFHKAMESH.................K-
ENSBTAP00000041651  ..............VLLYL...FALH...........DYDQSG.QL.DGLELLSMLTAAlapgas...........DS
ENSBTAP00000005154  ..............-----...----...........------.--.------------.................--
ENSBTAP00000021174  ..............EFNKA...FELY...........DQDGNG.YI.DENELDALLKDL.................CE
ENSBTAP00000022068  ..............-----...----...........------.--.------------.................--
ENSBTAP00000026682  ..............DISES...LR--...........--QGGG.KL.NFDELRQDLKGK.................G-
ENSBTAP00000007636  ..............TALSF...YHMA...........----GA.SL.DKVTMQQVARTVa................KV
ENSBTAP00000027954  ..............-----...---F...........DPGNTG.FI.STGKFRSLLDSH.................SS
ENSBTAP00000020778  ..............ESRAH...FRAV...........DPDGDG.HV.SWDEY-------.................--
ENSBTAP00000013601  ..............TLGQI...WALA...........NRTTPG.KL.TKEELYAVLAM-.................--
ENSBTAP00000005477  ..............GIQQS...FDILgft........NSKGEK.AI.QREDFLNLLHTK.................GE
ENSBTAP00000055305  ..............--SDT...FKEY...........DPDGKG.II.SKKEFQKAMEGQ.................K-
ENSBTAP00000036054  ..............--SDT...FKEY...........DPDGKG.II.SKKEFQKAMEGQ.................K-
ENSBTAP00000004912  ..............LIRKI...YSTLa..........GNRKDV.EV.TKEEFVLAAQKF.................G-
ENSBTAP00000022292  ..............HARQA...FALK...........DKSKSG.LI.SGLDFSDIMVTIr................SH
ENSBTAP00000002717  ..............EFKKD...SSVFllgnt......DRPDAS.AV.HLHDFQRFLLHE.................QQ
ENSBTAP00000036015  ..............-----...----...........------.--.------------.................--
ENSBTAP00000051638  ..............KLKLL...FKLHispaytevqykDPSKGD.EL.SKEELLY-----.................--
ENSBTAP00000026766  ..............KAKYI...FSLF...........ASESGS.YV.IREEMERMLHVV.................DG
ENSBTAP00000053738  ..............DISKA...LAKL...........DKSRTG.YI.SLGRLQRLLQEC.................GC
ENSBTAP00000016306  ..............RQEWT...FTLY...........DFDNNG.KV.TREDITSLLHTI.................YE
ENSBTAP00000013714  ..............-----...----...........------.--.------------.................--
ENSBTAP00000036550  ..............KIKLL...YR--...........------.--.------------.................--
ENSBTAP00000053738  ..............AFRKR...FLDF...........TKEPNG.KI.HTHDFKKVLEDY.................GM
ENSBTAP00000023383  ..............-----...----...........------.--.------------.................--
ENSBTAP00000027030  ..............IGFRV...FSCL...........-DDGMG.YA.SVERILDTWQEE.................GI
ENSBTAP00000053270  ..............IGFRV...FSCL...........-DDGMG.YA.SVERILDTWQEE.................GI
ENSBTAP00000054640  ..............IGFRV...FSCL...........-DDGMG.YA.SVERILDTWQEE.................GI
ENSBTAP00000012770  ..............QTRIG...LSLY...........DVAGQG.YL.RESDLENYILEL.................--
ENSBTAP00000009967  ..............ELLETlqrFKAL...........DAEQLG.TI.TYEQYKQA----.................--
ENSBTAP00000015183  ..............-----...----...........------.--.------------.................--
ENSBTAP00000014222  ..............KLTAA...FTRF...........DQDGNG.VL.DEKE--------.................--
ENSBTAP00000026288  ..............FLREA...FSFV...........DR-GDG.TV.TKEDFVLTLEER.................QD
ENSBTAP00000002128  ..............AFQNA...LKIF...........HRIKCG.RV.PVSEVDKVLDSM.................DI
ENSBTAP00000003365  ..............-LSDI...FEVI...........DLDGNG.LL.SLEEYNFFELRTs................GE
ENSBTAP00000053738  ..............-----...----...........------.--.------------.................--
ENSBTAP00000009228  ..............--SEA...FQDY...........VTDPRG.LI.SKKDFKKAMDSQ.................K-
ENSBTAP00000026785  ..............KLLSL...ASAL...........DDNKDG.KV.DIDDLVKVIELVdke..............DV
ENSBTAP00000002578  ..............KIWVI...FNFL...........SEDKYP.LIiVPEEIEYLLKKLteam.............GV
ENSBTAP00000000106  ..............-----...----...........------.--.------------.................--
ENSBTAP00000028840  ..............-----...----...........------.--.------------.................--
ENSBTAP00000053594  ..............RFEEA...FAQF...........DAEGDG.TV.DAENMLEALKNSs................G-
ENSBTAP00000055414  ekarqnasrirrelLLKAL...FQKW...........DCDGSG.FL.DLKEIDELLYTY.................KE
ENSBTAP00000026698  ..............LTRLA...FELF...........------.--.------------.................--
ENSBTAP00000017015  ..............-----...----...........------.--.------------.................--
ENSBTAP00000049908  ..............-LLMA...FVYF...........DQSHCG.YL.LEKDLEEIFYTL.................GL
ENSBTAP00000021395  ..............-----...----...........------.--.------------.................--
ENSBTAP00000007194  ..............DCLLA...FVYF...........DANWCG.YL.HRRDLERILLTL.................GL
ENSBTAP00000025455  ..............-LKAL...FQKW...........DCDGSG.FL.DLKEIDELLYTY.................KE


                                                                                             120    
                                                                                               |    
d1br1b_               ..KMTE...................................................................EE...
ENSBTAP00000019411  ..KLTD...................................................................EE...
ENSBTAP00000036057  ..KLTD...................................................................EE...
ENSBTAP00000038404  ..STPE...................................................................KR...
ENSBTAP00000010971  ..STPE...................................................................KR...
ENSBTAP00000019803  ..RLNE...................................................................HL...
ENSBTAP00000014038  ..NLKD...................................................................TQ...
ENSBTAP00000002055  ..KLTD...................................................................EE...
ENSBTAP00000049731  ..KLTD...................................................................EE...
ENSBTAP00000005577  ..STPE...................................................................KR...
ENSBTAP00000034949  ..NTPE...................................................................KR...
ENSBTAP00000017447  ..---Eilfpfydakra........................................................MQ...
ENSBTAP00000010858  ..----...................................................................--...
ENSBTAP00000046644  ..PLKQ...................................................................EQ...
ENSBTAP00000022814  ..GLTP...................................................................EQr..
ENSBTAP00000019758  ..----...................................................................--...
ENSBTAP00000019321  ..GLTP...................................................................QQr..
ENSBTAP00000011677  ..HLNN...................................................................QL...
ENSBTAP00000011680  ..HLNN...................................................................QL...
ENSBTAP00000021742  ..EAPR...................................................................EH...
ENSBTAP00000005348  ..DID-...................................................................--...
ENSBTAP00000016609  ..PLRP...................................................................SQ...
ENSBTAP00000012740  ..----...................................................................--...
ENSBTAP00000018403  ..KVSQ...................................................................DE...
ENSBTAP00000026407  ..----...................................................................--...
ENSBTAP00000052557  ..NLTD...................................................................EE...
ENSBTAP00000054167  ..DAPR...................................................................QH...
ENSBTAP00000010319  ..NLSD...................................................................EE...
ENSBTAP00000041545  ..RASD...................................................................LA...
ENSBTAP00000055204  ..RLSD...................................................................QF...
ENSBTAP00000003718  ..DTPR...................................................................QH...
ENSBTAP00000011676  ..TLSD...................................................................QV...
ENSBTAP00000049395  ..----...................................................................--...
ENSBTAP00000054983  ..----...................................................................--...
ENSBTAP00000052219  ..RLSP...................................................................QA...
ENSBTAP00000025402  ..----...................................................................--...
ENSBTAP00000011678  ..KLNK...................................................................KL...
ENSBTAP00000000433  ..----...................................................................--...
ENSBTAP00000021491  ..NLTD...................................................................DE...
ENSBTAP00000044733  ..KMPC...................................................................QL...
ENSBTAP00000010937  mtNVTT...................................................................DY...
ENSBTAP00000056439  mtNVTT...................................................................DY...
ENSBTAP00000055780  ..TITE...................................................................DD...
ENSBTAP00000038002  ..----...................................................................--...
ENSBTAP00000034705  .hKATL...................................................................AH...
ENSBTAP00000035936  ..LTPE...................................................................EV...
ENSBTAP00000013699  ..NLSP...................................................................QF...
ENSBTAP00000002564  ..RLEE...................................................................--...
ENSBTAP00000011496  ..NTPE...................................................................KR...
ENSBTAP00000019111  ..NMSD...................................................................EE...
ENSBTAP00000017036  ..TMTA...................................................................EEf..
ENSBTAP00000003213  mtGVTL...................................................................ES...
ENSBTAP00000055444  mtGVTL...................................................................ES...
ENSBTAP00000024550  ..RLSP...................................................................QT...
ENSBTAP00000015248  ..RFTD...................................................................EE...
ENSBTAP00000021328  ..RFTD...................................................................EE...
ENSBTAP00000037091  ..RFTD...................................................................EE...
ENSBTAP00000029967  ..RLSQ...................................................................RE...
ENSBTAP00000021449  ..KLTS...................................................................QE...
ENSBTAP00000053176  ..----...................................................................--...
ENSBTAP00000042361  ..QVGH...................................................................RD...
ENSBTAP00000016509  ..LTPE...................................................................EV...
ENSBTAP00000026714  ..QVGH...................................................................RD...
ENSBTAP00000004690  ..KLNN...................................................................KV...
ENSBTAP00000010858  ..----...................................................................--...
ENSBTAP00000013117  .aHINE...................................................................EI...
ENSBTAP00000017574  ..DFNK...................................................................SI...
ENSBTAP00000004885  ..TISE...................................................................QQ...
ENSBTAP00000008961  ..----...................................................................--...
ENSBTAP00000028063  ..----...................................................................--...
ENSBTAP00000012740  ..----...................................................................--...
ENSBTAP00000006283  ..PLVG...................................................................PE...
ENSBTAP00000014306  ..KMTE...................................................................EE...
ENSBTAP00000053252  .tHITE...................................................................DM...
ENSBTAP00000014304  ..KMTE...................................................................EE...
ENSBTAP00000045669  ..----...................................................................--...
ENSBTAP00000041264  ..----...................................................................--...
ENSBTAP00000006711  ..----...................................................................--...
ENSBTAP00000017358  ..----...................................................................--...
ENSBTAP00000053274  ..----...................................................................--...
ENSBTAP00000055296  ..----...................................................................--...
ENSBTAP00000016852  ..WTEE...................................................................QV...
ENSBTAP00000036380  ..KLTH...................................................................KE...
ENSBTAP00000041719  ..RMTE...................................................................EE...
ENSBTAP00000049636  ..KMKE...................................................................EE...
ENSBTAP00000024444  ..RFSK...................................................................EE...
ENSBTAP00000004556  ..--YE...................................................................PC...
ENSBTAP00000038767  ..NISD...................................................................EQlgs
ENSBTAP00000031285  ..DKYE...................................................................VC...
ENSBTAP00000011457  ..----...................................................................EEdpd
ENSBTAP00000011047  ..KLTE...................................................................DE...
ENSBTAP00000002564  ..----...................................................................--...
ENSBTAP00000037104  ..RFSE...................................................................EE...
ENSBTAP00000002672  ..KFSP...................................................................AE...
ENSBTAP00000028269  ..RFSQ...................................................................EE...
ENSBTAP00000016647  ..QVTE...................................................................EQ...
ENSBTAP00000004536  ..SISL...................................................................EQ...
ENSBTAP00000042177  ..SKPK...................................................................KC...
ENSBTAP00000028063  ..----...................................................................--...
ENSBTAP00000050283  ..KMSE...................................................................AE...
ENSBTAP00000048539  ..GVPD...................................................................LD...
ENSBTAP00000045669  ..----...................................................................--...
ENSBTAP00000007972  ..WTEE...................................................................QV...
ENSBTAP00000040815  ..----...................................................................--...
ENSBTAP00000025661  ..-VPD...................................................................LD...
ENSBTAP00000028350  ..RLSA...................................................................SE...
ENSBTAP00000053274  ..----...................................................................--...
ENSBTAP00000021537  ..LSTE...................................................................EVsli
ENSBTAP00000055481  ..----...................................................................--...
ENSBTAP00000039155  ..KLNN...................................................................QE...
ENSBTAP00000029333  ..----...................................................................--...
ENSBTAP00000016315  ..----...................................................................--...
ENSBTAP00000021091  ..MLSD...................................................................DV...
ENSBTAP00000021618  ..CLTK...................................................................TQlae
ENSBTAP00000055520  ..----...................................................................--...
ENSBTAP00000055624  ..----...................................................................--...
ENSBTAP00000016319  ..----...................................................................--...
ENSBTAP00000034078  ..PFSQ...................................................................EE...
ENSBTAP00000006645  ..DMSE...................................................................DL...
ENSBTAP00000021909  ..DHAE...................................................................AE...
ENSBTAP00000001426  ..PKLQ...................................................................EY...
ENSBTAP00000015802  ..KISE...................................................................QQ...
ENSBTAP00000032680  ..KISE...................................................................QQ...
ENSBTAP00000055007  ..----...................................................................--...
ENSBTAP00000020148  ..----...................................................................--...
ENSBTAP00000052345  ..----...................................................................--...
ENSBTAP00000029334  ..----...................................................................--...
ENSBTAP00000052345  ..KLPV...................................................................DI...
ENSBTAP00000056127  ..DHAQ...................................................................AE...
ENSBTAP00000012557  ..HIDD...................................................................SQ...
ENSBTAP00000011888  ..SLPK...................................................................EK...
ENSBTAP00000017060  ..KLPL...................................................................DV...
ENSBTAP00000031854  ..RMEAmgieplpfh..........................................................DL...
ENSBTAP00000031823  ..DQPL...................................................................VE...
ENSBTAP00000021603  ..---Rsfieisnncltktqla...................................................EV...
ENSBTAP00000010838  ..----...................................................................--...
ENSBTAP00000014575  ..ELDE...................................................................DEvvl
ENSBTAP00000011215  ..RMEAmgieplpfh..........................................................DL...
ENSBTAP00000053698  ..HLTM...................................................................KD...
ENSBTAP00000006806  ..----...................................................................--...
ENSBTAP00000029334  ..----...................................................................--...
ENSBTAP00000044105  ..----...................................................................--...
ENSBTAP00000026904  ..----...................................................................--...
ENSBTAP00000017060  ..----...................................................................--...
ENSBTAP00000055520  ..----...................................................................--...
ENSBTAP00000044226  ..----...................................................................--...
ENSBTAP00000055624  ..----...................................................................--...
ENSBTAP00000042182  ..HLNN...................................................................QL...
ENSBTAP00000010796  ..NLSE...................................................................EE...
ENSBTAP00000021174  ..TKLA...................................................................EY...
ENSBTAP00000006275  ..----...................................................................--...
ENSBTAP00000020950  ..GIAQ...................................................................EE...
ENSBTAP00000053738  ..NLSE...................................................................EE...
ENSBTAP00000004963  ..----...................................................................--...
ENSBTAP00000023774  ..HLSM...................................................................KD...
ENSBTAP00000020395  ..NLTR...................................................................EQ...
ENSBTAP00000020150  ..QKDP...................................................................LA...
ENSBTAP00000025561  ..----...................................................................--...
ENSBTAP00000053738  ..PLTP...................................................................RE...
ENSBTAP00000034009  ..----...................................................................--...
ENSBTAP00000020539  ..DITD...................................................................DC...
ENSBTAP00000020778  ..FSAL...................................................................NE...
ENSBTAP00000017461  ..KLSE...................................................................RI...
ENSBTAP00000044096  ..----...................................................................--...
ENSBTAP00000008523  ..----...................................................................--...
ENSBTAP00000035196  ..---P...................................................................DV...
ENSBTAP00000041997  ..KLPN...................................................................SV...
ENSBTAP00000025499  ..DLSV...................................................................KE...
ENSBTAP00000055481  ..----...................................................................--...
ENSBTAP00000002174  ..KLPN...................................................................TV...
ENSBTAP00000000589  ..KVDE...................................................................EG...
ENSBTAP00000028239  ..----...................................................................--...
ENSBTAP00000014894  ..----...................................................................--...
ENSBTAP00000026544  ..DL-D...................................................................KF...
ENSBTAP00000029333  ..----...................................................................--...
ENSBTAP00000041966  ..SITS...................................................................EL...
ENSBTAP00000008933  ..-LPN...................................................................SV...
ENSBTAP00000056088  ..----...................................................................--...
ENSBTAP00000033794  ..----...................................................................--...
ENSBTAP00000012786  ..-LPP...................................................................DQ...
ENSBTAP00000030018  ..----...................................................................--...
ENSBTAP00000040233  ..KMKD...................................................................EE...
ENSBTAP00000003365  ..KMTR...................................................................EE...
ENSBTAP00000053176  ..TELN...................................................................PI...
ENSBTAP00000024301  ..----...................................................................--...
ENSBTAP00000022292  ..HIPF...................................................................NW...
ENSBTAP00000015611  ..----...................................................................--...
ENSBTAP00000012770  ..PVSF...................................................................QDv..
ENSBTAP00000000847  ..KMRE...................................................................SS...
ENSBTAP00000053738  ..KMKD...................................................................EE...
ENSBTAP00000054975  ..ELTE...................................................................SE...
ENSBTAP00000046639  ..STEE...................................................................EI...
ENSBTAP00000052345  ..----...................................................................--...
ENSBTAP00000053164  ..KLSE...................................................................DE...
ENSBTAP00000016774  ..----...................................................................--...
ENSBTAP00000022630  ..----...................................................................--...
ENSBTAP00000010796  ..VLTD...................................................................EQ...
ENSBTAP00000021909  ..NYKQ...................................................................MMvr.
ENSBTAP00000033974  ..PLNE...................................................................--...
ENSBTAP00000006711  ..EWDP...................................................................TElrp
ENSBTAP00000010796  ..SLKE...................................................................EE...
ENSBTAP00000004912  ..HIPF...................................................................NW...
ENSBTAP00000005979  ..----...................................................................--...
ENSBTAP00000053738  ..VLTD...................................................................EQ...
ENSBTAP00000053746  ..H---...................................................................--...
ENSBTAP00000023221  ..----...................................................................--...
ENSBTAP00000019429  ..----...................................................................--...
ENSBTAP00000052019  ..----...................................................................--...
ENSBTAP00000042244  ..----...................................................................--...
ENSBTAP00000053738  ..FLTT...................................................................EH...
ENSBTAP00000018877  ..TGNR...................................................................KA...
ENSBTAP00000053019  ..----...................................................................--...
ENSBTAP00000003073  ..----...................................................................--...
ENSBTAP00000012886  ..----...................................................................--...
ENSBTAP00000044222  ..----...................................................................--...
ENSBTAP00000028499  ..----...................................................................--...
ENSBTAP00000047378  .qGLAK...................................................................EE...
ENSBTAP00000009308  ..----...................................................................--...
ENSBTAP00000017060  ..----...................................................................--...
ENSBTAP00000050406  ..----...................................................................--...
ENSBTAP00000031879  ..----...................................................................--...
ENSBTAP00000031854  ..----...................................................................--...
ENSBTAP00000001250  ..-VAE...................................................................LT...
ENSBTAP00000026035  ..----...................................................................--...
ENSBTAP00000011215  ..----...................................................................--...
ENSBTAP00000002128  ..YLSK...................................................................PE...
ENSBTAP00000053194  ..----...................................................................--...
ENSBTAP00000056127  ..----...................................................................--...
ENSBTAP00000033188  ..----...................................................................--...
ENSBTAP00000053548  ..PTSR...................................................................LE...
ENSBTAP00000011687  ..NIKK...................................................................QQ...
ENSBTAP00000007636  ..ELSD...................................................................HV...
ENSBTAP00000020950  ..----...................................................................--...
ENSBTAP00000009115  ..----...................................................................--...
ENSBTAP00000023873  ..----...................................................................--...
ENSBTAP00000054471  ..----...................................................................--...
ENSBTAP00000039694  ..KLSP...................................................................HL...
ENSBTAP00000025205  ..----...................................................................--...
ENSBTAP00000047882  ..PMNE...................................................................DE...
ENSBTAP00000001368  ..----...................................................................--...
ENSBTAP00000029786  ..----...................................................................--...
ENSBTAP00000028993  ..----...................................................................--...
ENSBTAP00000023678  ..PVDD...................................................................SL...
ENSBTAP00000034710  ..----...................................................................--...
ENSBTAP00000031823  ..----...................................................................--...
ENSBTAP00000038002  ..---W...................................................................DVsel
ENSBTAP00000021074  ..----...................................................................--...
ENSBTAP00000026544  ..----...................................................................--...
ENSBTAP00000007217  ..WMTP...................................................................ET...
ENSBTAP00000029792  ..----...................................................................--...
ENSBTAP00000044088  ..ELSN...................................................................NI...
ENSBTAP00000017319  ..----...................................................................--...
ENSBTAP00000044100  ..----...................................................................--...
ENSBTAP00000033594  ..SHHD...................................................................VL...
ENSBTAP00000026766  ..----...................................................................--...
ENSBTAP00000055894  ..----...................................................................--...
ENSBTAP00000015220  ..----...................................................................--...
ENSBTAP00000033613  ..----...................................................................--...
ENSBTAP00000056320  ..RLDS...................................................................--...
ENSBTAP00000025249  ..HYTY...................................................................DE...
ENSBTAP00000029159  ..----...................................................................--...
ENSBTAP00000044088  ..ELSN...................................................................NI...
ENSBTAP00000016319  ..----...................................................................--...
ENSBTAP00000017662  ..----...................................................................--...
ENSBTAP00000012479  ..YLTL...................................................................SL...
ENSBTAP00000029886  ..-LRG...................................................................LC...
ENSBTAP00000027388  ..----...................................................................--...
ENSBTAP00000039694  ..KNEKretkgdeekramlrlqlygyhsptnsvlktdaeelvsrsywdtlrrntsqalfsdfaeradditnlvTD...
ENSBTAP00000023673  ..PLTP...................................................................EQ...
ENSBTAP00000041488  ..PLTP...................................................................EQ...
ENSBTAP00000001452  ..----...................................................................--...
ENSBTAP00000028498  ..----...................................................................--...
ENSBTAP00000001426  ..KLTS...................................................................EE...
ENSBTAP00000020240  ..HYTQ...................................................................SE...
ENSBTAP00000053650  ..HYTQ...................................................................SE...
ENSBTAP00000041651  ..PTTN...................................................................PVilv
ENSBTAP00000005154  ..----...................................................................--...
ENSBTAP00000021174  ..KNKQ...................................................................--...
ENSBTAP00000022068  ..----...................................................................--...
ENSBTAP00000026682  ..-HTD...................................................................AE...
ENSBTAP00000007636  ..ELSD...................................................................HV...
ENSBTAP00000027954  ..KLDP...................................................................HK...
ENSBTAP00000020778  ..----...................................................................--...
ENSBTAP00000013601  ..----...................................................................--...
ENSBTAP00000005477  ..HMTE...................................................................EE...
ENSBTAP00000055305  ..QYTQ...................................................................SE...
ENSBTAP00000036054  ..QYTQ...................................................................SE...
ENSBTAP00000004912  ..QVTP...................................................................ME...
ENSBTAP00000022292  ..MLTP...................................................................FV...
ENSBTAP00000002717  ..ELWA...................................................................QD...
ENSBTAP00000036015  ..----...................................................................--...
ENSBTAP00000051638  ..----...................................................................--...
ENSBTAP00000026766  ..KVPD...................................................................TL...
ENSBTAP00000053738  ..SLKE...................................................................EE...
ENSBTAP00000016306  ..V---...................................................................--...
ENSBTAP00000013714  ..----...................................................................--...
ENSBTAP00000036550  ..----...................................................................--...
ENSBTAP00000053738  ..PMDD...................................................................DQ...
ENSBTAP00000023383  ..----...................................................................--...
ENSBTAP00000027030  ..ENSQ...................................................................--...
ENSBTAP00000053270  ..ENSQ...................................................................--...
ENSBTAP00000054640  ..ENSQ...................................................................--...
ENSBTAP00000012770  ..----...................................................................--...
ENSBTAP00000009967  ..----...................................................................--...
ENSBTAP00000015183  ..----...................................................................--...
ENSBTAP00000014222  ..----...................................................................--...
ENSBTAP00000026288  ..FVNS...................................................................EQ...
ENSBTAP00000002128  ..LVVP...................................................................ET...
ENSBTAP00000003365  ..KCDE...................................................................DA...
ENSBTAP00000053738  ..----...................................................................--...
ENSBTAP00000009228  ..QFTG...................................................................PE...
ENSBTAP00000026785  ..HIST...................................................................SQ...
ENSBTAP00000002578  ..SWQQ...................................................................EQ...
ENSBTAP00000000106  ..----...................................................................--...
ENSBTAP00000028840  ..----...................................................................--...
ENSBTAP00000053594  ..----...................................................................--...
ENSBTAP00000055414  ..GMEK...................................................................ES...
ENSBTAP00000026698  ..----...................................................................--...
ENSBTAP00000017015  ..----...................................................................--...
ENSBTAP00000049908  ..HLSR...................................................................AQ...
ENSBTAP00000021395  ..----...................................................................--...
ENSBTAP00000007194  ..RLSA...................................................................EQ...
ENSBTAP00000025455  ..GMEK...................................................................ES...


                                             130                   140                              
                                               |                     |                              
d1br1b_               ......VEQL....VA...G....HE....DS....NGC....INYEELVRMVL--sg....................
ENSBTAP00000019411  ......VDEM....IRe..A....DI....DG....DGQ....VNYEEFVQMM---......................
ENSBTAP00000036057  ......VDEM....IRe..A....DI....DG....DGQ....VNYEEFVQMM---......................
ENSBTAP00000038404  ......TEKI....FRq..M....DT....NR....DGK....LSLEEFIR-----g.....................
ENSBTAP00000010971  ......TEKI....FRq..M....DT....NN....DGK....LSLEEFIR-----g.....................
ENSBTAP00000019803  ......YNMI....IR...R....YS....DE....GGN....MDFDNFISCLV--rldamfrafksldkdgtgqiqv
ENSBTAP00000014038  ......LQQI....VDk..TiinaDK....DG....DGR....ISFEEFCA-----v.....................
ENSBTAP00000002055  ......VDEM....IRe..A....DI....DG....DGQ....VNYEEFVQMMT--......................
ENSBTAP00000049731  ......VDEM....IRe..A....DI....DG....DGQ....VNYEEFVHMMT--......................
ENSBTAP00000005577  ......TDKI....FRq..M....DT....NN....DGK....LSLEEFIK-----gaksdpsivrllqc........
ENSBTAP00000034949  ......AEKI....WGf..F....GK....KD....DDK....LTEKEFIE-----g.....................
ENSBTAP00000017447  ......IIEM....--...YepdeDL....KK....QGL....ISSDGFCRYLM--sdenapvfldrlely.......
ENSBTAP00000010858  ......----....--...-....--....--....---....-------------giislck...............
ENSBTAP00000046644  ......VQVL....IEk..Y....EP....NNslakKGQ....ISVDGFMRYLS--geengvvspekldl........
ENSBTAP00000022814  ......VDKI....FSk..M....DK....NK....DDQ....ITLDEFKE-----aaksdpsivlllq.........
ENSBTAP00000019758  ......----....--...-....--....--....---....-------------gikekdidkdl...........
ENSBTAP00000019321  ......VDKI....FKk..M....DQ....DK....DDQ....ITLEEFKE-----aaksdpsivlllqc........
ENSBTAP00000011677  ......YDII....TM...R....YA....DK....YMN....IDFDSFICCFV--rlegmfrafnafdkdgdgiikl
ENSBTAP00000011680  ......YDII....TM...R....YA....DK....YMN....IDFDSFICCFV--rlegmfrafnafdkdgdgiikl
ENSBTAP00000021742  ......VESF....FQk..M....DR....NK....DGV....VTIEEFIESCQ--kdenimrsmqlfdn........
ENSBTAP00000005348  ......----....--...-....--....--....---....-------------enll..................
ENSBTAP00000016609  ......ARLL....IEk..Y....EP....N-....---....-------------kqflerdqmsmegfsrylggee
ENSBTAP00000012740  ......----....--...-....--....--....---....-------------alskg.................
ENSBTAP00000018403  ......LDAM....IRe..A....DV....DQ....DGR....VNYEEFVRILT--q.....................
ENSBTAP00000026407  ......----....--...-....--....--....---....-------------eeafdaicqlvagkepanvgvt
ENSBTAP00000052557  ......LQEM....IDe..A....DR....DG....DGE....VNEDEFLRIMK--k.....................
ENSBTAP00000054167  ......VETF....FQk..M....DK....NK....DGV....VTIDEFIESCQ--kdenimrsmqlf..........
ENSBTAP00000010319  ......LQEM....IDe..A....DR....DG....DGE....VNEQEFLRIMKK-t.....................
ENSBTAP00000041545  ......LELI....DR...Y....EP....SE....SGK....L------------rhvlsmdgflgylcskdgdifn
ENSBTAP00000055204  ......HDIL....IRk..F....DR....QG....RGQ....IAFDDFIQG----civlqrltdifrrydtdqdgwi
ENSBTAP00000003718  ......VDIF....FQk..M....DK....NK....DGI....VTLDEFLESC---qeddnimrslqlfq........
ENSBTAP00000011676  ......QQTI....AMr..Y....-A....CS....KLT....MDFDSFIACMI--rletlfklfrlldkdqngivql
ENSBTAP00000049395  ......----....--...-....--....--....---....-------------qreeeagpalalslieryepse
ENSBTAP00000054983  ......----....--...-....--....--....---....-------------eeavrevhkliegkapiisgvt
ENSBTAP00000052219  ......VNSI....AKr..Y....ST....N-....-GK....ITFDDYIACCVK-lraltdsfrrrdtaqqgvvnfp
ENSBTAP00000025402  ......----....--...-....--....--....---....-------------qrdsrlnsllfpparpdqvqgl
ENSBTAP00000011678  ......YELI....IT...R....YS....EP....DLA....VDFDNFVCCLV--rletmfrffktldtdldgvvtf
ENSBTAP00000000433  ......----....--...-....--....--....---....-------------megkdpattgvtkattvggvsr
ENSBTAP00000021491  ......LQEM....LDe..A....DH....DG....DGE....INKEEFLKMMQK-t.....................
ENSBTAP00000044733  ......HQVI....VAr..F....-A....DD....DLI....IDFDNFVRCLI--rletlfrifkqldpentgmiql
ENSBTAP00000010937  ......CIDI....IRk..F....EV....SE....ENKvknvLGIEGFTNFM---rspacdifnplhhevy......
ENSBTAP00000056439  ......CIDI....IRk..F....EV....SE....ENKvknvLGIEGFTNFM---rspacdifnplhhevy......
ENSBTAP00000055780  ......IEEL....MKd..G....DK....NN....DGR....IDYDEFLEFMK--g.....................
ENSBTAP00000038002  ......----....--...-....--....--....---....-------------sfqtgyyiedtvredvvclsdv
ENSBTAP00000034705  ......AQQL....IHt..Y....EL....NE....TAKqhelMTLDGFMMYLL--spegaaldlahtrvf.......
ENSBTAP00000035936  ......VDRI....FLl..V....DE....NG....DGQ....LSLNEFVE-----garrdkwvmkmlqmdln.....
ENSBTAP00000013699  ......TQLL....VSry.C....PR....SA....NPA....MQLDRFIQVCTQ-lqvlteafrekdtavqgsvrls
ENSBTAP00000002564  ......----....--...-....--....--....---....-------------ergilvnvplcvdmslnwllnv
ENSBTAP00000011496  ......VDRI....FAm..M....DK....NA....DGK....LTLQEFQE-----gskadpsivqalslydg.....
ENSBTAP00000019111  ......LRAM....IEe..F....DK....DG....DGE....INQEEFIAIM---t.....................
ENSBTAP00000017036  ......TDTV....FSk..I....DV....NG....DGE....LSLEEFMEGV---qkdqmlldtlt...........
ENSBTAP00000003213  ......CRDI....IEq..FepcpEN....KS....KGA....MGIDGFTN-----ytrspagdifnpehrlv.....
ENSBTAP00000055444  ......CRDI....IEq..FepcpEN....KS....KGA....MGIDGFTN-----ytrspagdifnpehrlv.....
ENSBTAP00000024550  ......VTTI....VKr..Y....--....SK....NGR....IFFDDYVACCV--klraltdffrrrdhlqqgvvsf
ENSBTAP00000015248  ......VDEM....YRe..A....PI....DK....KGN....FNYVEFTRILK--h.....................
ENSBTAP00000021328  ......VDEL....YRe..A....PI....DK....KGN....FNYIEFTRILK--h.....................
ENSBTAP00000037091  ......VDEL....YRe..A....PI....DK....KGN....FNYIEFTRILK--h.....................
ENSBTAP00000029967  ......VDEI....LRd..I....DL....NG....DGL....VDFEEFVRMM---......................
ENSBTAP00000021449  ......ISEV....VQe..A....DI....NG....DGT....VDFEEFVKMM---s.....................
ENSBTAP00000053176  ......----....--...-....--....--....---....-------------snkfphsspmvkskpallssgl
ENSBTAP00000042361  ......IEEI....IRd..V....DL....NG....DGR....VDFEEFVRMM---......................
ENSBTAP00000016509  ......VDRI....FLl..V....DE....NG....DGQ....LSLNEFVE-----garrdkwvmkmlqmdln.....
ENSBTAP00000026714  ......IEEI....IRd..V....DL....NG....DGR....VDFEEFVRMM---......................
ENSBTAP00000004690  ......TQVL....VA...R....YA....ND....SLI....MEFDSFISCFL--rlkamfktayfltmdpentgqi
ENSBTAP00000010858  ......----....--...-....--....--....---....-------------ggsniepsvrscfqfannkpei
ENSBTAP00000013117  ......SLEI....IHk..Y....EPskegQE....KGW....LSIDGFTNYLMS-pdcyifdpehkkvc........
ENSBTAP00000017574  ......ASEI....IQk..YepieEV....KQ....AHQ....MSFEGFRRYMD--ssecllfdnkcdhvy.......
ENSBTAP00000004885  ......AELI....LQs..I....DA....DG....TMT....VDWNEWRDYF---lfnpvtdieeiirfwkhstgid
ENSBTAP00000008961  ......----....--...-....--....--....---....-------------pwssllrnwnslav........
ENSBTAP00000028063  ......----....--...-....--....--....---....-------------cgg...................
ENSBTAP00000012740  ......----....--...-....--....--....---....-------------lepqsmvwlpvlhrvaaaet..
ENSBTAP00000006283  ......LEEM....LQe..V....DL....NG....DGT....VDFNEFVMMLS--r.....................
ENSBTAP00000014306  ......VEML....VA...G....HE....DS....NGC....INYEELVRMV---l.....................
ENSBTAP00000053252  ......CLDI....IRr..Y....EL....SEegrqKGF....LAIDGFTQYLL--ssecnifdpeqskv........
ENSBTAP00000014304  ......VEML....VA...G....HE....DS....NGC....INYEAFVRHI---l.....................
ENSBTAP00000045669  ......----....--...-....--....--....---....-------------cgg...................
ENSBTAP00000041264  ......----....--...-....--....--....---....-------------pwptllknwqllav........
ENSBTAP00000006711  ......----....--...-....--....--....---....-------------levdlpqplsthlflafsqkpr
ENSBTAP00000017358  ......----....--...-....--....--....---....-------------pwgsilrnwnflav........
ENSBTAP00000053274  ......----....--...-....--....--....---....-------------cgg...................
ENSBTAP00000055296  ......----....--...-....--....--....---....-------------pwgsilrnwnflav........
ENSBTAP00000016852  ......FRKF....LDn..F....DSpy..DK....DGV....VTPEEFMNYY---agvsasidtdvyfivmmrtaw.
ENSBTAP00000036380  ......VEDL....FRe..A....GI....EP....NGK....VKYDEFIQK----l.....................
ENSBTAP00000041719  ......VESV....LA...G....HE....DS....SGC....INYEAFLKHI---l.....................
ENSBTAP00000049636  ......VEAL....MA...G....QE....DS....NGC....INYEAFVKHI---m.....................
ENSBTAP00000024444  ......IDQM....FAa..F....PP....DV....TGN....LDYKNLVHIIT--hg....................
ENSBTAP00000004556  ......IKPL....FNs..C....DS....FK....DGK....LSNNEWCYCFQ--kpgglpcqne............
ENSBTAP00000038767  .....iADRT....IQe..A....DQ....DG....DSA....ISFTEFVKVLE--kvdveq................
ENSBTAP00000031285  ......IRPF....FNs..C....DT....YK....DGR....VSTAEWCFCF---wrekppclae............
ENSBTAP00000011457  egikdlVEIT....LKk..M....DH....DH....DGK....LSFADYEQAV---reetllleafgpclpdpks...
ENSBTAP00000011047  ......VEKL....MA...G....QE....DS....NGC....INYEAFVKHI---m.....................
ENSBTAP00000002564  ......----....--...-....--....--....---....-------------wvnlepqsmvwlavlhrvtiae
ENSBTAP00000037104  ......VKQM....FAa..F....PP....DV....CGN....LDYRNLCYVIT--hg....................
ENSBTAP00000002672  ......VEQM....FAl..T....PM....DL....AGN....IDYKSLCYIIT--hg....................
ENSBTAP00000028269  ......IKNM....WAa..F....PP....DV....GGN....VDYKNICYVIT--hg....................
ENSBTAP00000016647  ......LESIadrtVQe..A....DE....DG....DGA....VSFLEFAKSL---ekmnieqkm.............
ENSBTAP00000004536  ......AEKI....LHs..M....DR....DG....TMT....IDWQEWRDHF---llhslenvedvlyfwkhs....
ENSBTAP00000042177  ......VKKF....VEy..C....DV....NN....DKS....ISLQELMGCL---gatreevkad............
ENSBTAP00000028063  ......----....--...-....--....--....---....-------------lklptavfegpsfgytehsvrt
ENSBTAP00000050283  ......VEQL....LA...G....QE....DA....NGC....INYEAFVKHI---m.....................
ENSBTAP00000048539  ......VSTL....FRe..I....AG....PN....SDR....ISYRTFKKF----alkhpayaklfssyldl.....
ENSBTAP00000045669  ......----....--...-....--....SQ....QKK....VTLNGF-------ldtlmsdpppqclvwlpllhrl
ENSBTAP00000007972  ......LRHF....LDn..F....DSs...EK....DGQ....VTLAEFQDYY---sgvsasmdtdeefvammtsa..
ENSBTAP00000040815  ......----....--...-....--....--....---....-------------gvskeg................
ENSBTAP00000025661  ......VSGL....FKe..I....--....AQ....GDS....VSYEEFKSF----alkhpeyakifttyldlqt...
ENSBTAP00000028350  ......MKQL....IDn..IleesDI....DR....DGT....INLSEFQHVI---srspdfassfki..........
ENSBTAP00000053274  ......----....--...-....--....SQ....QKK....VTLNGF-------ldtlmsdpppqclvwlpllhrl
ENSBTAP00000021537  ......CEKV....LDe..A....DG....DH....DGR....LSLEDFQNMIL--rapdflstfhi...........
ENSBTAP00000055481  ......----....--...-....--....--....---....-------------vamsgqplppvlppeyippsfr
ENSBTAP00000039155  ......VEEM....IRa..A....HM....DA....DGQ....VNCEEFMHLL---v.....................
ENSBTAP00000029333  ......----....--...-....--....--....---....-------------vamsgqplppvlppeyippsfr
ENSBTAP00000016315  ......----....--...-....--....--....---....-------------ngyplpeglpptlqpey.....
ENSBTAP00000021091  ......CQLM....LI...R....YG....GP....DLQ....MNFVRFVRLMLR-venmedvfqnltqdgkgiy...
ENSBTAP00000021618  .....vVESM....FRe..S....GF....QD....KQE....LTWEDFHFMLR--dhdselrftqlcv.........
ENSBTAP00000055520  ......----....--...-....--....--....---....-------------apaaaalitlsg..........
ENSBTAP00000055624  ......----....--...-....--....--....---....-------------apaaaalitlsg..........
ENSBTAP00000016319  ......----....--...-....--....--....---....-------------rkngydlpeklpeslmpkl...
ENSBTAP00000034078  ......MEEM....LSa..A....ID....PE....SNS....IHYKDYITMM---......................
ENSBTAP00000006645  ......LTDL....TSh..VlnesDL....DN....DNM....LSFSEFEHAM---akspdfmnsfrihfw.......
ENSBTAP00000021909  ......ARHL....VYe..S....DQ....NK....DGK....LTKEEIVD-----kydlfvgsqatdfgeal.....
ENSBTAP00000001426  ......TQTI....LRm..F....DL....NG....DGK....LGLSEMSR-----ll....................
ENSBTAP00000015802  ......AEKI....LKs..M....DK....NG....TMT....IDWNEWRDY----hllhpvenipeiilywkhs...
ENSBTAP00000032680  ......AEKI....LKs..M....DK....NG....TMT....IDWNEWRDY----hllhpvenipeiilywkhs...
ENSBTAP00000055007  ......----....--...-....--....--....---....-------------......................
ENSBTAP00000020148  ......----....--...-....--....--....---....-------------gglaiachesfiksa.......
ENSBTAP00000052345  ......----....--...-....--....--....---....-------------qklikgidpphiltpemipp..
ENSBTAP00000029334  ......----....--...-....--....--....---....-------------dmakagqplplalppelvppsf
ENSBTAP00000052345  ......LGRV....WEl..S....DI....DH....DGM....LDRDEFAVAM---flvycalekepvpmslppalvp
ENSBTAP00000056127  ......ARHL....VYe..S....DK....NK....DEK....LTKEEILD-----nwnmfvgsqatnygedl.....
ENSBTAP00000012557  ......FDEL....AEr..M....DL....NK....DGS....IDFNEFLKAF---yv....................
ENSBTAP00000011888  ......LDQLtlalFEs..A....DK....DC....SGT....ITFEELRDELQ--rfpgvlenl.............
ENSBTAP00000017060  ......LGRV....WDl..S....DI....DK....DGH....LDRDEFAVAM---hlvyralekepvpsvlppslip
ENSBTAP00000031854  ......LCQM....LDl..V....KP....AS....DGK....ITLRDLKR-----crmah.................
ENSBTAP00000031823  ......ANHL....LHe..S....DT....DK....DGR....LSKAEI-------lgnwnmfvgsqatnygedl...
ENSBTAP00000021603  ......VESM....FRe..S....GF....QD....KQE....LTWEDFHFMLR--dhdselrrtqlc..........
ENSBTAP00000010838  ......----....--...-....--....--....---....-------------tdyhnhshgaqlc.........
ENSBTAP00000014575  .....vCDKV....IEe..A....DL....DG....DGK....LGFADFEDMI---akapdflr..............
ENSBTAP00000011215  ......LCQM....LDl..V....KP....AS....DGK....ITLRDLKR-----crmah.................
ENSBTAP00000053698  ......IENI....I-...-....--....--....---....-------------......................
ENSBTAP00000006806  ......----....--...-....--....--....---....-------------altvacnnffw...........
ENSBTAP00000029334  ......----....--...-....--....--....---....-------------lklqgqqlpvvlppimkqpp..
ENSBTAP00000044105  ......----....--...-....--....--....---....-------------tdyhnhshgaqlc.........
ENSBTAP00000026904  ......----....--...-....--....--....---....-------------vacndyfveql...........
ENSBTAP00000017060  ......----....--...-....--....--....---....-------------qkvskgidppqvlspdmvppse
ENSBTAP00000055520  ......----....--...-....--....--....---....-------------rrvlrnlltdlqqiptvvgesr
ENSBTAP00000044226  ......----....--...-....--....--....---....-------------altvacnnffw...........
ENSBTAP00000055624  ......----....--...-....--....--....---....-------------rrvlrnlltdlqqiptvvgesr
ENSBTAP00000042182  ......TQAL....TS...R....YR....DS....RLR....VDFERFVSCMA--qlicvfrycsqhldggegvvcl
ENSBTAP00000010796  ......FFHI....LEy..Y....DK....TL....SSK....ISYNDFLRA----f.....................
ENSBTAP00000021174  ......TDLM....LKl..F....DS....NN....DGK....LELTEMARL----lp....................
ENSBTAP00000006275  ......----....--...-....--....--....---....-------------tacheff...............
ENSBTAP00000020950  ......ARHL....IDe..M....DL....NS....DRK....LSEEEIL------enqdlfltseatdygrqlhd..
ENSBTAP00000053738  ......FFHI....LEy..Y....DK....TL....SSK....ISYNDFLRA----f.....................
ENSBTAP00000004963  ......----....--...-....--....--....---....-------------lhqqsp................
ENSBTAP00000023774  ......IENI....I-...-....--....--....---....-------------m.....................
ENSBTAP00000020395  ......ADYC....VSh..M....--....--....---....-------------kpyvdgkgrelptafdyvef..
ENSBTAP00000020150  ......VDKI....MKd..L....DQ....CR....DGK....VGFQSFFSLI---agltiacndyfvv.........
ENSBTAP00000025561  ......----....--...-....--....--....---....-------------mmcneffeg.............
ENSBTAP00000053738  ......FEKL....WMr..Y....DS....EG....RGH....ITYQEFLQ-----k.....................
ENSBTAP00000034009  ......----....--...-....--....--....---....-------------ktahidihk.............
ENSBTAP00000020539  ......ICDL....ARs..I....DF....NK....DGH....IDINEFLEAF---rl....................
ENSBTAP00000020778  ......AKQM....IAi..A....DE....NQ....NHY....LEPEEVLK-----ysefftgsklvdyar.......
ENSBTAP00000017461  ......ILEV....F-...-....--....--....---....-------------sd....................
ENSBTAP00000044096  ......----....--...-....--....--....---....-------------tvasheemhntap.........
ENSBTAP00000008523  ......----....--...-....--....--....---....-------------tvasheemhntap.........
ENSBTAP00000035196  ......----....NNt..V....GT....NE....KGW....ITYQGFLS-----qwtl..................
ENSBTAP00000041997  ......LGKI....WKl..A....DI....DK....DGM....LDDEEFA------lanhlikvkleghelpnelpah
ENSBTAP00000025499  ......TKTL....LAa..G....DK....DG....DGK....IGADEFST-----lv....................
ENSBTAP00000055481  ......----....--...-....--....--....---....-------------klklqgyqlpsalppvmkqq..
ENSBTAP00000002174  ......LGKI....WKl..A....DV....DR....DGL....LDDEEFA------lanhlikvkleghelpadlpph
ENSBTAP00000000589  ......LKKL....MGd..L....DE....NS....DQQ....VDFQEYAVFL---alitimcndffq..........
ENSBTAP00000028239  ......----....--...-....--....--....---....-------------ashlieakleghglptnlprrl
ENSBTAP00000014894  ......----....--...-....--....--....---....-------------ppdqaeyciarm..........
ENSBTAP00000026544  ......REIL....LRh..C....DV....NK....DGK....IQKSELAL-----cl....................
ENSBTAP00000029333  ......----....--...-....--....--....---....-------------klklqgyqlpsalppvmkqq..
ENSBTAP00000041966  ......LDLM....KL...R....YS....DS....TGR....VSFPSLVCLLMR-leamakafqnlskdgkglylte
ENSBTAP00000008933  ......LGKI....WKl..A....DC....DG....DGM....LDEEEFA------lakhlikiklsgyelpsslpph
ENSBTAP00000056088  ......----....--...-....--....--....---....-------------ktah..................
ENSBTAP00000033794  ......----....--...-....--....--....---....-------------kdyhlqyhrqlcahyc......
ENSBTAP00000012786  ......AQ--....--...-....--....--....---....-------------ycikrmp...............
ENSBTAP00000030018  ......----....--...-....--....--....---....-------------paeqaeycirrm..........
ENSBTAP00000040233  ......YKKF....AQh..Y....NI....DK....DAA....VDYNVFLKN----l.....................
ENSBTAP00000003365  ......VNAI....INl..A....DV....NA....DGK....FDYIKFCKLY---ma....................
ENSBTAP00000053176  ......LHEM....MEe..I....DY....DH....DGT....VSLEEWIQ-----g.....................
ENSBTAP00000024301  ......----....--...-....--....--....---....-------------ppdqa.................
ENSBTAP00000022292  ......DCEF....IRlh.F....GH....NR....KKH....LNYTEFTQFLQ--e.....................
ENSBTAP00000015611  ......----....--...-....--....--....---....-------------amacnkv...............
ENSBTAP00000012770  ......KDEI....FDm..V....KP....KD....PLK....ISLQDL-------in....................
ENSBTAP00000000847  ......IDDL....MKs..L....DK....NS....DQE....IDFKEYSVFL---ttlcmayndffle.........
ENSBTAP00000053738  ......YKKF....AQh..Y....NI....DK....DAA....VDYNVFLKN----l.....................
ENSBTAP00000054975  ......TKSL....MAa..A....DN....DG....DGK....IGADEFQEM----v.....................
ENSBTAP00000046639  ......KSSF....LEt..Lkd..AC....SK....SDE....VSYGEFEDY----y.....................
ENSBTAP00000052345  ......----....--...-....--....--....---....-------------caqnglevslsslnlavppprf
ENSBTAP00000053164  ......FENV....WNl..A....SKk...HH....RGE....V------------cvenirs...............
ENSBTAP00000016774  ......----....--...-....--....--....---....-------------gleaheeihk............
ENSBTAP00000022630  ......----....--...-....--....--....---....-------------k.....................
ENSBTAP00000010796  ......FDRL....WEe..M....PV....NS....KGR....LRYLDFLS-----sf....................
ENSBTAP00000021909  ......DERR....FKm..A....DK....DG....DLI....ATKEEFTAF----l.....................
ENSBTAP00000033974  ......--QM....MKe..A....DE....NG....DGT....LNYE---------a.....................
ENSBTAP00000006711  .....iLKEM....LQg..M....DY....DR....DGF....VSLEEWVH-----ggmttipllvllgmddsg....
ENSBTAP00000010796  ......LIDL....LNr..T....SWgia.WH....NNS....INYLDFLRA----ve....................
ENSBTAP00000004912  ......DSEF....VQlh.F....GK....ER....KRH....LTYAEFTQFLL--e.....................
ENSBTAP00000005979  ......----....--...-....--....--....---....-------------paapwgphlpstvrtkagrlpl
ENSBTAP00000053738  ......FDRL....WEe..M....PV....NS....KGR....LRYLDFLS-----sf....................
ENSBTAP00000053746  ......----....--...-....--....--....---....-------------iekesarsiadgammeaasvcv
ENSBTAP00000023221  ......----....--...-....--....--....---....-------------at....................
ENSBTAP00000019429  ......----....--...-....--....--....---....-------------aa....................
ENSBTAP00000052019  ......----....--...-....--....--....---....-------------aqacyh................
ENSBTAP00000042244  ......----....--...-....--....--....---....-------------aagelqe...............
ENSBTAP00000053738  ......LVKL....CSk..F....QD....IA....SGR....ILYKKLLAC----lgi...................
ENSBTAP00000018877  ......ADKL....IQn..L....DA....NH....DGR....ISFDEYWTLI---ggitspianli...........
ENSBTAP00000053019  ......----....--...-....--....--....---....-------------ktfrki................
ENSBTAP00000003073  ......----....--...-....--....--....---....-------------ast...................
ENSBTAP00000012886  ......----....--...-....--....--....---....-------------k.....................
ENSBTAP00000044222  ......----....--...-....--....--....---....-------------iycheyfk..............
ENSBTAP00000028499  ......----....--...-....--....--....---....-------------gelakeirk.............
ENSBTAP00000047378  ......LEDL....FNk..L....DQ....DG....DGR....VSLEELQ------lglf..................
ENSBTAP00000009308  ......----....--...-....--....--....---....-------------stevaktfrk............
ENSBTAP00000017060  ......----....--...-....--....--....---....-------------caqsghevtlsnlnlnmpppkf
ENSBTAP00000050406  ......----....--...-....--....--....---....-------------inrkegicalggtselssegtq
ENSBTAP00000031879  ......----....--...-....--....--....---....-------------inrkegicalggtselssegtq
ENSBTAP00000031854  ......----....--...-....--....--....---....-------------......................
ENSBTAP00000001250  ......VTDL....FRa..I....DQ....ER....KGR....IAFADFKRF----aeanpdfaeeylyp........
ENSBTAP00000026035  ......----....--...-....--....--....---....-------------aqacfet...............
ENSBTAP00000011215  ......----....--...-....--....--....---....-------------......................
ENSBTAP00000002128  ......FQKI....TE...-....--....--....---....-------------ltev..................
ENSBTAP00000053194  ......----....--...-....--....--....---....-------------peq...................
ENSBTAP00000056127  ......----....--...-....--....--....---....-------------h.....................
ENSBTAP00000033188  ......----....--...-....--....--....---....-------------pnkd..................
ENSBTAP00000053548  ......MSAV....ADi..F....DR....DG....DGY....IDYYEFVAAL---hpnkd.................
ENSBTAP00000011687  ......LRDL....YYn..F....DI....TG....DRKl...LNYKEFK------lf....................
ENSBTAP00000007636  ......CDVV....FAl..F....DC....DG....NGE....LSNKEFVSIM---k.....................
ENSBTAP00000020950  ......-KKR....FEk..A....NQ....DS....GPG....LNLEEFI------af....................
ENSBTAP00000009115  ......----....--...-....--....--....---....-------------td....................
ENSBTAP00000023873  ......----....--...-....--....--....---....-------------e.....................
ENSBTAP00000054471  ......----....--...-....--....--....---....-------------fsqnn.................
ENSBTAP00000039694  ......VNTV....FKi..F....DV....DK....DDQ....LSYKEFIGIM---k.....................
ENSBTAP00000025205  ......----....--...-....--....--....---....-------------fsqnn.................
ENSBTAP00000047882  ......LINL....IDg..VlrddDK....NN....DGY....IDYAEFAK-----s.....................
ENSBTAP00000001368  ......----....--...-....--....--....---....-------------rss...................
ENSBTAP00000029786  ......----....--...-....--....--....---....-------------h.....................
ENSBTAP00000028993  ......----....--...-....--....--....---....-------------gf....................
ENSBTAP00000023678  ......IKEL....IR...M....CS....HG....EDK....IDYYNFVRAF---s.....................
ENSBTAP00000034710  ......----....--...-....--....--....---....-------------rlaqclgkvrnswaydpqglqt
ENSBTAP00000031823  ......----....--...-....--....--....---....-------------lh....................
ENSBTAP00000038002  ...rpiLQEM....MKe..I....DY....DG....SGS....VSLAEWLR-----a.....................
ENSBTAP00000021074  ......----....--...-....--....--....---....-------------nvcyldtqsl............
ENSBTAP00000026544  ......----....--...-....--....--....---....-------------flh...................
ENSBTAP00000007217  ......IQEM....YSaikA....DP....DG....DGV....LSLQEFSNM----dlrdfhkymrshraessqlvrn
ENSBTAP00000029792  ......----....--...-....--....--....---....-------------h.....................
ENSBTAP00000044088  ......LDTV....FKi..F....DL....DG....DEC....LSHEEFLGVL---k.....................
ENSBTAP00000017319  ......----....--...-....--....--....---....-------------tim...................
ENSBTAP00000044100  ......----....--...-....--....--....---....-------------ksqlhckmgpgfvhnf......
ENSBTAP00000033594  ......VEDI....FDk..E....DE....DK....DGF....ISAREF-------t.....................
ENSBTAP00000026766  ......----....--...-....--....--....---....-------------plaerqkycfllvqvnk.....
ENSBTAP00000055894  ......----....--...-....--....--....---....-------------l.....................
ENSBTAP00000015220  ......----....--...-....--....--....---....-------------......................
ENSBTAP00000033613  ......----....--...-....--....--....---....-------------......................
ENSBTAP00000056320  ......----....--...-....--....--....---....-------------maiealpfedcmcqmldlvkpq
ENSBTAP00000025249  ......ILSI....IQk..FepsvSM....CH....QGL....MSFEGFARFLM--dkdnfa................
ENSBTAP00000029159  ......----....--...-....--....--....---....-------------ra....................
ENSBTAP00000044088  ......LDTV....FKi..F....DL....DG....DEC....LSHEEFLGVLK--n.....................
ENSBTAP00000016319  ......----....--...-....--....--....---....-------------vaqsgfplrvesintvkdlp..
ENSBTAP00000017662  ......----....--...-....--....--....---....-------------rrf...................
ENSBTAP00000012479  ......LETL....LNh..Q....DL....GY....QNE....IKWENFVEWL---......................
ENSBTAP00000029886  ......VDAL....IEl..S....DE....NA....DWK....LSFQEFLKCL---......................
ENSBTAP00000027388  ......----....--...-....--....--....---....-------------l.....................
ENSBTAP00000039694  ......TTLL....VHf..F....GK....KG....KAE....LNFEDFYRFM---dn....................
ENSBTAP00000023673  ......LEAV....FEs..L....DQ....AH....TGF....LTAREFC------lgl...................
ENSBTAP00000041488  ......LEAV....FEs..L....DQ....AH....TGF....LTAREFC------lgl...................
ENSBTAP00000001452  ......----....--...-....--....--....---....-------------nvy...................
ENSBTAP00000028498  ......----....--...-....--....--....---....-------------ige...................
ENSBTAP00000001426  ......FNAI....FTf..Y....DK....DG....SGY....IDENELDALLK--dly...................
ENSBTAP00000020240  ......TEFL....LSc..A....ET....DE....NET....LDYEEFVKR----f.....................
ENSBTAP00000053650  ......TEFL....LSc..A....ET....DE....NET....LDYEEFVKR----f.....................
ENSBTAP00000041651  ......VDKV....LEt..Q....DL....NG....DGL....MTPAELVN-----f.....................
ENSBTAP00000005154  ......----....--...-....--....--....---....-------------lg....................
ENSBTAP00000021174  ......----....--...-....--....--....---....-------------dldinniptykksi........
ENSBTAP00000022068  ......----....--...-....--....--....---....-------------rngdpds...............
ENSBTAP00000026682  ......IEAI....FTk..Y....DQ....DG....DQE....LTEHE--------hqqm..................
ENSBTAP00000007636  ......CDVV....FAl..F....DC....DG....NGE....LSNKEFVSIM---k.....................
ENSBTAP00000027954  ......REVL....LAl..A....DS....HA....NGQ....ICYQDFVNLM---......................
ENSBTAP00000020778  ......----....--...-....--....--....---....-------------kv....................
ENSBTAP00000013601  ......----....--...-....--....--....---....-------------iaatqrgv..............
ENSBTAP00000005477  ......MTDC....FAtl.F....--....--....---....-------------glnpe.................
ENSBTAP00000055305  ......IDFL....LSc..A....EA....DE....NDM....FNYIDFVDR----f.....................
ENSBTAP00000036054  ......IDFL....LSc..A....EA....DE....NDM....FNYIDFVDR----f.....................
ENSBTAP00000004912  ......VDIL....FQl..A....D-....--....---....-------------l.....................
ENSBTAP00000022292  ......EENL....VSa..A....GG....SI....SHQ....VSFSYF-------nafnsllnnmelvrkiystlag
ENSBTAP00000002717  ......LNKV....--...-....--....--....---....-------------rermtkfiddtmretaepflfv
ENSBTAP00000036015  ......----....--...-....--....--....---....-------------egafvkehfdelcwtltakkny
ENSBTAP00000051638  ......----....--...-....--....--....---....-------------fsqlh.................
ENSBTAP00000026766  ......RKCF....--...-....--....SE....GEK....VNYEKFRNWL---llnkdaftfsrwlls.......
ENSBTAP00000053738  ......LIDL....LNr..T....SWgia.WH....NNS....INYLDFLRAV---ennk..................
ENSBTAP00000016306  ......----....--...-....--....--....---....-------------vdssvnhs..............
ENSBTAP00000013714  ......----....--...-....--....--....---....-------------qe....................
ENSBTAP00000036550  ......----....--...-....--....--....---....-------------lh....................
ENSBTAP00000053738  ......YALL....TTk..L....GY....KK....EGM....-------------syldfa................
ENSBTAP00000023383  ......----....--...-....--....--....---....-------------saqktmdlpfleasalragerp
ENSBTAP00000027030  ......--EI....LKa..L....DF....SL....DGN....VNLTELTLAL---enellv................
ENSBTAP00000053270  ......--EI....LKa..L....DF....SL....DGN....VNLTELTLAL---enellv................
ENSBTAP00000054640  ......--EI....LKa..L....DF....SL....DGN....VNLTELTLAL---enellv................
ENSBTAP00000012770  ......----....--...-....--....--....---....-------------iptlpqldgleksfysfyvcta
ENSBTAP00000009967  ......----....--...-....--....--....---....-------------glwftgd...............
ENSBTAP00000015183  ......----....--...-....--....--....---....-------------lyekd.................
ENSBTAP00000014222  ......----....--...-....--....--....---....-------------qketqqkl..............
ENSBTAP00000026288  ......LAAI....AQl..H....EK....VR....GGG....VNINEFFK-----gtrylsk...............
ENSBTAP00000002128  ......LQEV....IKy..A....DI....NS....NQM....VDIGDI-------ift...................
ENSBTAP00000003365  ......WAVC....REn..F....DT....KK....N-E....-------------ltrqgfmdlnl...........
ENSBTAP00000053738  ......----....--...-....--....--....---....-------------s.....................
ENSBTAP00000009228  ......IQFL....LSc..S....EA....DE....NEM....INCEEFAN-----rf....................
ENSBTAP00000026785  ......V---....--...-....--....--....---....-------------aeiva.................
ENSBTAP00000002578  ......FENY....KIn..F....DD....SK....D--....-------------g.....................
ENSBTAP00000000106  ......----....--...-....--....--....---....-------------al....................
ENSBTAP00000028840  ......----....--...-....--....--....---....-------------lastykqwsla...........
ENSBTAP00000053594  ......----....--...-....--....--....---....-------------anlqgelshiirql........
ENSBTAP00000055414  ......----....--...-....--....--....---....-------------mkk...................
ENSBTAP00000026698  ......----....--...-....--....--....---....-------------......................
ENSBTAP00000017015  ......----....--...-....--....--....---....-------------lll...................
ENSBTAP00000049908  ......VKKL....LN...-....--....--....---....-------------kv....................
ENSBTAP00000021395  ......----....--...-....--....--....---....-------------nl....................
ENSBTAP00000007194  ......AKQL....VS...-....--....--....---....-------------ra....................
ENSBTAP00000025455  ......----....--...-....--....--....---....-------------mkk...................


                                                                                                    
                                                                                                    
d1br1b_               ..............................................................................
ENSBTAP00000019411  ..............................................................................
ENSBTAP00000036057  ..............................................................................
ENSBTAP00000038404  ..............................................................................
ENSBTAP00000010971  ..............................................................................
ENSBTAP00000019803  niqewlqltm....................................................................
ENSBTAP00000014038  ..............................................................................
ENSBTAP00000002055  ..............................................................................
ENSBTAP00000049731  ..............................................................................
ENSBTAP00000005577  ..............................................................................
ENSBTAP00000034949  ..............................................................................
ENSBTAP00000017447  ..............................................................................
ENSBTAP00000010858  ..............................................................................
ENSBTAP00000046644  ..............................................................................
ENSBTAP00000022814  ..............................................................................
ENSBTAP00000019758  ..............................................................................
ENSBTAP00000019321  ..............................................................................
ENSBTAP00000011677  nvlewlqltmy...................................................................
ENSBTAP00000011680  nvlewlqltm....................................................................
ENSBTAP00000021742  ..............................................................................
ENSBTAP00000005348  ..............................................................................
ENSBTAP00000016609  ngilpleald....................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000018403  ..............................................................................
ENSBTAP00000026407  kaktggaverltdtskytgshker......................................................
ENSBTAP00000052557  ..............................................................................
ENSBTAP00000054167  ..............................................................................
ENSBTAP00000010319  ..............................................................................
ENSBTAP00000041545  ptchply.......................................................................
ENSBTAP00000055204  qvsyeqylsmv...................................................................
ENSBTAP00000003718  ..............................................................................
ENSBTAP00000011676  slaewlccv.....................................................................
ENSBTAP00000049395  takaqrqmtkdgflmyllsadgsafdlahrrvy.............................................
ENSBTAP00000054983  kaissptvsrltdtskftgshker......................................................
ENSBTAP00000052219  yddfiqcvms....................................................................
ENSBTAP00000025402  idkyepsginvqrgqlspegmvwflcgpensvlaqdkl........................................
ENSBTAP00000011678  dlfkwlqltm....................................................................
ENSBTAP00000000433  ltdtskytgthker................................................................
ENSBTAP00000021491  ..............................................................................
ENSBTAP00000044733  dliswlsf......................................................................
ENSBTAP00000010937  ..............................................................................
ENSBTAP00000056439  ..............................................................................
ENSBTAP00000055780  ..............................................................................
ENSBTAP00000038002  scyfslleggrpedkleft...........................................................
ENSBTAP00000034705  ..............................................................................
ENSBTAP00000035936  ..............................................................................
ENSBTAP00000013699  fedfvtmt......................................................................
ENSBTAP00000002564  fdrpsgrsgkmralsfktgiaclcg.....................................................
ENSBTAP00000011496  ..............................................................................
ENSBTAP00000019111  ..............................................................................
ENSBTAP00000017036  ..............................................................................
ENSBTAP00000003213  ..............................................................................
ENSBTAP00000055444  ..............................................................................
ENSBTAP00000024550  vyddflqgtm....................................................................
ENSBTAP00000015248  ..............................................................................
ENSBTAP00000021328  ..............................................................................
ENSBTAP00000037091  ..............................................................................
ENSBTAP00000029967  ..............................................................................
ENSBTAP00000021449  ..............................................................................
ENSBTAP00000053176  kmnkgaitpprtspantcspevihlkdivcylsllergrpedklefm...............................
ENSBTAP00000042361  ..............................................................................
ENSBTAP00000016509  ..............................................................................
ENSBTAP00000026714  ..............................................................................
ENSBTAP00000004690  sldlnqwlqitm..................................................................
ENSBTAP00000010858  eaalfldwmrlepqsmvwlpvlhrvaaaet................................................
ENSBTAP00000013117  ..............................................................................
ENSBTAP00000017574  ..............................................................................
ENSBTAP00000004885  igdsltipdefte.................................................................
ENSBTAP00000008961  ..............................................................................
ENSBTAP00000028063  ..............................................................................
ENSBTAP00000012740  ..............................................................................
ENSBTAP00000006283  ..............................................................................
ENSBTAP00000014306  ..............................................................................
ENSBTAP00000053252  ..............................................................................
ENSBTAP00000014304  ..............................................................................
ENSBTAP00000045669  ..............................................................................
ENSBTAP00000041264  ..............................................................................
ENSBTAP00000006711  qktpehpkegasnseasgadsdiqnadnaakadeacapdmetkitekqvpaknqaaatpvgnlvapssgsespivylk
ENSBTAP00000017358  ..............................................................................
ENSBTAP00000053274  ..............................................................................
ENSBTAP00000055296  ..............................................................................
ENSBTAP00000016852  ..............................................................................
ENSBTAP00000036380  ..............................................................................
ENSBTAP00000041719  ..............................................................................
ENSBTAP00000049636  ..............................................................................
ENSBTAP00000024444  ..............................................................................
ENSBTAP00000004556  ..............................................................................
ENSBTAP00000038767  ..............................................................................
ENSBTAP00000031285  ..............................................................................
ENSBTAP00000011457  ..............................................................................
ENSBTAP00000011047  ..............................................................................
ENSBTAP00000002564  ..............................................................................
ENSBTAP00000037104  ..............................................................................
ENSBTAP00000002672  ..............................................................................
ENSBTAP00000028269  ..............................................................................
ENSBTAP00000016647  ..............................................................................
ENSBTAP00000004536  ..............................................................................
ENSBTAP00000042177  ..............................................................................
ENSBTAP00000028063  cfpqqkkimlnmfldtmmadpppqclvwlplmhrlahven......................................
ENSBTAP00000050283  ..............................................................................
ENSBTAP00000048539  ..............................................................................
ENSBTAP00000045669  anven.........................................................................
ENSBTAP00000007972  ..............................................................................
ENSBTAP00000040815  ..............................................................................
ENSBTAP00000025661  ..............................................................................
ENSBTAP00000028350  ..............................................................................
ENSBTAP00000053274  anven.........................................................................
ENSBTAP00000021537  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000039155  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000016315  ..............................................................................
ENSBTAP00000021091  ..............................................................................
ENSBTAP00000021618  ..............................................................................
ENSBTAP00000055520  ..............................................................................
ENSBTAP00000055624  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000034078  ..............................................................................
ENSBTAP00000006645  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000015802  ..............................................................................
ENSBTAP00000032680  ..............................................................................
ENSBTAP00000055007  ..............................................................................
ENSBTAP00000020148  ..............................................................................
ENSBTAP00000052345  ..............................................................................
ENSBTAP00000029334  r.............................................................................
ENSBTAP00000052345  pskr..........................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000012557  ..............................................................................
ENSBTAP00000011888  ..............................................................................
ENSBTAP00000017060  pskr..........................................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000021603  ..............................................................................
ENSBTAP00000010838  ..............................................................................
ENSBTAP00000014575  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000053698  ..............................................................................
ENSBTAP00000006806  ..............................................................................
ENSBTAP00000029334  ..............................................................................
ENSBTAP00000044105  ..............................................................................
ENSBTAP00000026904  ..............................................................................
ENSBTAP00000017060  r.............................................................................
ENSBTAP00000055520  alcsvesatrscfqgvlspvikeekflswlqseppillwiptcyrlsatem...........................
ENSBTAP00000044226  ..............................................................................
ENSBTAP00000055624  alcsvesatrscfqgvlspvikeekflswlqseppillwiptcyrlsatem...........................
ENSBTAP00000042182  thrqwmq.......................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000006275  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000004963  ..............................................................................
ENSBTAP00000023774  ..............................................................................
ENSBTAP00000020395  ..............................................................................
ENSBTAP00000020150  ..............................................................................
ENSBTAP00000025561  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000034009  ..............................................................................
ENSBTAP00000020539  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000017461  ..............................................................................
ENSBTAP00000044096  ..............................................................................
ENSBTAP00000008523  ..............................................................................
ENSBTAP00000035196  ..............................................................................
ENSBTAP00000041997  lvppskr.......................................................................
ENSBTAP00000025499  ..............................................................................
ENSBTAP00000055481  ..............................................................................
ENSBTAP00000002174  lvppskr.......................................................................
ENSBTAP00000000589  ..............................................................................
ENSBTAP00000028239  vppskr........................................................................
ENSBTAP00000014894  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000029333  ..............................................................................
ENSBTAP00000041966  mewmnlvm......................................................................
ENSBTAP00000008933  lvppshr.......................................................................
ENSBTAP00000056088  ..............................................................................
ENSBTAP00000033794  ..............................................................................
ENSBTAP00000012786  ..............................................................................
ENSBTAP00000030018  ..............................................................................
ENSBTAP00000040233  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053176  ..............................................................................
ENSBTAP00000024301  ..............................................................................
ENSBTAP00000022292  ..............................................................................
ENSBTAP00000015611  ..............................................................................
ENSBTAP00000012770  ..............................................................................
ENSBTAP00000000847  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000054975  ..............................................................................
ENSBTAP00000046639  ..............................................................................
ENSBTAP00000052345  hd............................................................................
ENSBTAP00000053164  ..............................................................................
ENSBTAP00000016774  ..............................................................................
ENSBTAP00000022630  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000021909  ..............................................................................
ENSBTAP00000033974  ..............................................................................
ENSBTAP00000006711  ..............................................................................
ENSBTAP00000010796  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000005979  hgylcqwtl.....................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000053746  gqmepdqvyegitfddflkiwqgidietkmhvrf............................................
ENSBTAP00000023221  ..............................................................................
ENSBTAP00000019429  ..............................................................................
ENSBTAP00000052019  ..............................................................................
ENSBTAP00000042244  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000018877  ..............................................................................
ENSBTAP00000053019  ..............................................................................
ENSBTAP00000003073  ..............................................................................
ENSBTAP00000012886  ..............................................................................
ENSBTAP00000044222  ..............................................................................
ENSBTAP00000028499  ..............................................................................
ENSBTAP00000047378  ..............................................................................
ENSBTAP00000009308  ..............................................................................
ENSBTAP00000017060  hd............................................................................
ENSBTAP00000050406  hsyseeekyafvnwinkalendpd......................................................
ENSBTAP00000031879  hsyseeekyafvnwinkalendpd......................................................
ENSBTAP00000031854  ..............................................................................
ENSBTAP00000001250  ..............................................................................
ENSBTAP00000026035  ..............................................................................
ENSBTAP00000011215  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000053194  ..............................................................................
ENSBTAP00000056127  ..............................................................................
ENSBTAP00000033188  ..............................................................................
ENSBTAP00000053548  ..............................................................................
ENSBTAP00000011687  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000020950  ..............................................................................
ENSBTAP00000009115  ..............................................................................
ENSBTAP00000023873  ..............................................................................
ENSBTAP00000054471  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000025205  ..............................................................................
ENSBTAP00000047882  ..............................................................................
ENSBTAP00000001368  ..............................................................................
ENSBTAP00000029786  ..............................................................................
ENSBTAP00000028993  ..............................................................................
ENSBTAP00000023678  ..............................................................................
ENSBTAP00000034710  lflemlfklmsl..................................................................
ENSBTAP00000031823  ..............................................................................
ENSBTAP00000038002  ..............................................................................
ENSBTAP00000021074  ..............................................................................
ENSBTAP00000026544  ..............................................................................
ENSBTAP00000007217  shhtwly.......................................................................
ENSBTAP00000029792  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000017319  ..............................................................................
ENSBTAP00000044100  ..............................................................................
ENSBTAP00000033594  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000055894  ..............................................................................
ENSBTAP00000015220  ..............................................................................
ENSBTAP00000033613  ..............................................................................
ENSBTAP00000056320  tegritlqdlkrcklanvffdtffn.....................................................
ENSBTAP00000025249  ..............................................................................
ENSBTAP00000029159  ..............................................................................
ENSBTAP00000044088  ..............................................................................
ENSBTAP00000016319  ..............................................................................
ENSBTAP00000017662  ..............................................................................
ENSBTAP00000012479  ..............................................................................
ENSBTAP00000029886  ..............................................................................
ENSBTAP00000027388  ..............................................................................
ENSBTAP00000039694  ..............................................................................
ENSBTAP00000023673  ..............................................................................
ENSBTAP00000041488  ..............................................................................
ENSBTAP00000001452  ..............................................................................
ENSBTAP00000028498  ..............................................................................
ENSBTAP00000001426  ..............................................................................
ENSBTAP00000020240  ..............................................................................
ENSBTAP00000053650  ..............................................................................
ENSBTAP00000041651  ..............................................................................
ENSBTAP00000005154  ..............................................................................
ENSBTAP00000021174  ..............................................................................
ENSBTAP00000022068  ..............................................................................
ENSBTAP00000026682  ..............................................................................
ENSBTAP00000007636  ..............................................................................
ENSBTAP00000027954  ..............................................................................
ENSBTAP00000020778  ..............................................................................
ENSBTAP00000013601  ..............................................................................
ENSBTAP00000005477  ..............................................................................
ENSBTAP00000055305  ..............................................................................
ENSBTAP00000036054  ..............................................................................
ENSBTAP00000004912  ..............................................................................
ENSBTAP00000022292  trkdvevtkeefa.................................................................
ENSBTAP00000002717  defltylfsrensiwdekydvv........................................................
ENSBTAP00000036015  qvdsngnsmlsnqdafrlwclfn.......................................................
ENSBTAP00000051638  ..............................................................................
ENSBTAP00000026766  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000016306  ..............................................................................
ENSBTAP00000013714  ..............................................................................
ENSBTAP00000036550  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000023383  elcrvslpefqqflleyqgelwavdrlqvqefmlsflrdplreieepyffldefvtflfskensiwnsqldevc....
ENSBTAP00000027030  ..............................................................................
ENSBTAP00000053270  ..............................................................................
ENSBTAP00000054640  ..............................................................................
ENSBTAP00000012770  vrkffffldplrtgkikiqdilacsfld..................................................
ENSBTAP00000009967  ..............................................................................
ENSBTAP00000015183  ..............................................................................
ENSBTAP00000014222  ..............................................................................
ENSBTAP00000026288  ..............................................................................
ENSBTAP00000002128  ..............................................................................
ENSBTAP00000003365  ..............................................................................
ENSBTAP00000053738  ..............................................................................
ENSBTAP00000009228  ..............................................................................
ENSBTAP00000026785  ..............................................................................
ENSBTAP00000002578  ..............................................................................
ENSBTAP00000000106  ..............................................................................
ENSBTAP00000028840  ..............................................................................
ENSBTAP00000053594  ..............................................................................
ENSBTAP00000055414  ..............................................................................
ENSBTAP00000026698  ..............................................................................
ENSBTAP00000017015  ..............................................................................
ENSBTAP00000049908  ..............................................................................
ENSBTAP00000021395  ..............................................................................
ENSBTAP00000007194  ..............................................................................
ENSBTAP00000025455  ..............................................................................


                                           
                                           
d1br1b_               .....................
ENSBTAP00000019411  .....................
ENSBTAP00000036057  .....................
ENSBTAP00000038404  .....................
ENSBTAP00000010971  .....................
ENSBTAP00000019803  .....................
ENSBTAP00000014038  .....................
ENSBTAP00000002055  .....................
ENSBTAP00000049731  .....................
ENSBTAP00000005577  .....................
ENSBTAP00000034949  .....................
ENSBTAP00000017447  .....................
ENSBTAP00000010858  .....................
ENSBTAP00000046644  .....................
ENSBTAP00000022814  .....................
ENSBTAP00000019758  .....................
ENSBTAP00000019321  .....................
ENSBTAP00000011677  .....................
ENSBTAP00000011680  .....................
ENSBTAP00000021742  .....................
ENSBTAP00000005348  .....................
ENSBTAP00000016609  .....................
ENSBTAP00000012740  .....................
ENSBTAP00000018403  .....................
ENSBTAP00000026407  .....................
ENSBTAP00000052557  .....................
ENSBTAP00000054167  .....................
ENSBTAP00000010319  .....................
ENSBTAP00000041545  .....................
ENSBTAP00000055204  .....................
ENSBTAP00000003718  .....................
ENSBTAP00000011676  .....................
ENSBTAP00000049395  .....................
ENSBTAP00000054983  .....................
ENSBTAP00000052219  .....................
ENSBTAP00000025402  .....................
ENSBTAP00000011678  .....................
ENSBTAP00000000433  .....................
ENSBTAP00000021491  .....................
ENSBTAP00000044733  .....................
ENSBTAP00000010937  .....................
ENSBTAP00000056439  .....................
ENSBTAP00000055780  .....................
ENSBTAP00000038002  .....................
ENSBTAP00000034705  .....................
ENSBTAP00000035936  .....................
ENSBTAP00000013699  .....................
ENSBTAP00000002564  .....................
ENSBTAP00000011496  .....................
ENSBTAP00000019111  .....................
ENSBTAP00000017036  .....................
ENSBTAP00000003213  .....................
ENSBTAP00000055444  .....................
ENSBTAP00000024550  .....................
ENSBTAP00000015248  .....................
ENSBTAP00000021328  .....................
ENSBTAP00000037091  .....................
ENSBTAP00000029967  .....................
ENSBTAP00000021449  .....................
ENSBTAP00000053176  .....................
ENSBTAP00000042361  .....................
ENSBTAP00000016509  .....................
ENSBTAP00000026714  .....................
ENSBTAP00000004690  .....................
ENSBTAP00000010858  .....................
ENSBTAP00000013117  .....................
ENSBTAP00000017574  .....................
ENSBTAP00000004885  .....................
ENSBTAP00000008961  .....................
ENSBTAP00000028063  .....................
ENSBTAP00000012740  .....................
ENSBTAP00000006283  .....................
ENSBTAP00000014306  .....................
ENSBTAP00000053252  .....................
ENSBTAP00000014304  .....................
ENSBTAP00000045669  .....................
ENSBTAP00000041264  .....................
ENSBTAP00000006711  dvvcylsllesgrpqdklefm
ENSBTAP00000017358  .....................
ENSBTAP00000053274  .....................
ENSBTAP00000055296  .....................
ENSBTAP00000016852  .....................
ENSBTAP00000036380  .....................
ENSBTAP00000041719  .....................
ENSBTAP00000049636  .....................
ENSBTAP00000024444  .....................
ENSBTAP00000004556  .....................
ENSBTAP00000038767  .....................
ENSBTAP00000031285  .....................
ENSBTAP00000011457  .....................
ENSBTAP00000011047  .....................
ENSBTAP00000002564  .....................
ENSBTAP00000037104  .....................
ENSBTAP00000002672  .....................
ENSBTAP00000028269  .....................
ENSBTAP00000016647  .....................
ENSBTAP00000004536  .....................
ENSBTAP00000042177  .....................
ENSBTAP00000028063  .....................
ENSBTAP00000050283  .....................
ENSBTAP00000048539  .....................
ENSBTAP00000045669  .....................
ENSBTAP00000007972  .....................
ENSBTAP00000040815  .....................
ENSBTAP00000025661  .....................
ENSBTAP00000028350  .....................
ENSBTAP00000053274  .....................
ENSBTAP00000021537  .....................
ENSBTAP00000055481  .....................
ENSBTAP00000039155  .....................
ENSBTAP00000029333  .....................
ENSBTAP00000016315  .....................
ENSBTAP00000021091  .....................
ENSBTAP00000021618  .....................
ENSBTAP00000055520  .....................
ENSBTAP00000055624  .....................
ENSBTAP00000016319  .....................
ENSBTAP00000034078  .....................
ENSBTAP00000006645  .....................
ENSBTAP00000021909  .....................
ENSBTAP00000001426  .....................
ENSBTAP00000015802  .....................
ENSBTAP00000032680  .....................
ENSBTAP00000055007  .....................
ENSBTAP00000020148  .....................
ENSBTAP00000052345  .....................
ENSBTAP00000029334  .....................
ENSBTAP00000052345  .....................
ENSBTAP00000056127  .....................
ENSBTAP00000012557  .....................
ENSBTAP00000011888  .....................
ENSBTAP00000017060  .....................
ENSBTAP00000031854  .....................
ENSBTAP00000031823  .....................
ENSBTAP00000021603  .....................
ENSBTAP00000010838  .....................
ENSBTAP00000014575  .....................
ENSBTAP00000011215  .....................
ENSBTAP00000053698  .....................
ENSBTAP00000006806  .....................
ENSBTAP00000029334  .....................
ENSBTAP00000044105  .....................
ENSBTAP00000026904  .....................
ENSBTAP00000017060  .....................
ENSBTAP00000055520  .....................
ENSBTAP00000044226  .....................
ENSBTAP00000055624  .....................
ENSBTAP00000042182  .....................
ENSBTAP00000010796  .....................
ENSBTAP00000021174  .....................
ENSBTAP00000006275  .....................
ENSBTAP00000020950  .....................
ENSBTAP00000053738  .....................
ENSBTAP00000004963  .....................
ENSBTAP00000023774  .....................
ENSBTAP00000020395  .....................
ENSBTAP00000020150  .....................
ENSBTAP00000025561  .....................
ENSBTAP00000053738  .....................
ENSBTAP00000034009  .....................
ENSBTAP00000020539  .....................
ENSBTAP00000020778  .....................
ENSBTAP00000017461  .....................
ENSBTAP00000044096  .....................
ENSBTAP00000008523  .....................
ENSBTAP00000035196  .....................
ENSBTAP00000041997  .....................
ENSBTAP00000025499  .....................
ENSBTAP00000055481  .....................
ENSBTAP00000002174  .....................
ENSBTAP00000000589  .....................
ENSBTAP00000028239  .....................
ENSBTAP00000014894  .....................
ENSBTAP00000026544  .....................
ENSBTAP00000029333  .....................
ENSBTAP00000041966  .....................
ENSBTAP00000008933  .....................
ENSBTAP00000056088  .....................
ENSBTAP00000033794  .....................
ENSBTAP00000012786  .....................
ENSBTAP00000030018  .....................
ENSBTAP00000040233  .....................
ENSBTAP00000003365  .....................
ENSBTAP00000053176  .....................
ENSBTAP00000024301  .....................
ENSBTAP00000022292  .....................
ENSBTAP00000015611  .....................
ENSBTAP00000012770  .....................
ENSBTAP00000000847  .....................
ENSBTAP00000053738  .....................
ENSBTAP00000054975  .....................
ENSBTAP00000046639  .....................
ENSBTAP00000052345  .....................
ENSBTAP00000053164  .....................
ENSBTAP00000016774  .....................
ENSBTAP00000022630  .....................
ENSBTAP00000010796  .....................
ENSBTAP00000021909  .....................
ENSBTAP00000033974  .....................
ENSBTAP00000006711  .....................
ENSBTAP00000010796  .....................
ENSBTAP00000004912  .....................
ENSBTAP00000005979  .....................
ENSBTAP00000053738  .....................
ENSBTAP00000053746  .....................
ENSBTAP00000023221  .....................
ENSBTAP00000019429  .....................
ENSBTAP00000052019  .....................
ENSBTAP00000042244  .....................
ENSBTAP00000053738  .....................
ENSBTAP00000018877  .....................
ENSBTAP00000053019  .....................
ENSBTAP00000003073  .....................
ENSBTAP00000012886  .....................
ENSBTAP00000044222  .....................
ENSBTAP00000028499  .....................
ENSBTAP00000047378  .....................
ENSBTAP00000009308  .....................
ENSBTAP00000017060  .....................
ENSBTAP00000050406  .....................
ENSBTAP00000031879  .....................
ENSBTAP00000031854  .....................
ENSBTAP00000001250  .....................
ENSBTAP00000026035  .....................
ENSBTAP00000011215  .....................
ENSBTAP00000002128  .....................
ENSBTAP00000053194  .....................
ENSBTAP00000056127  .....................
ENSBTAP00000033188  .....................
ENSBTAP00000053548  .....................
ENSBTAP00000011687  .....................
ENSBTAP00000007636  .....................
ENSBTAP00000020950  .....................
ENSBTAP00000009115  .....................
ENSBTAP00000023873  .....................
ENSBTAP00000054471  .....................
ENSBTAP00000039694  .....................
ENSBTAP00000025205  .....................
ENSBTAP00000047882  .....................
ENSBTAP00000001368  .....................
ENSBTAP00000029786  .....................
ENSBTAP00000028993  .....................
ENSBTAP00000023678  .....................
ENSBTAP00000034710  .....................
ENSBTAP00000031823  .....................
ENSBTAP00000038002  .....................
ENSBTAP00000021074  .....................
ENSBTAP00000026544  .....................
ENSBTAP00000007217  .....................
ENSBTAP00000029792  .....................
ENSBTAP00000044088  .....................
ENSBTAP00000017319  .....................
ENSBTAP00000044100  .....................
ENSBTAP00000033594  .....................
ENSBTAP00000026766  .....................
ENSBTAP00000055894  .....................
ENSBTAP00000015220  .....................
ENSBTAP00000033613  .....................
ENSBTAP00000056320  .....................
ENSBTAP00000025249  .....................
ENSBTAP00000029159  .....................
ENSBTAP00000044088  .....................
ENSBTAP00000016319  .....................
ENSBTAP00000017662  .....................
ENSBTAP00000012479  .....................
ENSBTAP00000029886  .....................
ENSBTAP00000027388  .....................
ENSBTAP00000039694  .....................
ENSBTAP00000023673  .....................
ENSBTAP00000041488  .....................
ENSBTAP00000001452  .....................
ENSBTAP00000028498  .....................
ENSBTAP00000001426  .....................
ENSBTAP00000020240  .....................
ENSBTAP00000053650  .....................
ENSBTAP00000041651  .....................
ENSBTAP00000005154  .....................
ENSBTAP00000021174  .....................
ENSBTAP00000022068  .....................
ENSBTAP00000026682  .....................
ENSBTAP00000007636  .....................
ENSBTAP00000027954  .....................
ENSBTAP00000020778  .....................
ENSBTAP00000013601  .....................
ENSBTAP00000005477  .....................
ENSBTAP00000055305  .....................
ENSBTAP00000036054  .....................
ENSBTAP00000004912  .....................
ENSBTAP00000022292  .....................
ENSBTAP00000002717  .....................
ENSBTAP00000036015  .....................
ENSBTAP00000051638  .....................
ENSBTAP00000026766  .....................
ENSBTAP00000053738  .....................
ENSBTAP00000016306  .....................
ENSBTAP00000013714  .....................
ENSBTAP00000036550  .....................
ENSBTAP00000053738  .....................
ENSBTAP00000023383  .....................
ENSBTAP00000027030  .....................
ENSBTAP00000053270  .....................
ENSBTAP00000054640  .....................
ENSBTAP00000012770  .....................
ENSBTAP00000009967  .....................
ENSBTAP00000015183  .....................
ENSBTAP00000014222  .....................
ENSBTAP00000026288  .....................
ENSBTAP00000002128  .....................
ENSBTAP00000003365  .....................
ENSBTAP00000053738  .....................
ENSBTAP00000009228  .....................
ENSBTAP00000026785  .....................
ENSBTAP00000002578  .....................
ENSBTAP00000000106  .....................
ENSBTAP00000028840  .....................
ENSBTAP00000053594  .....................
ENSBTAP00000055414  .....................
ENSBTAP00000026698  .....................
ENSBTAP00000017015  .....................
ENSBTAP00000049908  .....................
ENSBTAP00000021395  .....................
ENSBTAP00000007194  .....................
ENSBTAP00000025455  .....................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0045999 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes