SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

EF-hand alignments in Gorilla gorilla 76_3.1

These alignments are sequences aligned to the 0040064 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1kful1               eiean.........................................................................
ENSGGOP00000000209  m.............................................................................
ENSGGOP00000022972  m.............................................................................
ENSGGOP00000021376  lrpevmqd......................................................................
ENSGGOP00000009800  lrpemlqd......................................................................
ENSGGOP00000011095  ..............................................................................
ENSGGOP00000003638  ggggggggtamrilggvisaiseaaaqynpepppp...........................................
ENSGGOP00000025293  gggtamrilggvisaiseaaaqynpepppp................................................
ENSGGOP00000002483  a.............................................................................
ENSGGOP00000028220  mgkqnsklrpevlqdl..............................................................
ENSGGOP00000017724  q.............................................................................
ENSGGOP00000006566  a.............................................................................
ENSGGOP00000019618  s.............................................................................
ENSGGOP00000008245  vspmtclkkhwmklafmtntngkipvrsitrtfasgktekvifqalkelglpsgkndeieptafsyekfyeltqk...
ENSGGOP00000025102  mgkqnsklapevmedl..............................................................
ENSGGOP00000010426  srdaflekaytklklqvtpegriplkniyrlfsadrkrvetaleacslpssr..........................
ENSGGOP00000015754  ppcldseltefplrmrdwlknvlvtlyerdednnlltekqklrvkkihenekrleagdhpvellardfeknynmyifp
ENSGGOP00000012299  pgss..........................................................................
ENSGGOP00000021175  vspmtclkkhwmklafmtntngkipvrspsitrtfasgktekvifqalkelglpsgkndeieptafsyekfyeltqk.
ENSGGOP00000019593  lvl...........................................................................
ENSGGOP00000006396  rpegleqlq.....................................................................
ENSGGOP00000022632  srntflrkaytklklqvnqdgripvknilkmfsadkkrvetalescglk.............................
ENSGGOP00000011943  srntflrkaytklklqvnqdgripvknilkmfsadkkrvetalescglk.............................
ENSGGOP00000008286  ast...........................................................................
ENSGGOP00000015051  ptctdfeviqfplrmrdwlknilmqlyeansehagylnekqrnkvkkiyldekrllagdhpidlllrdfkknyhmyvy
ENSGGOP00000024872  ptctdfeviqfplrmrdwlknilmqlyeansehagylnekqrnkvkkiyldekrllagdhpidlllrdfkknyhmyvy
ENSGGOP00000011390  eelfgdltdlnnvrfsayrtamklrrlqkalcldllslsaacdaldqhnlkqndqpmdilqiinclttiydrleqehn
ENSGGOP00000008090  edlvk.........................................................................
ENSGGOP00000006979  mgkqnsklrpevmqd...............................................................
ENSGGOP00000014947  hpkmtelfqsladlnnvrfsayrtaikirrlqkalcldl.......................................
ENSGGOP00000000749  srstfldkilvklkmqlnsegkipvknffqmfpadrkrveaalsachl..............................
ENSGGOP00000022235  hpkmtelfqsladlnnvrfsayrtaikirrlqkalcldl.......................................
ENSGGOP00000004772  m.............................................................................
ENSGGOP00000001305  ap............................................................................
ENSGGOP00000009619  qpegldqlqa....................................................................
ENSGGOP00000027707  ars...........................................................................
ENSGGOP00000013700  maker.........................................................................
ENSGGOP00000026634  ..............................................................................
ENSGGOP00000027354  leqleaqt......................................................................
ENSGGOP00000007591  lpdeqv........................................................................
ENSGGOP00000024754  lpdeqv........................................................................
ENSGGOP00000000341  pelsaleeafrrfavhgdtratgremhgknwsklckdcqvidgrn.................................
ENSGGOP00000006559  g.............................................................................
ENSGGOP00000001194  t.............................................................................
ENSGGOP00000020610  qklqhw........................................................................
ENSGGOP00000003736  qklqhw........................................................................
ENSGGOP00000004196  hpkmtelyqtladlnn..............................................................
ENSGGOP00000015532  av............................................................................
ENSGGOP00000000785  dp............................................................................
ENSGGOP00000014368  rldpw.........................................................................
ENSGGOP00000023413  leqleaqtnftk..................................................................
ENSGGOP00000007126  leqleaqtnftk..................................................................
ENSGGOP00000008349  nsksgalskeileelq..............................................................
ENSGGOP00000011020  erthtw........................................................................
ENSGGOP00000015507  nvd...........................................................................
ENSGGOP00000012471  elss..........................................................................
ENSGGOP00000012549  ptp...........................................................................
ENSGGOP00000019099  ed............................................................................
ENSGGOP00000003031  ed............................................................................
ENSGGOP00000005101  eaektfhrfaafgessssgtemnnknfsklckdcgimdgktv....................................
ENSGGOP00000024511  elss..........................................................................
ENSGGOP00000018250  ..............................................................................
ENSGGOP00000003074  giaekqre......................................................................
ENSGGOP00000012477  elss..........................................................................
ENSGGOP00000010001  rtr...........................................................................
ENSGGOP00000020622  rtr...........................................................................
ENSGGOP00000010490  mt............................................................................
ENSGGOP00000015637  nmrtsw........................................................................
ENSGGOP00000011144  ..............................................................................
ENSGGOP00000026982  ..............................................................................
ENSGGOP00000003975  ..............................................................................
ENSGGOP00000004885  rwflskiq......................................................................
ENSGGOP00000014678  vy............................................................................
ENSGGOP00000013437  ekwahlspsefsqlqkyaeystkklkdvleefhgngvlakynpegkqdil............................
ENSGGOP00000011390  hledkyrylfkqvasstgfcdqrrlglllhdsiqipr.........................................
ENSGGOP00000010036  a.............................................................................
ENSGGOP00000027819  r.............................................................................
ENSGGOP00000012841  l.............................................................................
ENSGGOP00000009918  r.............................................................................
ENSGGOP00000012485  ge............................................................................
ENSGGOP00000009782  r.............................................................................
ENSGGOP00000009375  kr............................................................................
ENSGGOP00000023560  myqltkapahtfwrescgarc.........................................................
ENSGGOP00000014947  leekyrylfkevagptemcdqrqlglllhdaiqiprqlgevaafggsniepsvrscfqqn..................
ENSGGOP00000012603  erwvsltpeefdqlqkyseysskkikdvltefneggslkqydphep................................
ENSGGOP00000017349  tfritkadaaefwrkafge...........................................................
ENSGGOP00000003738  tfritkadaaefwrkafge...........................................................
ENSGGOP00000007513  emraqnfdvirlstyrtacklrfvqkrcnlhlvdiwnmieafrdngln..............................
ENSGGOP00000022235  leekyrylfkevagptemcdqrqlglllhdaiqiprqlgevaafggsniepsvrscfqqn..................
ENSGGOP00000001928  tprfm.........................................................................
ENSGGOP00000013652  leef..........................................................................
ENSGGOP00000006109  vpaqethvwyrtfmmey.............................................................
ENSGGOP00000003219  ..............................................................................
ENSGGOP00000022428  aemtlgaqdldrirlstyrtacklrfvqkkcnlhlvdiwnviealrenalnnldpntelnvsrleavlstifyqlnkr
ENSGGOP00000017119  qlfaemraqdldrirlstyrtacklrfvqkkcnlhlvdiwnviealrenalnnldpntelnvsrleavlstifyqlnk
ENSGGOP00000003545  qlfaemraqdldrirlstyrtacklrfvqkkcnlhlvdiwnviealrenalnnldpntelnvsrleavlstifyqlnk
ENSGGOP00000023406  ..............................................................................
ENSGGOP00000007856  fdis..........................................................................
ENSGGOP00000011697  ..............................................................................
ENSGGOP00000018636  fritkadaaefw..................................................................
ENSGGOP00000017641  ..............................................................................
ENSGGOP00000013074  yg............................................................................
ENSGGOP00000007661  gprm..........................................................................
ENSGGOP00000020763  ..............................................................................
ENSGGOP00000005624  ..............................................................................
ENSGGOP00000025395  tctgqdladlgdrlrdwfqllhenskqngsassvaspasgldkslg................................
ENSGGOP00000019250  tctgqdladlgdrlrdwfqllhenskqngsassvaspasgldkslg................................
ENSGGOP00000020096  ..............................................................................
ENSGGOP00000000796  actdkelrnlasrlkdwfgalhedanrvikptssntaqarfdt...................................
ENSGGOP00000004196  vkeklqylfsqvansgsqcdqrhlgvllheaiqvprqlgevaafggsnvep...........................
ENSGGOP00000002530  ..............................................................................
ENSGGOP00000015006  nckhfnkfevncliklfydllggverqglvvg..............................................
ENSGGOP00000016611  ..............................................................................
ENSGGOP00000004209  rre...........................................................................
ENSGGOP00000011570  lnp...........................................................................
ENSGGOP00000006906  d.............................................................................
ENSGGOP00000024832  d.............................................................................
ENSGGOP00000019567  ..............................................................................
ENSGGOP00000009496  ..............................................................................
ENSGGOP00000012555  qgcpgakkhefltsvldalstdmvhavsdpssssgrlsepdpshtl................................
ENSGGOP00000006153  g.............................................................................
ENSGGOP00000008018  pgcpegkkmefitslldalttdmvqainsaaptgggrfsepdpshtl...............................
ENSGGOP00000007513  ml............................................................................
ENSGGOP00000024452  pgcpegkkmefitslldalttdmvqainsaaptgggrfsepdpshtl...............................
ENSGGOP00000005045  eftkisrk......................................................................
ENSGGOP00000017287  s.............................................................................
ENSGGOP00000004706  kellaeyqdltfltkqeillahrrfcellpqeqrsvesslraqvpfeqilslpelkanpfkericrvfstsp......
ENSGGOP00000022428  kimd..........................................................................
ENSGGOP00000017119  kimd..........................................................................
ENSGGOP00000003545  kimd..........................................................................
ENSGGOP00000004257  mgnkqtvftheqleayqdctfftrkeimrvfyryqdlapqlvpldyttcpdvkvpyeligsmpelkd...........
ENSGGOP00000024127  nssypde.......................................................................
ENSGGOP00000012291  ppvaewav......................................................................
ENSGGOP00000004812  ip............................................................................
ENSGGOP00000012046  lsrae.........................................................................
ENSGGOP00000015625  nssypde.......................................................................
ENSGGOP00000008889  ddp...........................................................................
ENSGGOP00000008482  pte...........................................................................
ENSGGOP00000013349  n.............................................................................
ENSGGOP00000011422  lsrae.........................................................................
ENSGGOP00000018846  elksifklsvfipsqefsty..........................................................
ENSGGOP00000003216  ..............................................................................
ENSGGOP00000021719  de............................................................................
ENSGGOP00000005693  vrde..........................................................................
ENSGGOP00000010676  mgnkqtifteeqldnyqqdctffnkkdilklhsrfyelapnlvpmdyrkspivhvpmsliiqmpelren.........
ENSGGOP00000007432  spktgtsewavpq.................................................................
ENSGGOP00000018435  lt............................................................................
ENSGGOP00000006035  isgtsaael.....................................................................
ENSGGOP00000025507  isgtsaael.....................................................................
ENSGGOP00000006035  wv............................................................................
ENSGGOP00000025507  wv............................................................................
ENSGGOP00000003343  ks............................................................................
ENSGGOP00000020870  e.............................................................................
ENSGGOP00000002976  e.............................................................................
ENSGGOP00000024041  wlr...........................................................................
ENSGGOP00000009817  wlr...........................................................................
ENSGGOP00000011240  tptfyqtl......................................................................
ENSGGOP00000008587  ard...........................................................................
ENSGGOP00000007432  gp............................................................................
ENSGGOP00000013302  qptvnwvvp.....................................................................
ENSGGOP00000024313  qptvnwvvp.....................................................................
ENSGGOP00000000552  eeedinqitdyf..................................................................
ENSGGOP00000002697  eevrele.......................................................................
ENSGGOP00000016489  seleta........................................................................
ENSGGOP00000028006  ..............................................................................
ENSGGOP00000023206  ..............................................................................
ENSGGOP00000006503  tqaersii......................................................................
ENSGGOP00000006509  tqaersii......................................................................
ENSGGOP00000021892  mselekamv.....................................................................
ENSGGOP00000004839  s.............................................................................
ENSGGOP00000019168  mtdllnaedikkavgafsatdsfdhkkf..................................................
ENSGGOP00000003722  ..............................................................................
ENSGGOP00000007472  le............................................................................
ENSGGOP00000027338  mteletamg.....................................................................
ENSGGOP00000007156  edfqripelainplg...............................................................
ENSGGOP00000024526  mpsqmeha......................................................................
ENSGGOP00000028098  tqlema........................................................................
ENSGGOP00000007082  plekal........................................................................
ENSGGOP00000023859  pltkyralfqlcaensrggydsgprmt...................................................
ENSGGOP00000019080  pltkyralfqlcaensrggydsgprmt...................................................
ENSGGOP00000010449  ysafqeilkvnpfrdricrvf.........................................................
ENSGGOP00000000844  msql..........................................................................
ENSGGOP00000023819  tqaersii......................................................................
ENSGGOP00000006595  mtql..........................................................................
ENSGGOP00000006390  t.............................................................................
ENSGGOP00000015096  riqgcwrqllkecke...............................................................
ENSGGOP00000019080  alnsiensiyktafklrsvqtlcqldlidssliqqvllgpsfweag................................
ENSGGOP00000002308  tkd...........................................................................
ENSGGOP00000023711  tkd...........................................................................
ENSGGOP00000000733  ..............................................................................
ENSGGOP00000023859  alnsiensiyktafklrsvqtlcqldlidssliqqvllgpsfweag................................
ENSGGOP00000028529  tqaersii......................................................................
ENSGGOP00000015096  ..............................................................................
ENSGGOP00000002979  rdkpmy........................................................................
ENSGGOP00000000348  kdkpt.........................................................................
ENSGGOP00000012168  kstpsesprtkkfplteeeifymncraayltvfkssle........................................
ENSGGOP00000021101  tpvees........................................................................
ENSGGOP00000024236  tpvees........................................................................
ENSGGOP00000005783  enqi..........................................................................
ENSGGOP00000011525  akdkpvydelfytlspi.............................................................
ENSGGOP00000011629  etq...........................................................................
ENSGGOP00000009256  mtdllnaedikkavgafsatdsfdhkkf..................................................
ENSGGOP00000022443  eadinqlteffs..................................................................
ENSGGOP00000013081  eadinqlteffs..................................................................
ENSGGOP00000006507  hptgpl........................................................................
ENSGGOP00000026277  hptgpl........................................................................
ENSGGOP00000026775  ls............................................................................
ENSGGOP00000015605  enqvl.........................................................................
ENSGGOP00000013437  vihlkdi.......................................................................
ENSGGOP00000015096  als...........................................................................
ENSGGOP00000015264  farlvrglg.....................................................................
ENSGGOP00000019492  gsps..........................................................................
ENSGGOP00000015242  gsps..........................................................................
ENSGGOP00000015096  esfr..........................................................................
ENSGGOP00000011088  ls............................................................................
ENSGGOP00000020157  rpleqavaai....................................................................
ENSGGOP00000025587  mstllenifa....................................................................
ENSGGOP00000002805  t.............................................................................
ENSGGOP00000013256  dt............................................................................
ENSGGOP00000023524  dt............................................................................
ENSGGOP00000013295  l.............................................................................
ENSGGOP00000018258  l.............................................................................
ENSGGOP00000005688  radp..........................................................................
ENSGGOP00000007088  macpldqai.....................................................................
ENSGGOP00000004418  llnsil........................................................................
ENSGGOP00000004827  srtw..........................................................................
ENSGGOP00000023450  rdak..........................................................................
ENSGGOP00000007087  etplekalt.....................................................................
ENSGGOP00000020253  mlteleka......................................................................
ENSGGOP00000027573  mlteleka......................................................................
ENSGGOP00000021162  ksdltrafqlqdhrksakldhriingslrellkltkpwrererekknkyrnslyeymssfqniriekpvqeahstlv.
ENSGGOP00000016495  aepltele......................................................................
ENSGGOP00000005787  kevweetdgldpndfdp.............................................................
ENSGGOP00000020487  mspllrs.......................................................................
ENSGGOP00000016148  ak............................................................................
ENSGGOP00000015096  ksyek.........................................................................
ENSGGOP00000012603  vvylkdvvcylsll................................................................
ENSGGOP00000015201  gs............................................................................
ENSGGOP00000024915  pte...........................................................................
ENSGGOP00000023450  adtd..........................................................................
ENSGGOP00000001678  py............................................................................
ENSGGOP00000024627  ytelekavivlvenfykyvskyslv.....................................................
ENSGGOP00000018908  mpqllq........................................................................
ENSGGOP00000025434  e.............................................................................
ENSGGOP00000006199  kevweeldgldpnrfnpk............................................................
ENSGGOP00000019261  kevweeldgldpnrfnpk............................................................
ENSGGOP00000005693  kdrvhhepqlsdkvhndaqsfdydhdaflgaeea............................................
ENSGGOP00000001807  kllqgvitv.....................................................................
ENSGGOP00000024313  aeahwavrv.....................................................................
ENSGGOP00000019354  sll...........................................................................
ENSGGOP00000018853  dsfdhkkf......................................................................
ENSGGOP00000008614  at............................................................................
ENSGGOP00000024313  nsly..........................................................................
ENSGGOP00000000552  eqtlsrietafmdiedqkadiyemgkiakvcgcplywkap......................................
ENSGGOP00000004747  cglisfsdyiflttvlstpq..........................................................
ENSGGOP00000013302  nsly..........................................................................
ENSGGOP00000020941  sleqalavlvt...................................................................
ENSGGOP00000000504  tkg...........................................................................
ENSGGOP00000024502  tkg...........................................................................
ENSGGOP00000011848  dk............................................................................
ENSGGOP00000024360  isklq.........................................................................
ENSGGOP00000000733  da............................................................................
ENSGGOP00000024360  vrnmrd........................................................................
ENSGGOP00000021249  wrkkymrwmnhk..................................................................
ENSGGOP00000019415  wrkkymrwmnhk..................................................................
ENSGGOP00000013501  hptaplydp.....................................................................
ENSGGOP00000021515  dqh...........................................................................
ENSGGOP00000005854  dqh...........................................................................
ENSGGOP00000016618  ..............................................................................
ENSGGOP00000024091  fngngkinvnsimeglkkfkpkgmvtlhklktandikdrvtghmavseikpklklnpltkvpishnkrdrdlpgslqc
ENSGGOP00000013700  gdaigyeg......................................................................
ENSGGOP00000008485  pspmeht.......................................................................
ENSGGOP00000011966  eaemspqe......................................................................
ENSGGOP00000023645  gvqelealidtiqkqlkdhs..........................................................
ENSGGOP00000028176  ks............................................................................
ENSGGOP00000004508  gkaelnfedfyrf.................................................................
ENSGGOP00000018206  gkaelnfedfyrf.................................................................
ENSGGOP00000006739  tkrnvvrtivtetsftideleelyalfkaehltscywggssnaldrhdpslpyleqy.....................
ENSGGOP00000023979  tkrnvvrtivtetsftideleelyalfkaehltscywggssnaldrhdpslpyleqy.....................
ENSGGOP00000012342  ks............................................................................
ENSGGOP00000023206  ..............................................................................
ENSGGOP00000001608  g.............................................................................
ENSGGOP00000010042  mlrk..........................................................................
ENSGGOP00000028006  ..............................................................................
ENSGGOP00000025507  sgnpv.........................................................................
ENSGGOP00000020583  rn............................................................................
ENSGGOP00000012393  eewtsaakpkldq.................................................................
ENSGGOP00000016724  qlvt..........................................................................
ENSGGOP00000023938  sfcic.........................................................................
ENSGGOP00000022364  rn............................................................................
ENSGGOP00000005326  cqlqh.........................................................................
ENSGGOP00000008587  fqydheaflgrev.................................................................
ENSGGOP00000002982  takrsvvraipvdigfsieeledlymvfkakhlasqywgcsrtmagrrdpslpyleqyr...................
ENSGGOP00000006523  r.............................................................................
ENSGGOP00000014183  gkegkgkippestlifnidlleirng....................................................
ENSGGOP00000018435  keiv..........................................................................
ENSGGOP00000021184  tkqnvlrvvsqdvklslqeleelyvifkkelflscywclgcpvlkhhdpslpyleqy.....................
ENSGGOP00000015096  qa............................................................................
ENSGGOP00000024360  ylh...........................................................................
ENSGGOP00000027849  akrsvvraipvdigfsieeledlymvfkakhlasqywgcsrtmagrrdpslpyleqyr....................
ENSGGOP00000022443  rfpheratmddmglvakacscplywkgplfyg..............................................
ENSGGOP00000013081  rfpheratmddmglvakacscplywkgplfyg..............................................
ENSGGOP00000022610  ..............................................................................
ENSGGOP00000010606  h.............................................................................
ENSGGOP00000026802  qvnfeefkegfvavlssnagvrpsdedssslesaassaippkcvngskwygrrsrpelcdaatearrvpeqqtqaslk
ENSGGOP00000011774  mpqllrnvlcv...................................................................
ENSGGOP00000002441  qvnfeefkegfvavlssnagvrpsdedssslesaassaippkcvngskwygrrsrpelcdaatearrvpeqqtqaslk
ENSGGOP00000002021  dyledgkvnvhkllalynhiselvqlqevappleankdlvhlltlsldlyytedeiyelsyareprnhrappltpskp
ENSGGOP00000009877  fvwhedppan....................................................................
ENSGGOP00000016754  lcdqkysdeenl..................................................................
ENSGGOP00000007308  egymfiwngevsp.................................................................
ENSGGOP00000012932  ..............................................................................
ENSGGOP00000012554  sdlekaiatta...................................................................
ENSGGOP00000011621  rp............................................................................
ENSGGOP00000024380  sdsnmsfvefvelfksfsvrsrkdlkdlfdvyavpcnrsgsesaplytnltidentsdlqpdldlltrnvsdlglfik
ENSGGOP00000000011  ifl...........................................................................
ENSGGOP00000007649  sdsnmsfvefvelfksfsvrsrkdlkdlfdvyavpcnrsgsesaplytnltidentsdlqpdldlltrnvsdlglfik
ENSGGOP00000006035  npv...........................................................................
ENSGGOP00000011720  flddpkyssdedlp................................................................
ENSGGOP00000002269  kgsnyse.......................................................................
ENSGGOP00000018132  eq............................................................................
ENSGGOP00000017534  kgsnyse.......................................................................
ENSGGOP00000004508  slskqelnqmlaetppvwkgssklfr....................................................
ENSGGOP00000018206  slskqelnqmlaetppvwkgssklfr....................................................
ENSGGOP00000016496  sdver.........................................................................
ENSGGOP00000012932  qrfmqfsslehegeyymtprdflfsvmfeqmerktsvkkltkkdiedtlsgiqtagcgstffr...............
ENSGGOP00000004839  yt............................................................................
ENSGGOP00000008738  elrniflqyastevdgehymtpedfvqrylglyndpnsnpkivqllagvadqtkdnvkeifgqtiihhhip.......
ENSGGOP00000028586  gkippdatlifeielyavtkgpr.......................................................
ENSGGOP00000011240  rrvtdvelkrlkdafkrtrglsyymgqhcfirevlgdgvpprvaeviycsfggtsk......................
ENSGGOP00000007686  g.............................................................................
ENSGGOP00000000151  pgsql.........................................................................
ENSGGOP00000006499  ..............................................................................
ENSGGOP00000023045  tkqnvlrvvsqdvklslqeleelyvifkkelflscywclgcpvlkhhdpslpyleqy.....................
ENSGGOP00000020565  ..............................................................................
ENSGGOP00000012340  nvemilkffdmflklkdltss.........................................................
ENSGGOP00000023745  nvemilkffdmflklkdltss.........................................................
ENSGGOP00000008325  lvd...........................................................................
ENSGGOP00000022444  gdinfaeieeanrvlgpiyfttfvffmffillnmflaiindtysevksdlaqqkaemelsdlirkgyhkalvklklkk
ENSGGOP00000024026  hipfn.........................................................................
ENSGGOP00000003268  gdinfaeieeanrvlgpiyfttfvffmffillnmflaiindtysevksdlaqqkaemelsdlirkgyhkalvklklkk
ENSGGOP00000012291  pfggsldiw.....................................................................
ENSGGOP00000020860  ..............................................................................
ENSGGOP00000004747  hdvlkle.......................................................................
ENSGGOP00000016725  sislrelktilp..................................................................
ENSGGOP00000027884  sislrelktilp..................................................................
ENSGGOP00000008864  itdvlsaddiaaalqecqdpdtfepqkff.................................................
ENSGGOP00000024021  qecqfflqkfesga................................................................
ENSGGOP00000002559  lsreqv........................................................................
ENSGGOP00000008975  nvemilkffdmflklkdltss.........................................................
ENSGGOP00000015810  el............................................................................
ENSGGOP00000022677  el............................................................................
ENSGGOP00000001056  v.............................................................................
ENSGGOP00000024407  mselekamv.....................................................................
ENSGGOP00000008333  e.............................................................................
ENSGGOP00000005688  q.............................................................................
ENSGGOP00000027880  e.............................................................................
ENSGGOP00000015096  drdklm........................................................................
ENSGGOP00000022419  ..............................................................................
ENSGGOP00000003523  ..............................................................................
ENSGGOP00000007901  sv............................................................................
ENSGGOP00000008530  s.............................................................................
ENSGGOP00000007957  kqlk..........................................................................
ENSGGOP00000010635  malvapeaps....................................................................
ENSGGOP00000004392  vsve..........................................................................
ENSGGOP00000010370  i.............................................................................
ENSGGOP00000022364  mqrqlkkhfkegkgltfqevenfftflknindvdtalsfyhmagasldkvt...........................
ENSGGOP00000015625  llsegeqqcyselfarcagaagggpgsgppeaarvapgtataaagpvadlfrasql......................
ENSGGOP00000007654  er............................................................................
ENSGGOP00000020583  mqrqlkkhfkegkgltfqevenfftflknindvdtalsfyhmagasldkvt...........................
ENSGGOP00000013302  aeahwavrveekakfdgifesllpin....................................................
ENSGGOP00000010930  ves...........................................................................
ENSGGOP00000005349  kqnvlrvvipevsilpedleelydlfkrehmmscyweqprpmasrhdpsrpyaeqy......................
ENSGGOP00000008253  mtdllrsvvtvidvfyk.............................................................
ENSGGOP00000001993  es............................................................................
ENSGGOP00000024222  g.............................................................................
ENSGGOP00000002875  g.............................................................................
ENSGGOP00000012369  st............................................................................
ENSGGOP00000011933  l.............................................................................
ENSGGOP00000011848  etle..........................................................................
ENSGGOP00000018329  l.............................................................................
ENSGGOP00000000391  l.............................................................................
ENSGGOP00000013508  l.............................................................................
ENSGGOP00000022560  q.............................................................................
ENSGGOP00000019614  qqeqelaa......................................................................
ENSGGOP00000015110  nvemilkffdmflklkdivgs.........................................................
ENSGGOP00000008437  qqeqelaa......................................................................
ENSGGOP00000016998  nvemilkffdmflklkdivgs.........................................................
ENSGGOP00000024026  vd............................................................................
ENSGGOP00000017722  lhsr..........................................................................
ENSGGOP00000017757  d.............................................................................
ENSGGOP00000002740  d.............................................................................
ENSGGOP00000012168  stl...........................................................................
ENSGGOP00000001815  rlrlrkervsdmqkvl..............................................................
ENSGGOP00000020483  rlrlrkervsdmqkvl..............................................................
ENSGGOP00000020927  rlrlrkervsdmqkvl..............................................................
ENSGGOP00000002387  fsslqdmpkeldpsavlpl...........................................................
ENSGGOP00000006515  rpa...........................................................................
ENSGGOP00000008725  wlinyiqeilr...................................................................
ENSGGOP00000018073  wlinyiqeilr...................................................................
ENSGGOP00000015740  eeqi..........................................................................


                                                                                           10       
                                                                                            |       
d1kful1               .............................................................-----LEEFDISEDDI.
ENSGGOP00000000209  .............................................................--------ADQLTEEQ.
ENSGGOP00000022972  .............................................................--------ADQLTEEQ.
ENSGGOP00000021376  .............................................................-----LLESTDFTEHE.
ENSGGOP00000009800  .............................................................-----LRENTEFSELE.
ENSGGOP00000011095  .............................................................-----------LTEEQ.
ENSGGOP00000003638  .............................................................--RTHYSNIEANESEE.
ENSGGOP00000025293  .............................................................--RTHYSNIEANESEE.
ENSGGOP00000002483  .............................................................---------DQLTEEQ.
ENSGGOP00000028220  .............................................................------RENTEFTDHE.
ENSGGOP00000017724  .............................................................----------------.
ENSGGOP00000006566  .............................................................---------DQLTEEQ.
ENSGGOP00000019618  .............................................................----------------.
ENSGGOP00000008245  .............................................................---------------Ic
ENSGGOP00000025102  .............................................................------VKSTEFNEHE.
ENSGGOP00000010426  .............................................................----------------.
ENSGGOP00000015754  ..........................................................vhw----------------.
ENSGGOP00000012299  .............................................................----------DQESEE.
ENSGGOP00000021175  .............................................................---------------Ic
ENSGGOP00000019593  .............................................................------AQTSDQESEE.
ENSGGOP00000006396  .............................................................----------EQTKFT.
ENSGGOP00000022632  .............................................................----------------.
ENSGGOP00000011943  .............................................................----------------.
ENSGGOP00000008286  .............................................................---------------D.
ENSGGOP00000015051  .........................................................pvhw----------------.
ENSGGOP00000024872  .........................................................pvhw----------------.
ENSGGOP00000011390  ...................................................nlvnvplcvd----------------.
ENSGGOP00000008090  .............................................................--------STEFNEHE.
ENSGGOP00000006979  .............................................................-----LLESTDFTEHE.
ENSGGOP00000014947  .............................................................--------------LE.
ENSGGOP00000000749  .............................................................----------------.
ENSGGOP00000022235  .............................................................--------------LE.
ENSGGOP00000004772  .............................................................-----------FEQTQ.
ENSGGOP00000001305  .............................................................--------KPELTEDQ.
ENSGGOP00000009619  .............................................................-----------QTKFT.
ENSGGOP00000027707  .............................................................----------YLSEEM.
ENSGGOP00000013700  .............................................................----------------.
ENSGGOP00000026634  .............................................................-----------LTGEQ.
ENSGGOP00000027354  .............................................................-------------NFT.
ENSGGOP00000007591  .............................................................-----------LSEEEi
ENSGGOP00000024754  .............................................................-----------LSEEEi
ENSGGOP00000000341  .............................................................----------------.
ENSGGOP00000006559  .............................................................----------ELTPEQ.
ENSGGOP00000001194  .............................................................-------------EKE.
ENSGGOP00000020610  .............................................................----------------.
ENSGGOP00000003736  .............................................................----------------.
ENSGGOP00000004196  .............................................................----------------.
ENSGGOP00000015532  .............................................................---------EQLTEEQ.
ENSGGOP00000000785  .............................................................----------------.
ENSGGOP00000014368  .............................................................----------------.
ENSGGOP00000023413  .............................................................----------------.
ENSGGOP00000007126  .............................................................----------------.
ENSGGOP00000008349  .............................................................-------LNTKFSEEE.
ENSGGOP00000011020  .............................................................----------------.
ENSGGOP00000015507  .............................................................----------------.
ENSGGOP00000012471  .............................................................----------------.
ENSGGOP00000012549  .............................................................---------PDQETEE.
ENSGGOP00000019099  .............................................................--------------DM.
ENSGGOP00000003031  .............................................................--------------DM.
ENSGGOP00000005101  .............................................................----------------.
ENSGGOP00000024511  .............................................................----------------.
ENSGGOP00000018250  .............................................................-----------FDQSQ.
ENSGGOP00000003074  .............................................................---------RPLGQDE.
ENSGGOP00000012477  .............................................................----------------.
ENSGGOP00000010001  .............................................................----------------.
ENSGGOP00000020622  .............................................................----------------.
ENSGGOP00000010490  .............................................................---------ERLSAEQ.
ENSGGOP00000015637  .............................................................----------------.
ENSGGOP00000011144  .............................................................-----------FDQSQ.
ENSGGOP00000026982  .............................................................-----------FDQSQ.
ENSGGOP00000003975  .............................................................-----------FDQSQ.
ENSGGOP00000004885  .............................................................----------------.
ENSGGOP00000014678  .............................................................----------------.
ENSGGOP00000013437  .............................................................----------------.
ENSGGOP00000011390  .............................................................----------------.
ENSGGOP00000010036  .............................................................--------------DE.
ENSGGOP00000027819  .............................................................----------ELRPEE.
ENSGGOP00000012841  .............................................................------------RPEE.
ENSGGOP00000009918  .............................................................----------ELRPEE.
ENSGGOP00000012485  .............................................................--------------ID.
ENSGGOP00000009782  .............................................................----------ELGPEE.
ENSGGOP00000009375  .............................................................---------RELSEEQ.
ENSGGOP00000023560  .............................................................----------------.
ENSGGOP00000014947  .............................................................----------------.
ENSGGOP00000012603  .............................................................----------------.
ENSGGOP00000017349  .............................................................----------------.
ENSGGOP00000003738  .............................................................----------------.
ENSGGOP00000007513  .............................................................----------------.
ENSGGOP00000022235  .............................................................----------------.
ENSGGOP00000001928  .............................................................----------------.
ENSGGOP00000013652  .............................................................---------DISEDDI.
ENSGGOP00000006109  .............................................................----------------.
ENSGGOP00000003219  .............................................................-----------FTEDQ.
ENSGGOP00000022428  ..............................................mptthqihveqsisl----------------.
ENSGGOP00000017119  .............................................rmptthqihveqsisl----------------.
ENSGGOP00000003545  .............................................rmptthqihveqsisl----------------.
ENSGGOP00000023406  .............................................................-----------FSKEQ.
ENSGGOP00000007856  .............................................................------------EDDI.
ENSGGOP00000011697  .............................................................-----------FSKEQ.
ENSGGOP00000018636  .............................................................----------------.
ENSGGOP00000017641  .............................................................-----------FNKDQ.
ENSGGOP00000013074  .............................................................----------------.
ENSGGOP00000007661  .............................................................--------AKFLSQDQ.
ENSGGOP00000020763  .............................................................----------------.
ENSGGOP00000005624  .............................................................-----------FEQTQ.
ENSGGOP00000025395  .............................................................-------------ASC.
ENSGGOP00000019250  .............................................................-------------ASC.
ENSGGOP00000020096  .............................................................-----------FDQSQ.
ENSGGOP00000000796  .............................................................----------------.
ENSGGOP00000004196  .............................................................----------------.
ENSGGOP00000002530  .............................................................-----------FTPEQ.
ENSGGOP00000015006  .............................................................----------------.
ENSGGOP00000016611  .............................................................-----------FDQTQ.
ENSGGOP00000004209  .............................................................---------TGFSQAS.
ENSGGOP00000011570  .............................................................----------------.
ENSGGOP00000006906  .............................................................-------------AER.
ENSGGOP00000024832  .............................................................-------------AER.
ENSGGOP00000019567  .............................................................-----------FTADQ.
ENSGGOP00000009496  .............................................................-----------FTADQ.
ENSGGOP00000012555  .............................................................---------------E.
ENSGGOP00000006153  .............................................................----------------.
ENSGGOP00000008018  .............................................................---------------E.
ENSGGOP00000007513  .............................................................----------------.
ENSGGOP00000024452  .............................................................---------------E.
ENSGGOP00000005045  .............................................................---------LKLDWDG.
ENSGGOP00000017287  .............................................................----------------.
ENSGGOP00000004706  .............................................................----------------.
ENSGGOP00000022428  .............................................................----------------.
ENSGGOP00000017119  .............................................................----------------.
ENSGGOP00000003545  .............................................................----------------.
ENSGGOP00000004257  .............................................................----------------.
ENSGGOP00000024127  .............................................................--------PWRITEEQ.
ENSGGOP00000012291  .............................................................------------PQSS.
ENSGGOP00000004812  .............................................................----------------.
ENSGGOP00000012046  .............................................................----------------.
ENSGGOP00000015625  .............................................................--------PWRITEEQ.
ENSGGOP00000008889  .............................................................---------WKITDEQ.
ENSGGOP00000008482  .............................................................------------TERC.
ENSGGOP00000013349  .............................................................----------------.
ENSGGOP00000011422  .............................................................----------------.
ENSGGOP00000018846  .............................................................----------------.
ENSGGOP00000003216  .............................................................-----------FNKDQ.
ENSGGOP00000021719  .............................................................------------NERQ.
ENSGGOP00000005693  .............................................................----------------.
ENSGGOP00000010676  .............................................................----------------.
ENSGGOP00000007432  .............................................................--------------ST.
ENSGGOP00000018435  .............................................................------------PDES.
ENSGGOP00000006035  .............................................................--------PWAVKPED.
ENSGGOP00000025507  .............................................................--------PWAVKPED.
ENSGGOP00000006035  .............................................................-----------VSPAE.
ENSGGOP00000025507  .............................................................-----------VSPAE.
ENSGGOP00000003343  .............................................................----------------.
ENSGGOP00000020870  .............................................................--------------DE.
ENSGGOP00000002976  .............................................................--------------DE.
ENSGGOP00000024041  .............................................................----------------.
ENSGGOP00000009817  .............................................................----------------.
ENSGGOP00000011240  .............................................................------AGVTHLEESD.
ENSGGOP00000008587  .............................................................----------------.
ENSGGOP00000007432  .............................................................-------NMWAITSEE.
ENSGGOP00000013302  .............................................................-------------VAD.
ENSGGOP00000024313  .............................................................-------------VAD.
ENSGGOP00000000552  .............................................................----------------.
ENSGGOP00000002697  .............................................................-------GKTGFSSDQ.
ENSGGOP00000016489  .............................................................----------------.
ENSGGOP00000028006  .............................................................----------------.
ENSGGOP00000023206  .............................................................----------------.
ENSGGOP00000006503  .............................................................----------------.
ENSGGOP00000006509  .............................................................----------------.
ENSGGOP00000021892  .............................................................----------------.
ENSGGOP00000004839  .............................................................----------------.
ENSGGOP00000019168  .............................................................------FQMVGLKKKS.
ENSGGOP00000003722  .............................................................----------------.
ENSGGOP00000007472  .............................................................-QQIQARNTTGVTEEA.
ENSGGOP00000027338  .............................................................----------------.
ENSGGOP00000007156  .............................................................----------------.
ENSGGOP00000024526  .............................................................----------------.
ENSGGOP00000028098  .............................................................----------------.
ENSGGOP00000007082  .............................................................----------------.
ENSGGOP00000023859  .............................................................----------------.
ENSGGOP00000019080  .............................................................----------------.
ENSGGOP00000010449  .............................................................----------------.
ENSGGOP00000000844  .............................................................-------------ERN.
ENSGGOP00000023819  .............................................................----------------.
ENSGGOP00000006595  .............................................................-------------EEY.
ENSGGOP00000006390  .............................................................-------------QEV.
ENSGGOP00000015096  .............................................................----------------.
ENSGGOP00000019080  .............................................................----------------.
ENSGGOP00000002308  .............................................................----------------.
ENSGGOP00000023711  .............................................................----------------.
ENSGGOP00000000733  .............................................................----------------.
ENSGGOP00000023859  .............................................................----------------.
ENSGGOP00000028529  .............................................................----------------.
ENSGGOP00000015096  .............................................................----------------.
ENSGGOP00000002979  .............................................................----------------.
ENSGGOP00000000348  .............................................................----------------.
ENSGGOP00000012168  .............................................................----------------.
ENSGGOP00000021101  .............................................................----------------.
ENSGGOP00000024236  .............................................................----------------.
ENSGGOP00000005783  .............................................................----LTRDAKGISQEQ.
ENSGGOP00000011525  .............................................................----------------.
ENSGGOP00000011629  .............................................................---ILTRDAKGITQEQ.
ENSGGOP00000009256  .............................................................------FQMVGLKKKS.
ENSGGOP00000022443  .............................................................----------------.
ENSGGOP00000013081  .............................................................----------------.
ENSGGOP00000006507  .............................................................----YCPEEKEMKPAC.
ENSGGOP00000026277  .............................................................----YCPEEKEMKPAC.
ENSGGOP00000026775  .............................................................----------------.
ENSGGOP00000015605  .............................................................-----TRDAKGLSQEQ.
ENSGGOP00000013437  .............................................................----------------.
ENSGGOP00000015096  .............................................................----------------.
ENSGGOP00000015264  .............................................................-----------LKPEK.
ENSGGOP00000019492  .............................................................---------------E.
ENSGGOP00000015242  .............................................................---------------E.
ENSGGOP00000015096  .............................................................----------------.
ENSGGOP00000011088  .............................................................-------------VRN.
ENSGGOP00000020157  .............................................................----------------.
ENSGGOP00000025587  .............................................................----------------.
ENSGGOP00000002805  .............................................................---------TTISREE.
ENSGGOP00000013256  .............................................................----------------.
ENSGGOP00000023524  .............................................................----------------.
ENSGGOP00000013295  .............................................................----------------.
ENSGGOP00000018258  .............................................................----------------.
ENSGGOP00000005688  .............................................................----------------.
ENSGGOP00000007088  .............................................................----------------.
ENSGGOP00000004418  .............................................................----------------.
ENSGGOP00000004827  .............................................................----------EASPSD.
ENSGGOP00000023450  .............................................................----------GISQEQ.
ENSGGOP00000007087  .............................................................----------------.
ENSGGOP00000020253  .............................................................----------------.
ENSGGOP00000027573  .............................................................----------------.
ENSGGOP00000021162  .............................................................----------------.
ENSGGOP00000016495  .............................................................--------------ES.
ENSGGOP00000005787  .............................................................----------------.
ENSGGOP00000020487  .............................................................----------------.
ENSGGOP00000016148  .............................................................----------GISQEQ.
ENSGGOP00000015096  .............................................................----------------.
ENSGGOP00000012603  .............................................................----------------.
ENSGGOP00000015201  .............................................................-----------VSDEE.
ENSGGOP00000024915  .............................................................------------TARC.
ENSGGOP00000023450  .............................................................---------------T.
ENSGGOP00000001678  .............................................................------TEFPEFSRRL.
ENSGGOP00000024627  .............................................................----------------.
ENSGGOP00000018908  .............................................................---------------N.
ENSGGOP00000025434  .............................................................-----------FNKDQ.
ENSGGOP00000006199  .............................................................----------------.
ENSGGOP00000019261  .............................................................----------------.
ENSGGOP00000005693  .............................................................------KTFDQLTPEEs
ENSGGOP00000001807  .............................................................----------------.
ENSGGOP00000024313  .............................................................--------------EE.
ENSGGOP00000019354  .............................................................-------------PSD.
ENSGGOP00000018853  .............................................................------FQMVGLKKKS.
ENSGGOP00000008614  .............................................................---------TQISKDE.
ENSGGOP00000024313  .............................................................----------------.
ENSGGOP00000000552  .............................................................----------------.
ENSGGOP00000004747  .............................................................----------------.
ENSGGOP00000013302  .............................................................----------------.
ENSGGOP00000020941  .............................................................----------------.
ENSGGOP00000000504  .............................................................-----------VSEET.
ENSGGOP00000024502  .............................................................-----------VSEET.
ENSGGOP00000011848  .............................................................---------------S.
ENSGGOP00000024360  .............................................................----------------.
ENSGGOP00000000733  .............................................................----------------.
ENSGGOP00000024360  .............................................................-------------AAR.
ENSGGOP00000021249  .............................................................----------------.
ENSGGOP00000019415  .............................................................----------------.
ENSGGOP00000013501  .............................................................-------EAKQLRPAC.
ENSGGOP00000021515  .............................................................----------------.
ENSGGOP00000005854  .............................................................----------------.
ENSGGOP00000016618  .............................................................----------------.
ENSGGOP00000024091  ...........................................................ql-----QHKEKKLSASQ.
ENSGGOP00000013700  .............................................................----------------.
ENSGGOP00000008485  .............................................................----------------.
ENSGGOP00000011966  .............................................................----------------.
ENSGGOP00000023645  .............................................................----------------.
ENSGGOP00000028176  .............................................................----------------.
ENSGGOP00000004508  .............................................................-----------MDNLQ.
ENSGGOP00000018206  .............................................................-----------MDNLQ.
ENSGGOP00000006739  .............................................................----------------.
ENSGGOP00000023979  .............................................................----------------.
ENSGGOP00000012342  .............................................................----------------.
ENSGGOP00000023206  .............................................................-------------EEQ.
ENSGGOP00000001608  .............................................................---------------E.
ENSGGOP00000010042  .............................................................----------------.
ENSGGOP00000028006  .............................................................-------------EEQ.
ENSGGOP00000025507  .............................................................----------------.
ENSGGOP00000020583  .............................................................----------------.
ENSGGOP00000012393  .............................................................----------------.
ENSGGOP00000016724  .............................................................----------------.
ENSGGOP00000023938  .............................................................----------------.
ENSGGOP00000022364  .............................................................----------------.
ENSGGOP00000005326  .............................................................-------KEKKLSASQ.
ENSGGOP00000008587  .............................................................-----AKEFDQLTPEEs
ENSGGOP00000002982  .............................................................----------------.
ENSGGOP00000006523  .............................................................----------------.
ENSGGOP00000014183  .............................................................----------------.
ENSGGOP00000018435  .............................................................----------------.
ENSGGOP00000021184  .............................................................----------------.
ENSGGOP00000015096  .............................................................----------------.
ENSGGOP00000024360  .............................................................-------------SKE.
ENSGGOP00000027849  .............................................................----------------.
ENSGGOP00000022443  .............................................................----------------.
ENSGGOP00000013081  .............................................................----------------.
ENSGGOP00000022610  .............................................................----------------.
ENSGGOP00000010606  .............................................................----------------.
ENSGGOP00000026802  shlwhsaslesveslksdeeaestkeaqnelfeaqgqlqtwdsedfgspqkscspsfdtpe----------------.
ENSGGOP00000011774  .............................................................----------------.
ENSGGOP00000002441  shlwhsaslesveslksdeeaestkeaqnelfeaqgqlqtwdsedfgspqkscspsfdtpe----------------.
ENSGGOP00000002021  ...........................................pvvvdwasgvspkpdpkt----------------.
ENSGGOP00000009877  .............................................................----------------.
ENSGGOP00000016754  .............................................................-------------PEK.
ENSGGOP00000007308  .............................................................----------------.
ENSGGOP00000012932  .............................................................----------------.
ENSGGOP00000012554  .............................................................----------------.
ENSGGOP00000011621  .............................................................-----------LSSNL.
ENSGGOP00000024380  .................skqqlsdnqrqisdaiaaasivtngtgiestslgifgvgilqln----------------.
ENSGGOP00000000011  .............................................................----------------.
ENSGGOP00000007649  .................skqqlsdnqrqisdaiaaasivtngtgiestslgifgvgilqln----------------.
ENSGGOP00000006035  .............................................................----------------.
ENSGGOP00000011720  .............................................................--------------SK.
ENSGGOP00000002269  .............................................................----------------.
ENSGGOP00000018132  .............................................................----------------.
ENSGGOP00000017534  .............................................................----------------.
ENSGGOP00000004508  .............................................................----------------.
ENSGGOP00000018206  .............................................................----------------.
ENSGGOP00000016496  .............................................................---------------A.
ENSGGOP00000012932  .............................................................----------------.
ENSGGOP00000004839  .............................................................----------------.
ENSGGOP00000008738  .............................................................----------------.
ENSGGOP00000028586  .............................................................----------------.
ENSGGOP00000011240  .............................................................----------------.
ENSGGOP00000007686  .............................................................------------SQED.
ENSGGOP00000000151  .............................................................-----------FTEVH.
ENSGGOP00000006499  .............................................................----------------.
ENSGGOP00000023045  .............................................................----------------.
ENSGGOP00000020565  .............................................................----------------.
ENSGGOP00000012340  .............................................................----------------.
ENSGGOP00000023745  .............................................................----------------.
ENSGGOP00000008325  .............................................................----------------.
ENSGGOP00000022444  .............................................................----------------.
ENSGGOP00000024026  .............................................................----------------.
ENSGGOP00000003268  .............................................................----------------.
ENSGGOP00000012291  .............................................................----------AITVEE.
ENSGGOP00000020860  .............................................................----------------.
ENSGGOP00000004747  .............................................................----------------.
ENSGGOP00000016725  .............................................................--------LINFKVSS.
ENSGGOP00000027884  .............................................................--------LINFKVSS.
ENSGGOP00000008864  .............................................................-------QTSGLSKMS.
ENSGGOP00000024021  .............................................................----------------.
ENSGGOP00000002559  .............................................................----------------.
ENSGGOP00000008975  .............................................................----------------.
ENSGGOP00000015810  .............................................................----------------.
ENSGGOP00000022677  .............................................................----------------.
ENSGGOP00000001056  .............................................................----------------.
ENSGGOP00000024407  .............................................................----------------.
ENSGGOP00000008333  .............................................................----------------.
ENSGGOP00000005688  .............................................................----------------.
ENSGGOP00000027880  .............................................................----------------.
ENSGGOP00000015096  .............................................................----------------.
ENSGGOP00000022419  .............................................................----------------.
ENSGGOP00000003523  .............................................................----------------.
ENSGGOP00000007901  .............................................................--------------ER.
ENSGGOP00000008530  .............................................................-----------LKEEL.
ENSGGOP00000007957  .............................................................----------------.
ENSGGOP00000010635  .............................................................----------------.
ENSGGOP00000004392  .............................................................---------------E.
ENSGGOP00000010370  .............................................................----------------.
ENSGGOP00000022364  .............................................................----------------.
ENSGGOP00000015625  .............................................................----------------.
ENSGGOP00000007654  .............................................................----------------.
ENSGGOP00000020583  .............................................................----------------.
ENSGGOP00000013302  .............................................................----------------.
ENSGGOP00000010930  .............................................................----------------.
ENSGGOP00000005349  .............................................................----------------.
ENSGGOP00000008253  .............................................................----------------.
ENSGGOP00000001993  .............................................................----------------.
ENSGGOP00000024222  .............................................................----------------.
ENSGGOP00000002875  .............................................................----------------.
ENSGGOP00000012369  .............................................................----------------.
ENSGGOP00000011933  .............................................................----------------.
ENSGGOP00000011848  .............................................................----------------.
ENSGGOP00000018329  .............................................................------------TEEE.
ENSGGOP00000000391  .............................................................------------TEEE.
ENSGGOP00000013508  .............................................................----------------.
ENSGGOP00000022560  .............................................................----------------.
ENSGGOP00000019614  .............................................................----------------.
ENSGGOP00000015110  .............................................................----------------.
ENSGGOP00000008437  .............................................................----------------.
ENSGGOP00000016998  .............................................................----------------.
ENSGGOP00000024026  .............................................................----------------.
ENSGGOP00000017722  .............................................................----------------.
ENSGGOP00000017757  .............................................................----------------.
ENSGGOP00000002740  .............................................................----------------.
ENSGGOP00000012168  .............................................................----------------.
ENSGGOP00000001815  .............................................................----------------.
ENSGGOP00000020483  .............................................................----------------.
ENSGGOP00000020927  .............................................................----------------.
ENSGGOP00000002387  .............................................................----------------.
ENSGGOP00000006515  .............................................................----------------.
ENSGGOP00000008725  .............................................................-------------NYM.
ENSGGOP00000018073  .............................................................-------------NYM.
ENSGGOP00000015740  .............................................................----------------.


                         20           30           40                                               
                          |            |            |                                               
d1kful1               .DDGVRRLFAQLA...GEDA...EISAFELQT...IL.........................................
ENSGGOP00000000209  .IAEFKEAFSLFDk..DGDG...TITTKELGT...VM.........................................
ENSGGOP00000022972  .IAEFKEAFSLFDk..DGDG...TITTKELGT...VM.........................................
ENSGGOP00000021376  .IQEWYKGFLR-D...CPSG...HLSMEEFKK...IY.........................................
ENSGGOP00000009800  .LQEWYKGFLK-D...CPTG...ILNVDEFKK...IY.........................................
ENSGGOP00000011095  .KQEIREAFDLFDa..DGTG...TIDVKELKV...AM.........................................
ENSGGOP00000003638  .VRQFRRLFAQLA...GDDM...EVSATELMN...IL.........................................
ENSGGOP00000025293  .VRQFRRLFAQLA...GDDM...EVSATELMN...IL.........................................
ENSGGOP00000002483  .IAEFKEAFSLFDk..DGDG...TITTKELGT...VM.........................................
ENSGGOP00000028220  .LQEWYKGFLK-D...CPTG...HLTVDEFKK...IY.........................................
ENSGGOP00000017724  .-TEFKEAFSLFDk..DGDG...TITTKELGT...VM.........................................
ENSGGOP00000006566  .VTEFKEAFSLFDk..DGDG...CITTRELGT...VM.........................................
ENSGGOP00000019618  .--EFKEAFSLFDk..DGDG...TITTKELGT...VM.........................................
ENSGGOP00000008245  pRTDIEDLFKKINg..DKTD...YLTVDQLVS...FL.........................................
ENSGGOP00000025102  .LKQWYKGFLK-D...CPSG...RLNLEEFQQ...LY.........................................
ENSGGOP00000010426  .------------...----...---------...--.........................................
ENSGGOP00000015754  .------QFGQLDqh.PIDG...YLSHTELAP...LR.........................................
ENSGGOP00000012299  .QQQFRNIFKQIA...GDDM...EICADELKK...VL.........................................
ENSGGOP00000021175  pRTDIEDLFKKINg..DKTD...YLTVDQLVS...FL.........................................
ENSGGOP00000019593  .QQQFRNIFKQIA...GDDM...EICADELKK...VL.........................................
ENSGGOP00000006396  .RKELQVLYRGFKne.CPSG...IVNEENFKQ...IY.........................................
ENSGGOP00000022632  .------------...----...---------...--.........................................
ENSGGOP00000011943  .------------...----...---------...--.........................................
ENSGGOP00000008286  .IAGLEESFRKFAi..HGDP...KASGQEMNGk..NW.........................................
ENSGGOP00000015051  .------QFSELDqh.PMDR...VLTHSELAP...LR.........................................
ENSGGOP00000024872  .------QFSELDqh.PMDR...VLTHSELAP...LR.........................................
ENSGGOP00000011390  .------------...----...---------...--.........................................
ENSGGOP00000008090  .LKQWYKGFLK-D...CPSG...RLNLEEFQQ...LY.........................................
ENSGGOP00000006979  .IQEWYKGFLR-D...CPSG...HLSMEEFKK...IY.........................................
ENSGGOP00000014947  .LSTTNEIFKQHKln.QNDQ...LLSVPDVIN...CL.........................................
ENSGGOP00000000749  .------------...----...---------...--.........................................
ENSGGOP00000022235  .LSTTNEIFKQHKln.QNDQ...LLSVPDVIN...CL.........................................
ENSGGOP00000004772  .IQEFKEAFTIMDq..NRDG...FIDKNDLRD...TF.........................................
ENSGGOP00000001305  .KQEVREAFDLFDv..DGSG...TIDVKELKV...AM.........................................
ENSGGOP00000009619  .KKELQSLYRGFKne.CPTG...LVDEDTFKL...IY.........................................
ENSGGOP00000027707  .IAEFKAAFDMFDa..DGGG...DISVKELGT...VM.........................................
ENSGGOP00000013700  .------------...---G...LISPSDFAQ...LQ.........................................
ENSGGOP00000026634  .IVEFKKAYLLFDk..DGDG...TITTKELGT...EM.........................................
ENSGGOP00000027354  .KRELQVLYRGFKne.CPSG...VVNEDTFKQ...IY.........................................
ENSGGOP00000007591  .DENFKALFRQLA...GEDM...EISVKELRT...IL.........................................
ENSGGOP00000024754  .DENFKALFRQLA...GEDM...EISVKELRT...IL.........................................
ENSGGOP00000000341  .------------...----...---------...--.........................................
ENSGGOP00000006559  .EAQYKKAFSTVDt..DENG...TINAQELGA...AL.........................................
ENSGGOP00000001194  .VQQWYKGFIK-D...CPSG...QLDAAGFQK...IY.........................................
ENSGGOP00000020610  .---IHSCLRKADk..NKDN...KMSFKELQN...FL.........................................
ENSGGOP00000003736  .---IHSCLRKADk..NKDN...KMSFKELQN...FL.........................................
ENSGGOP00000004196  .------------...----...---------...--.........................................
ENSGGOP00000015532  .KNEFKAAFDIFVlg.AEDG...CISTKELGK...VM.........................................
ENSGGOP00000000785  .---LYGYFAAVA...GQDG...QIDADELQR...CL.........................................
ENSGGOP00000014368  .---IHSYLHRADs..NQDS...KMSFKEIKS...LL.........................................
ENSGGOP00000023413  .-RELQVLYRGFKne.CPSG...VVNEDTFKQ...IYaqffphgalpclegspcveflpps.................
ENSGGOP00000007126  .-RELQVLYRGFKne.CPSG...VVNEDTFKQ...IYaqffphgalpclegspcveflpps.................
ENSGGOP00000008349  .LCSWYQSFLK-D...CPTG...RITQQQFQS...IY.........................................
ENSGGOP00000011020  .---IHSYLHRADs..NQDS...KMSFKEIKS...LL.........................................
ENSGGOP00000015507  .-PEAYSWFQSVDs..DHSG...YISMKELKQ...AL.........................................
ENSGGOP00000012471  .-TECHQWYKKFMte.CPSG...QLTLYEFRQ...FF.........................................
ENSGGOP00000012549  .EQRFRALFEQVA...GEDM...EVTAEELEY...VL.........................................
ENSGGOP00000019099  .DQDFLHLFKIVA...GEGK...EIGVYELQR...LL.........................................
ENSGGOP00000003031  .DQDFLHLFKIVA...GEGK...EIGVYELQR...LL.........................................
ENSGGOP00000005101  .------------...----...---------...--.........................................
ENSGGOP00000024511  .-TECHQWYKKFMte.CPSG...QLTLYEFRQ...FF.........................................
ENSGGOP00000018250  .IQEFKEAFNMIDq..NRDG...FIDKEDLHD...ML.........................................
ENSGGOP00000003074  .IEELREAFLEFDk..DRDG...FISCKDLGN...LM.........................................
ENSGGOP00000012477  .-TECHQWYKKFMte.CPSG...QLTLYEFRQ...FF.........................................
ENSGGOP00000010001  .DQWLKQTFDEADk..NGDG...TLSIGEVLQ...LL.........................................
ENSGGOP00000020622  .DQWLKQTFDEADk..NGDG...TLSIGEVLQ...LL.........................................
ENSGGOP00000010490  .IKEYKGVFEMFDe..EGNG...EVKTGELER...LM.........................................
ENSGGOP00000015637  .---VSQMFSEIDv..DNLG...HITLCNAVQ...CI.........................................
ENSGGOP00000011144  .IQEFKEAFNMIDq..NRDG...FIDKEDLHD...ML.........................................
ENSGGOP00000026982  .IQEFKEAFNMIDq..NRDG...FIDKEDLHD...ML.........................................
ENSGGOP00000003975  .IQEFKEAFNMIDq..NRDG...FIDKEDLHD...ML.........................................
ENSGGOP00000004885  .-----------Dd..FRGG...KINLEKTQR...LL.........................................
ENSGGOP00000014678  .-----TYFSAVA...GQDG...EVDAEELQR...CL.........................................
ENSGGOP00000013437  .------------...----...---------...--.........................................
ENSGGOP00000011390  .------------...----...---------...--.........................................
ENSGGOP00000010036  .IKRLGKRFKKLDl..DNSG...SLSVEEFMS...LP.........................................
ENSGGOP00000027819  .IEELQVAFQEFDr..DRDG...YIGCRELGA...CM.........................................
ENSGGOP00000012841  .IEELREAFREFDk..DKDG...YINCRDLGN...CM.........................................
ENSGGOP00000009918  .IEELQVAFQEFDr..DRDG...YIGCRELGA...CM.........................................
ENSGGOP00000012485  .VAELQEWYKKFVme.CPSG...TLFMHEFKR...FF.........................................
ENSGGOP00000009782  .LDELQAAFEEFDt..DRDG...YISHRELGD...CM.........................................
ENSGGOP00000009375  .KQEIKDAFELFDt..DKDE...AIDYHELKKv..AM.........................................
ENSGGOP00000023560  .------------...----...VLPWAEFES...LL.........................................
ENSGGOP00000014947  .------------...NNKP...EISVKEFID...WM.........................................
ENSGGOP00000012603  .------------...----...---------...--.........................................
ENSGGOP00000017349  .------------...--KT...IVPWKSFRQ...AL.........................................
ENSGGOP00000003738  .------------...--KT...IVPWKSFRQ...AL.........................................
ENSGGOP00000007513  .------------...----...---------...--.........................................
ENSGGOP00000022235  .------------...NNKP...EISVKEFID...WM.........................................
ENSGGOP00000001928  .--WLKTVFEAADv..DGNG...IMLEDTSVE...LI.........................................
ENSGGOP00000013652  .DDGFRRLFAQLA...GEFG...EVEGFQVSRmqaTC.........................................
ENSGGOP00000006109  .------------...-PSG...LQTLHEFKT...LL.........................................
ENSGGOP00000003219  .TAEFKEAFQLFDr..TGDG...KILYSQCGD...VM.........................................
ENSGGOP00000022428  .------------...----...---------...--.........................................
ENSGGOP00000017119  .------------...----...---------...--.........................................
ENSGGOP00000003545  .------------...----...---------...--.........................................
ENSGGOP00000023406  .QDEFKEAFLLFDr..TGDS...KITLSQVGD...VL.........................................
ENSGGOP00000007856  .DDGFRRLFAQLAg..EQD-...---------...--.........................................
ENSGGOP00000011697  .QDEFKEAFLLFDr..TGDS...KITLSQVGD...VL.........................................
ENSGGOP00000018636  .--------RKFF...GDKT...IVPWKVFRQ...CL.........................................
ENSGGOP00000017641  .LEEFKEAFELFDr..VGDG...KILYSQCGD...VM.........................................
ENSGGOP00000013074  .-----DLFWYLDy..NKDG...TLDIFELQE...GL.........................................
ENSGGOP00000007661  .INEYKECFSLYDk..QQRG...KIKATDLMV...AM.........................................
ENSGGOP00000020763  .IKGLGRVFRIMDd..DNNR...TLDFKEFMK...GL.........................................
ENSGGOP00000005624  .IQEFKEAFTLMDq..NRDG...FIDKEDLKD...TY.........................................
ENSGGOP00000025395  .KDSIGWMFSKLDt..SADL...FLDQTELAA...I-.........................................
ENSGGOP00000019250  .KDSIGWMFSKLDt..SADL...FLDQTELAA...I-.........................................
ENSGGOP00000020096  .IQEFKEAFTIMDq..NRDG...FIDKEDLRD...TF.........................................
ENSGGOP00000000796  .------------...----...---------...--.........................................
ENSGGOP00000004196  .------------...----...---------...--.........................................
ENSGGOP00000002530  .IEEFKEAFMLFDrtpKCEM...KITYGQCGD...VL.........................................
ENSGGOP00000015006  .------------...----...-LDRNAFRN...IL.........................................
ENSGGOP00000016611  .IQEFKEAFTVIDq..NRDG...IIDKEDLRD...TF.........................................
ENSGGOP00000004209  .LLRLHHRFRALDr..NKKG...YLSRMDLQQ...IG.........................................
ENSGGOP00000011570  .------------...----...---------...--.........................................
ENSGGOP00000006906  .RQRWGRLFEELDs..NKDG...RVDVHELRQ...GL.........................................
ENSGGOP00000024832  .RQRWGRLFEELDs..NKDG...RVDVHELRQ...GL.........................................
ENSGGOP00000019567  .IEEFKEAFSLFDrtpTGEM...KITYGQCGD...VL.........................................
ENSGGOP00000009496  .IEEFKEAFSLFDrtpTGEM...KITYGQCGD...VL.........................................
ENSGGOP00000012555  .ERVVHWYFKLLDk..NSSG...DIGKKEIKP...FK.........................................
ENSGGOP00000006153  .IQGLARFFRQLDw..DGSR...SLDADEFRQ...GL.........................................
ENSGGOP00000008018  .ERVVHWYFSQLDs..NSSN...DINKREMKP...FK.........................................
ENSGGOP00000007513  .-DKLRYVFSQMS...DSNG...LMIFSKFDQ...FL.........................................
ENSGGOP00000024452  .ERVVHWYFSQLDs..NSSN...DINKREMKP...FK.........................................
ENSGGOP00000005045  .VRKHLDEYASIAss.SKGG...RIGIEEFAK...YL.........................................
ENSGGOP00000017287  .-----QAFTIMDq..NRDG...FIDKEDLRD...TF.........................................
ENSGGOP00000004706  .------------...----...---------...--.........................................
ENSGGOP00000022428  .--KLRYIFSMIS...DSSG...V--------...--.........................................
ENSGGOP00000017119  .--KLRYIFSMIS...DSSG...V--------...--.........................................
ENSGGOP00000003545  .--KLRYIFSMIS...DSSG...V--------...--.........................................
ENSGGOP00000004257  .------------...----...---------...--.........................................
ENSGGOP00000024127  .REYYVNQFRSLQp..DPSS...FISGSVAKN...FF.........................................
ENSGGOP00000012291  .RLKYRQLFNSHDk..TMSG...HLTGPQART...IL.........................................
ENSGGOP00000004812  .-----QAFSCIDq..NRDG...IICKADLRE...TY.........................................
ENSGGOP00000012046  .------------...----...---------...FA.........................................
ENSGGOP00000015625  .REYYVNQFRSLQp..DPSS...FISGSVAKN...FF.........................................
ENSGGOP00000008889  .RQYYVNQFKTIQp..DLNG...FIPGSAAKE...FF.........................................
ENSGGOP00000008482  .IESLIAVFQKYA...GKDGynyTLSKTEFLS...FM.........................................
ENSGGOP00000013349  .------------...----...-----DLAV...GL.........................................
ENSGGOP00000011422  .------------...----...---------...FA.........................................
ENSGGOP00000018846  .------------...----...---------...--.........................................
ENSGGOP00000003216  .LEEFKEAFELFDr..VGDG...KILYSQCGD...VM.........................................
ENSGGOP00000021719  .NEFFTKFFEKAD...PDHP...EINAVQLQN...LL.........................................
ENSGGOP00000005693  .-----RRFKMADk..DGDL...IATKEEFTA...FL.........................................
ENSGGOP00000010676  .------------...----...---------...--.........................................
ENSGGOP00000007432  .RLKYRQKFNTLDk..SMSG...YLSGFQARN...AL.........................................
ENSGGOP00000018435  .KERLGKIVDRIDn..DGDG...FVTTEELKT...WI.........................................
ENSGGOP00000006035  .KAKYDAIFDSLS...PVNG...FLSGDKVKP...VL.........................................
ENSGGOP00000025507  .KAKYDAIFDSLS...PVNG...FLSGDKVKP...VL.........................................
ENSGGOP00000006035  .KAKYDEIFLKTDk..DMDG...FVSGLEVRE...IF.........................................
ENSGGOP00000025507  .KAKYDEIFLKTDk..DMDG...FVSGLEVRE...IF.........................................
ENSGGOP00000003343  .--DLTRAFQLQDh..RKSG...KLSVSQWAF...CM.........................................
ENSGGOP00000020870  .NERQNEFFTKFF...EKHP...EINAVQLQN...LL.........................................
ENSGGOP00000002976  .NERQNEFFTKFF...EKHP...EINAVQLQN...LL.........................................
ENSGGOP00000024041  .--WVTQQFKTIA...GEDG...EISLQEFKA...AL.........................................
ENSGGOP00000009817  .--WVTQQFKTIA...GEDG...EISLQEFKA...AL.........................................
ENSGGOP00000011240  .IIDLEKRYWLLKaq.SRTG...RFDLETFGP...LV.........................................
ENSGGOP00000008587  .----ERRFRVADq..DGDS...MATREELTA...FL.........................................
ENSGGOP00000007432  .RTKHDRQFDNLK...PSGG...YITGDQARN...FF.........................................
ENSGGOP00000013302  .KMRFDEIFLKTDl..DLDG...YVSGQEVKE...IF.........................................
ENSGGOP00000024313  .KMRFDEIFLKTDl..DLDG...YVSGQEVKE...IF.........................................
ENSGGOP00000000552  .------------...----...---------...--.........................................
ENSGGOP00000002697  .IEQLHRRFKQLS...GDQP...TIRKENFNN...V-.........................................
ENSGGOP00000016489  .METLINVFHAHSgk.E--GdkyKLSKKELKE...LL.........................................
ENSGGOP00000028006  .----KKRFEKANq..DSGP...GLSLEEFIA...FE.........................................
ENSGGOP00000023206  .----KKRFEKANq..DSGP...GLSLEEFIA...FE.........................................
ENSGGOP00000006503  .--GMIDMFHKYT...RRDD...KIDKPSLLT...MM.........................................
ENSGGOP00000006509  .--GMIDMFHKYT...RRDD...KIDKPSLLT...MM.........................................
ENSGGOP00000021892  .--ALIDVFHQYSgreGDKH...KLKKSELKE...LI.........................................
ENSGGOP00000004839  .--QFFEIWLHFDa..DGSG...YLEGKELQN...LI.........................................
ENSGGOP00000019168  .ADDVKKVFHILDk..DKSG...FIEEDELGF...IL.........................................
ENSGGOP00000003722  .--EIREAFKVFDr..DGNG...FISKQELGT...AM.........................................
ENSGGOP00000007472  .LKEFSMMFKHFDk..DKSG...RLNHQEFKS...CL.........................................
ENSGGOP00000027338  .--MIIDVFSRYSgseGSTQ...TLTKGELKV...LM.........................................
ENSGGOP00000007156  .------------...----...---------...--.........................................
ENSGGOP00000024526  .METMMFTFHKFA...GDKG...YLTKEDLRV...LM.........................................
ENSGGOP00000028098  .MDTMIRIFHRYSgkeR--Krf.KLSKGELKL...LL.........................................
ENSGGOP00000007082  .-DVMVSTFHKYS...GKEGdkfKLNKSELKE...LL.........................................
ENSGGOP00000023859  .------------...----...---R-----...--.........................................
ENSGGOP00000019080  .------------...----...---R-----...--.........................................
ENSGGOP00000010449  .------------...----...---------...--.........................................
ENSGGOP00000000844  .IETIINTFHQYSvklGHPD...TLNQGEFKE...LV.........................................
ENSGGOP00000023819  .--GMIDMFHKYT...RRDD...KIDKPSLLT...MM.........................................
ENSGGOP00000006595  .LEGIVNIFHQYSvrkGHFD...TLSKGELKQ...LL.........................................
ENSGGOP00000006390  .LENLKDRWYQADsp.PADL...LLTEEEFLS...FL.........................................
ENSGGOP00000015096  .----------KDv..ARQG...DINASDFLV...ALv........................................
ENSGGOP00000019080  .------------...--KR...SLSVQQLSQ...AL.........................................
ENSGGOP00000002308  .KSKYDEIFYNLA...PADG...KLSGSKAKT...WM.........................................
ENSGGOP00000023711  .KSKYDEIFYNLA...PADG...KLSGSKAKT...WM.........................................
ENSGGOP00000000733  .--EFMQIWRKYDa..DSSG...FISAAELRN...FL.........................................
ENSGGOP00000023859  .------------...--KR...SLSVQQLSQ...AL.........................................
ENSGGOP00000028529  .--GMIDMFHKYT...RRDD...KIDKPSLLT...MM.........................................
ENSGGOP00000015096  .-DELQKAFQLLDt..GQNL...TVSKSELRR...II.........................................
ENSGGOP00000002979  .----DEIFYTLS...PVDG...KITGANAKK...EM.........................................
ENSGGOP00000000348  .---YDEIFYTLS...PVNG...KITGANAKK...EM.........................................
ENSGGOP00000012168  .------------...---N...IISKDQLYL...AL.........................................
ENSGGOP00000021101  .LFQIIHCFHQYAar.QGDMe..TLSLQELQA...LL.........................................
ENSGGOP00000024236  .LFQIIHCFHQYAar.QGDMe..TLSLQELQA...LL.........................................
ENSGGOP00000005783  .MQEFRASFNHFDk..DHGG...ALGPEEFKA...CL.........................................
ENSGGOP00000011525  .------------...--DG...KISGVNAKK...EM.........................................
ENSGGOP00000011629  .MNEFRASFNHFDr..RKNG...LMDHEDFRA...CL.........................................
ENSGGOP00000009256  .ADDVKKVFHILDk..DKSG...FIEEDELGF...IL.........................................
ENSGGOP00000022443  .------------...----...---------...--.........................................
ENSGGOP00000013081  .------------...----...---------...--.........................................
ENSGGOP00000006507  .IKALTRIFKISDq..DNDG...TLNDAELNF...FQ.........................................
ENSGGOP00000026277  .IKALTRIFKISDq..DNDG...TLNDAELNF...FQ.........................................
ENSGGOP00000026775  .IESLISLFQKYVgkrGYNC...TLPKTEFLS...FM.........................................
ENSGGOP00000015605  .LNEFRASFNHFDr..KRNG...MMEPDDFRA...CL.........................................
ENSGGOP00000013437  .------------...----...---------...--.........................................
ENSGGOP00000015096  .-----TAFSALDk..EDTG...FVKATEFGQ...VL.........................................
ENSGGOP00000015264  .LEKDLDRYSERArm.KGGE...KIGIAEFAA...SL.........................................
ENSGGOP00000019492  .HGSQQSIFNRYA...QQRL...DIDATQLQG...LL.........................................
ENSGGOP00000015242  .HGSQQSIFNRYA...QQRL...DIDATQLQG...LL.........................................
ENSGGOP00000015096  .--DPYSAFFKTDa..DRDG...IINMHDLHR...LL.........................................
ENSGGOP00000011088  .VKALAEYFHILDv..HGKN...TLNDVLFYH...FL.........................................
ENSGGOP00000020157  .----VCTFQEYAgr.CGDKy..KLCQAELKE...LL.........................................
ENSGGOP00000025587  .---IINLFKQYSkkdKNTD...TLSKKELKE...LL.........................................
ENSGGOP00000002805  .LEELQEAFNKIDi..DNSG...YVSDYELQD...LF.........................................
ENSGGOP00000013256  .---LLAAFRHYDk..KGDG...MIDKAELQE...AC.........................................
ENSGGOP00000023524  .---LLAAFRHYDk..KGDG...MIDKAELQE...AC.........................................
ENSGGOP00000013295  .----GKYFQQLDk..EGNG...LLDKADFKQ...AL.........................................
ENSGGOP00000018258  .----GKYFQQLDk..EGNG...LLDKADFKQ...AL.........................................
ENSGGOP00000005688  .-AELRTIFLKYAsi.EKNGef.FMSPNDFVT...RY.........................................
ENSGGOP00000007088  .-GLLVAIFHKYSgreGDKH...TLSKKELKE...LI.........................................
ENSGGOP00000004418  .--SVIEVFHKYAkg.N--GdcaLLCKEELKQ...LL.........................................
ENSGGOP00000004827  .HRKWVEVFKACDe..DHKG...YLSREDFKT...AV.........................................
ENSGGOP00000023450  .MNEFRASFNHFDr..DHSG...TLGPEEFKA...CL.........................................
ENSGGOP00000007087  .--TMVTTFHKYS...GREGsklTLSRKELKE...LV.........................................
ENSGGOP00000020253  .LNSIIEVYHKYSlikGNFH...AVYRDDLKK...LL.........................................
ENSGGOP00000027573  .LNSIIEVYHKYSlikGNFH...AVYRDDLKK...LL.........................................
ENSGGOP00000021162  .------------...----...---------...--.........................................
ENSGGOP00000016495  .IETVVTTFFTFArqeGRKD...SLSVNEFKE...LV.........................................
ENSGGOP00000005787  .------------...----...---------...--.........................................
ENSGGOP00000020487  .ICDITEIFNQYVsh.DCDGa..ALTKKDLKN...LL.........................................
ENSGGOP00000016148  .MNEFRASFNHFDr..KKTG...MMDTDDFRA...CL.........................................
ENSGGOP00000015096  .---VEKALSAGDp..CKGG...YVSFNYLKI...VL.........................................
ENSGGOP00000012603  .------------...----...---------...--.........................................
ENSGGOP00000015201  .MMELREAFAKVDt..DGNG...YISFNELND...LF.........................................
ENSGGOP00000024915  .IESLKAVFQKYA...GKDGyncNLSNTEFPS...FM.........................................
ENSGGOP00000023450  .ADQVMASFKILA...GDKN...YITMDELRR...EL.........................................
ENSGGOP00000001678  .IKDLESMFKLYDa..GRDG...FIDLMELKL...MM.........................................
ENSGGOP00000024627  .------------...--KN...KISKSSFRE...ML.........................................
ENSGGOP00000018908  .INGIIEAFRRYArteGNCT...ALTRGELKR...LL.........................................
ENSGGOP00000025434  .LEEFKEAFELFDr..VGDG...KILYSQCGD...VM.........................................
ENSGGOP00000006199  .-----TFFILHDi..NSDG...VLDEQELEA...LF.........................................
ENSGGOP00000019261  .-----TFFILHDi..NSDG...VLDEQELEA...LF.........................................
ENSGGOP00000005693  .KERLGKIVSKIDg..DKDG...FVTVDELKD...WI.........................................
ENSGGOP00000001807  .----IDVFYQYAtqhGEYD...TLNKAELKE...LL.........................................
ENSGGOP00000024313  .KAKFDGIFESLL...PING...LLSGDKVKP...VL.........................................
ENSGGOP00000019354  .IDRYKKRFHKFDa..DQKG...FITIVDVQR...VL.........................................
ENSGGOP00000018853  .ADDVKKVFHILDk..DKSG...FIEEDELGA...SP.........................................
ENSGGOP00000008614  .LDELKEAFAKVDl..NSNG...FICDYELHE...LF.........................................
ENSGGOP00000024313  .----ESYYKQVDp..AYTG...RVGASEAAL...FL.........................................
ENSGGOP00000000552  .------MFRAAGg..EKTG...FVTAQSFIA...MW.........................................
ENSGGOP00000004747  .-RNFEIAFKMFDl..NGDG...EVDMEEFEQ...AIsiirsq...................................
ENSGGOP00000013302  .----ESYYKQVDp..AYTG...RVGASEAAL...FL.........................................
ENSGGOP00000020941  .------TFHKYScq.EGDKf..KLSKGEMKE...LLhkelpsfvghsrepcavrafrvhlfnpvigdlrnqspegks
ENSGGOP00000000504  .LKEFSTIYKHFDe..NLTG...RLTHKEFRS...CL.........................................
ENSGGOP00000024502  .LKEFSTIYKHFDe..NLTG...RLTHKEFRS...CL.........................................
ENSGGOP00000011848  .KERLGKIVDRINn..DGDG...FGTTEELKT...WI.........................................
ENSGGOP00000024360  .------------...--EN...YIAAEELQS...IL.........................................
ENSGGOP00000000733  .-AGFWQVWLRFDa..DEKG...YIEEKELDA...FF.........................................
ENSGGOP00000024360  .LEELQEVVLAADl..LEGD...MIAGKNLED...FL.........................................
ENSGGOP00000021249  .KSRVMDFFRRIDk..DQDG...KITRQEFID...GI.........................................
ENSGGOP00000019415  .KSRVMDFFRRIDk..DQDG...KITRQEFID...GI.........................................
ENSGGOP00000013501  .AQALTRIFRLSDq..DLDQ...ALSDEELNA...FQ.........................................
ENSGGOP00000021515  .EARLKELFDSFDt..TGTG...SLGQEELTD...LC.........................................
ENSGGOP00000005854  .EARLKELFDSFDt..TGTG...SLGQEELTD...LC.........................................
ENSGGOP00000016618  .------------...--NG...YIEGKELEN...FF.........................................
ENSGGOP00000024091  .MAAFQDAYNFFYk..DKTG...CIDFHGLMC...TV.........................................
ENSGGOP00000013700  .------------...----...---------...--.........................................
ENSGGOP00000008485  .METVLFTFHRFA...GDKG...YLMKQGLKV...FM.........................................
ENSGGOP00000011966  .------------...----...---------...--.........................................
ENSGGOP00000023645  .------------...----...---------...--.........................................
ENSGGOP00000028176  .-RELKQIFKAADs..KHTN...MVDYNTFRD...IL.........................................
ENSGGOP00000004508  .TEVLEIEFLSYS...NGMN...TISEEDFAH...IL.........................................
ENSGGOP00000018206  .TEVLEIEFLSYS...NGMN...TISEEDFAH...IL.........................................
ENSGGOP00000006739  .------------...----...RIDFEQFKG...MF.........................................
ENSGGOP00000023979  .------------...----...RIDFEQFKG...MF.........................................
ENSGGOP00000012342  .-RELKQIFKAADs..KHTN...MVDYNTFRD...IL.........................................
ENSGGOP00000023206  .QKRLQAIIKKIDl..DSDG...FLTESELSS...WI.........................................
ENSGGOP00000001608  .EERMRRLFQTCDg..DGDG...YISRNDLLM...VC.........................................
ENSGGOP00000010042  .---AQEFFQTCDa..EGKG...FIARKDMQR...LH.........................................
ENSGGOP00000028006  .QKRLQAIIKKIDl..DSDG...FLTESELSS...WI.........................................
ENSGGOP00000025507  .---YEKYYRQVDt..GNTG...RVLASDAAA...FL.........................................
ENSGGOP00000020583  .---FEIAFKMFDl..NGDG...EVDMEEFEQ...VQsiirsq...................................
ENSGGOP00000012393  .------------...----...---------...--.........................................
ENSGGOP00000016724  .------------...DRDH...FIRTLSLKP...LL.........................................
ENSGGOP00000023938  .---------RYDa..GRDG...FIDLMELKL...MM.........................................
ENSGGOP00000022364  .---FEIAFKMFDl..NGDG...EVDMEEFEQ...VQsiirsq...................................
ENSGGOP00000005326  .MAAFQDAYNFFYk..DKTG...CIDFHGLMC...TV.........................................
ENSGGOP00000008587  .QARLGRIVDRMDragDGDG...WVSLAELRA...WI.........................................
ENSGGOP00000002982  .------------...----...-IDASQFRE...LF.........................................
ENSGGOP00000006523  .----------YDa..GRDG...FIDLMELKL...MM.........................................
ENSGGOP00000014183  .-PRSHESFQEMDl..NDDW...KLSKDEVKA...YL.........................................
ENSGGOP00000018435  .------------...----...---------...--.........................................
ENSGGOP00000021184  .------------...----...---------...--.........................................
ENSGGOP00000015096  .---FYNMLRSYDl..GDTG...LIGRNNFKK...IM.........................................
ENSGGOP00000024360  .LSALHKACKIFSk..IRSG...KIYVNDLPV...IL.........................................
ENSGGOP00000027849  .------------...----...-IDASQFRE...LF.........................................
ENSGGOP00000022443  .----------AGg..ERTG...SVSVHKFVT...MW.........................................
ENSGGOP00000013081  .----------AGg..ERTG...SVSVHKFVT...MW.........................................
ENSGGOP00000022610  .------------...-GNG...YIEGKELEN...FF.........................................
ENSGGOP00000010606  .---WKVLFDQFDp..GNTG...YISTGKFRS...LL.........................................
ENSGGOP00000026802  .-SQIRGMWEELGv..GSSG...HLSEQELAV...VC.........................................
ENSGGOP00000011774  .----IETFHKYAse.DSNGa..TLTGRELKQ...LI.........................................
ENSGGOP00000002441  .-SQIRGMWEELGv..GSSG...HLSEQELAV...VC.........................................
ENSGGOP00000002021  .------------...----...---------...--.........................................
ENSGGOP00000009877  .------------...----...---------...--.........................................
ENSGGOP00000016754  .LTAFKEKYMEFDl..NNEG...EIDLMSLKR...MM.........................................
ENSGGOP00000007308  .------------...----...---------...--.........................................
ENSGGOP00000012932  .-----------Dl..GDKG...LISYTEYLF...LL.........................................
ENSGGOP00000012554  .-----LIFRNSS...DSDG...KLEKAVAKD...LL.........................................
ENSGGOP00000011621  .LEKLQKELKILDp..ISSG...FLLQSQLSH...LF.........................................
ENSGGOP00000024380  .------------...----...---------...--.........................................
ENSGGOP00000000011  .------------...----...---------...--.........................................
ENSGGOP00000007649  .------------...----...---------...--.........................................
ENSGGOP00000006035  .---YEKYYRQVDt..GNTG...RVLASDAAA...FL.........................................
ENSGGOP00000011720  .LEGFKEKYMEFDl..NGNG...DIDIMSLKR...ML.........................................
ENSGGOP00000002269  .--ILDKYFKNFD...NGDS...RLDSSEFLK...FV.........................................
ENSGGOP00000018132  .---AEELFLLCDk..EAKG...FITKHDLQG...LQ.........................................
ENSGGOP00000017534  .--ILDKYFKNFD...NGDS...RLDSSEFLK...FV.........................................
ENSGGOP00000004508  .------------...----...---------...--.........................................
ENSGGOP00000018206  .------------...----...---------...--.........................................
ENSGGOP00000016496  .IETLIKNFHQYSve.GGKE...TLTPSELRD...LV.........................................
ENSGGOP00000012932  .------------...----...---------...--.........................................
ENSGGOP00000004839  .------------...----...---------...--.........................................
ENSGGOP00000008738  .------------...----...---------...--.........................................
ENSGGOP00000028586  .---SIETFKQIDt..DNDR...QLSKAEINL...YL.........................................
ENSGGOP00000011240  .------------...----...---------...--.........................................
ENSGGOP00000007686  .GPRLRAVFDALDg..DGDG...FVRIEDFIQ...FA.........................................
ENSGGOP00000000151  .LAKIEKMFEE-Di..NSTG...ALGMDAFIK...AM.........................................
ENSGGOP00000006499  .------------...----...---------...--.........................................
ENSGGOP00000023045  .------------...----...---------...--.........................................
ENSGGOP00000020565  .------------...----...---------...--.........................................
ENSGGOP00000012340  .-----DTFKEYDp..DGKG...VISKRDFHK...AM.........................................
ENSGGOP00000023745  .-----DTFKEYDp..DGKG...VISKRDFHK...AM.........................................
ENSGGOP00000008325  .-----QMFKYFDa..DSNG...LVDINELTQ...VI.........................................
ENSGGOP00000022444  .------------...----...---------...--.........................................
ENSGGOP00000024026  .------------...----...---------...--.........................................
ENSGGOP00000003268  .------------...----...---------...--.........................................
ENSGGOP00000012291  .RAKHDQQFHSLK...PISG...FITGDQARN...FF.........................................
ENSGGOP00000020860  .----------FDp..GNTG...YISTGKFRS...LL.........................................
ENSGGOP00000004747  .-------FERHD...PVDG...RITERQFGG...ML.........................................
ENSGGOP00000016725  .AKFLKDKFVEIG...AHKD...ELSFEQFHL...FY.........................................
ENSGGOP00000027884  .AKFLKDKFVEIG...AHKD...ELSFEQFHL...FY.........................................
ENSGGOP00000008864  .ANQVKDVFRFIDn..DQSG...YLDEEELFQ...--.........................................
ENSGGOP00000024021  .------------...----...---------...--.........................................
ENSGGOP00000002559  .---LLYLFALHDy..DQSG...QLDGLELLS...ML.........................................
ENSGGOP00000008975  .-----DTFKEYDp..DGKG...IISKKEFQK...AM.........................................
ENSGGOP00000015810  .LKSIWYAFTALDv..EKSG...KVSKSQLKV...LS.........................................
ENSGGOP00000022677  .LKSIWYAFTALDv..EKSG...KVSKSQLKV...LS.........................................
ENSGGOP00000001056  .-RRLREVFEVCGr..DPDG...FLRVERVAA...LG.........................................
ENSGGOP00000024407  .--ALIDVFHQYSgreGDKH...KLKKSELKE...LI.........................................
ENSGGOP00000008333  .------------...----...HICLSELPF...VM.........................................
ENSGGOP00000005688  .LEHAKQAFVQRDn..ARTG...RVTAIDFRD...IM.........................................
ENSGGOP00000027880  .------------...----...HICLSELPF...VM.........................................
ENSGGOP00000015096  .------------...----...---------...--.........................................
ENSGGOP00000022419  .------------...----...---------...--.........................................
ENSGGOP00000003523  .------------...----...---------...--.........................................
ENSGGOP00000007901  .EAFLREAFAVLD...RGDG...SISKNDFVM...VL.........................................
ENSGGOP00000008530  .LKAIWHAFTALDq..DHSG...KVSKSQLKV...LS.........................................
ENSGGOP00000007957  .------------...----...---------...--.........................................
ENSGGOP00000010635  .------------...----...---------...--.........................................
ENSGGOP00000004392  .DDRQEWTFTLYDf..DNCG...KVTREDMSS...LM.........................................
ENSGGOP00000010370  .------------...----...---------...--.........................................
ENSGGOP00000022364  .------------...----...------MQQ...VA.........................................
ENSGGOP00000015625  .------------...----...---------...--.........................................
ENSGGOP00000007654  .--WLRKQFYSVDr..NRED...RISAKDLKN...ML.........................................
ENSGGOP00000020583  .------------...----...------MQQ...VA.........................................
ENSGGOP00000013302  .------------...---G...LLSGDKVKP...VL.........................................
ENSGGOP00000010930  .------------...----...---------...--.........................................
ENSGGOP00000005349  .------------...----...---------...--.........................................
ENSGGOP00000008253  .-------YTKQD...GECG...TLSKGELKE...LL.........................................
ENSGGOP00000001993  .------------...----...---------...--.........................................
ENSGGOP00000024222  .------------...--EN...VISVAELIN...AM.........................................
ENSGGOP00000002875  .------------...--EN...VISVAELIN...AM.........................................
ENSGGOP00000012369  .------------...----...---------...--.........................................
ENSGGOP00000011933  .----------YDv..AGQG...YLRESDLEN...YI.........................................
ENSGGOP00000011848  .------------...----...---------...--.........................................
ENSGGOP00000018329  .MYSLTETFQRCKv..IPDC...SLTLEDFLR...YR.........................................
ENSGGOP00000000391  .MYSLTETFQRCKv..IPDC...SLTLEDFLR...YR.........................................
ENSGGOP00000013508  .------------...----...---------...--.........................................
ENSGGOP00000022560  .------------...----...---------...--.........................................
ENSGGOP00000019614  .-----DAFKELDd..DMDG...TVSVTELQT...HL.........................................
ENSGGOP00000015110  .-----EAFQDYVt..DPRG...LISKKDFQK...AM.........................................
ENSGGOP00000008437  .-----DAFKELDd..DMDG...TVSVTELQT...HL.........................................
ENSGGOP00000016998  .-----EAFQDYVt..DPRG...LISKKDFQK...AM.........................................
ENSGGOP00000024026  .------------...-GEH...YMTPEDFVQ...RY.........................................
ENSGGOP00000017722  .------------...----...---------...--.........................................
ENSGGOP00000017757  .------------...----...---------...--.........................................
ENSGGOP00000002740  .------------...----...---------...--.........................................
ENSGGOP00000012168  .------------...----...---------...--.........................................
ENSGGOP00000001815  .------------...----...---------...--.........................................
ENSGGOP00000020483  .------------...----...---------...--.........................................
ENSGGOP00000020927  .------------...----...---------...--.........................................
ENSGGOP00000002387  .------------...----...---------...--.........................................
ENSGGOP00000006515  .------------...----...---------...--.........................................
ENSGGOP00000008725  .YEDFHELFQHLDf..DNDG...MVEEDDLRS...LM.........................................
ENSGGOP00000018073  .YEDFHELFQHLDf..DNDG...MVEEDDLRS...LM.........................................
ENSGGOP00000015740  .---LNSTFEACDp..QRTG...TVAVAQVLA...YL.........................................


                                       50        60                               70                
                                        |         |                                |                
d1kful1               .....RR..VL...AK..RQDIKSDGFSI...E..........TCKIMVDM..........L......DSDG...SGK
ENSGGOP00000000209  .....RS..LG...QN..PTE--------...A..........ELQDMINE..........V......DADG...NGT
ENSGGOP00000022972  .....RS..LG...QN..PTE--------...A..........ELQDMINE..........V......DADG...NGT
ENSGGOP00000021376  .....GN..FF...PY..GDA-------S...K..........FAEHVFRT..........F......DANG...DGT
ENSGGOP00000009800  .....AN..FF...PY..GDA-------S...K..........FAEHVFRT..........F......DTNS...DGT
ENSGGOP00000011095  .....RA..LG...FE..PKK--------...E..........EIKKMISE..........I......DKEG...TGK
ENSGGOP00000003638  .....NK..VV...TR..HPDLKTDGFGI...D..........TCRSMVAV..........M......DSDT...TGK
ENSGGOP00000025293  .....NK..VV...TR..HPDLKTDGFGI...D..........TCRSMVAV..........M......DSDT...TGK
ENSGGOP00000002483  .....RS..LG...QN..PTE--------...A..........ELQDMINE..........V......DADG...NGT
ENSGGOP00000028220  .....AN..FF...PY..GDA-------S...K..........FAEHVFRT..........F......DTNG...DGT
ENSGGOP00000017724  .....RS..LG...QN..PTE--------...A..........ELQDMINE..........V......DADG...NGT
ENSGGOP00000006566  .....RS..LG...QN..PTE--------...A..........ELRDMMSE..........I......DRDG...NGT
ENSGGOP00000019618  .....RS..LG...QN..PTE--------...A..........ELQDMINE..........V......DADG...NGT
ENSGGOP00000008245  .....NE..HQ...RDprLNEILFPFYDA...K..........RAMQIIEM..........Yepde..DLKK...KGL
ENSGGOP00000025102  .....VK..FF...PY..GDA-------S...K..........FAQHAFRT..........F......DKNG...DGT
ENSGGOP00000010426  .....--..--...--..-----------...-..........--------..........-......----...NDS
ENSGGOP00000015754  .....AP..LI...P-..-ME--------...H..........CTTRFFET..........C......DLDN...DKY
ENSGGOP00000012299  .....NT..VV...NK..HKDLKTHGFTL...E..........SCRSMIAL..........M......DTDG...SGK
ENSGGOP00000021175  .....NE..HQ...RDprLNEILFPFYDA...K..........RAMQIIEM..........Yepde..DLKK...KGL
ENSGGOP00000019593  .....NT..VV...NK..HKDLKTHGFTL...E..........SCRSMIAL..........M......DTDG...SGK
ENSGGOP00000006396  .....SQ..FFp..QG..DSS--------...T..........YATFLFNA..........F......DTNH...DGS
ENSGGOP00000022632  .....--..--...--..-----------...-..........--------..........-......-FNR...SES
ENSGGOP00000011943  .....--..--...--..-----------...-..........--------..........-......-FNR...SES
ENSGGOP00000008286  .....AK..LC...KD..CKVADGKSVTG...T..........DVDIVFSK..........V......KGKS...ARV
ENSGGOP00000015051  .....AS..LV...P-..-ME--------...H..........CITRFFEE..........C......DPNK...DKH
ENSGGOP00000024872  .....AS..LV...P-..-ME--------...H..........CITRFFEE..........C......DPNK...DKH
ENSGGOP00000011390  .....--..--...--..-----------...-..........--------..........-......----...---
ENSGGOP00000008090  .....VK..FF...PY..GDA-------S...K..........FAQHAFRT..........F......DKNG...DGT
ENSGGOP00000006979  .....GN..FF...PY..GDA-------S...K..........FAEHVFRT..........F......DANG...DGT
ENSGGOP00000014947  .....--..--...--..-----------...-..........--------..........-......----...---
ENSGGOP00000000749  .....--..--...--..-----------...-..........--------..........-......PKGK...NDA
ENSGGOP00000022235  .....--..--...--..-----------...-..........--------..........-......----...---
ENSGGOP00000004772  .....AA..LGr..VN..VKN--------...E..........EIDEMIKE..........A......P---...-GP
ENSGGOP00000001305  .....RA..LG...FE..PRK--------...E..........EMKKMISE..........V......DKEG...TGK
ENSGGOP00000009619  .....AQ..FF...PQ..GDA-------T...T..........YAHFLFNA..........F......DADG...NGA
ENSGGOP00000027707  .....RM..LG...QT..PTK--------...E..........ELDAIIEE..........V......DEDG...SGT
ENSGGOP00000013700  .....KY..ME...YS..TKK--------...-..........-VSDVLKL..........F......E---...DGE
ENSGGOP00000026634  .....RS..LR...QH..PTE--------...A..........ELQDMIYE..........V......DADS...NGR
ENSGGOP00000027354  .....AQ..FF...PH..GDA-------S...T..........YAHYLFNA..........F......DATQ...TGS
ENSGGOP00000007591  .....NR..II...SK..HKDLRTKGFSL...E..........SCRSMVNL..........M......DRDG...NGK
ENSGGOP00000024754  .....NR..II...SK..HKDLRTKGFSL...E..........SCRSMVNL..........M......DRDG...NGK
ENSGGOP00000000341  .....--..--...--..--------VTV...T..........DVDIVFSK..........I......KGKS...CRT
ENSGGOP00000006559  .....KA..MG...KN..LSE--------...A..........QLKKLISQ..........L......DSDG...DGE
ENSGGOP00000001194  .....KQ..FFp..FG..DPT--------...K..........FATFVFNV..........F......DENK...DGR
ENSGGOP00000020610  .....KE..LN...IQ..VDD--------...S..........YARKIFRE..........C......DHSQ...TDS
ENSGGOP00000003736  .....KE..LN...IQ..VDD--------...S..........YARKIFRE..........C......DHSQ...TDS
ENSGGOP00000004196  .....--..--...--..-----------...-..........--------..........-......----...---
ENSGGOP00000015532  .....RM..LG...QN..PTP--------...E..........ELQEMIDE..........V......DEDG...SGT
ENSGGOP00000000785  .....TQ..SG...IA..---GGYKPFNL...E..........TCRLMVSM..........L......DRDM...SGT
ENSGGOP00000014368  .....RM..VN...VD..MND--------...M..........YAYLLFKE..........C......DHSN...NDR
ENSGGOP00000023413  .....P-..--...--..-----------...AllfclvdastYAHYLFNA..........F......DATQ...TGS
ENSGGOP00000007126  .....P-..--...--..-----------...AllfclvdastYAHYLFNA..........F......DATQ...TGS
ENSGGOP00000008349  .....AK..FF...PDt.DPK--------...A..........YAQHVFRS..........F......DSNL...DGT
ENSGGOP00000011020  .....RM..VN...VD..MND--------...M..........YAYLLFKE..........C......DHSN...NDR
ENSGGOP00000015507  .....VN..CN...--..-----WSSFND...E..........TCLMMINM..........F......DKTK...SGR
ENSGGOP00000012471  .....GL..KN...LS..PSA-------S...Q..........YVEQMFET..........F......DFNK...DGY
ENSGGOP00000012549  .....NA..VL...QK..KKDIKFKRLSL...I..........SCKNIISL..........M......DTSG...NGK
ENSGGOP00000019099  .....NR..MA...IK..FKSFKTKGFGL...D..........ACRCMINL..........M......DKDG...SGK
ENSGGOP00000003031  .....NR..MA...IK..FKSFKTKGFGL...D..........ACRCMINL..........M......DKDG...SGK
ENSGGOP00000005101  .....--..--...--..---------TS...T..........DVDIVFSK..........V......KAKN...ART
ENSGGOP00000024511  .....GL..KN...LS..PSA-------S...Q..........YVEQMFET..........F......DFNK...DGY
ENSGGOP00000018250  .....AS..LG...KN..PTD--------...E..........YLEGMMSE..........A......P---...-GP
ENSGGOP00000003074  .....RT..MG...YM..PTE--------...M..........ELIELGQQ..........I......RMNL...GGR
ENSGGOP00000012477  .....GL..KN...LS..PSA-------S...Q..........YVEQMFET..........F......DFNK...DGY
ENSGGOP00000010001  .....HK..LN...VN..LPR--------...Q..........RVKQMFRE..........A......DTDDh..QGT
ENSGGOP00000020622  .....HK..LN...VN..LPR--------...Q..........RVKQMFRE..........A......DTDDh..QGT
ENSGGOP00000010490  .....SL..LG...IN..PTK--------...S..........ELALMAKD..........V......DRDN...KGF
ENSGGOP00000015637  .....RN..LN...PG..LKT--------...S..........KIELKFKE..........L......HKSK...DKA
ENSGGOP00000011144  .....AS..LG...KN..PTD--------...E..........YLDAMMNE..........A......P---...-GP
ENSGGOP00000026982  .....AS..LG...KN..PTD--------...E..........YLDAMMNE..........A......P---...-GP
ENSGGOP00000003975  .....AS..LG...KN..PTD--------...A..........YLDAMMNE..........A......P---...-GP
ENSGGOP00000004885  .....EK..LD...IR..CSY--------...I..........HVKQIFKD..........N......DRLK...QGR
ENSGGOP00000014678  .....TQ..SG...IN..GTY---SPFSL...E..........TCRIMIAM..........L......DRDY...TGK
ENSGGOP00000013437  .....--..--...--..-----------...-..........--------..........-......----...NQT
ENSGGOP00000011390  .....--..--...--..--Q--------...-..........--------..........-......----...---
ENSGGOP00000010036  .....EL..QQ...N-..-----------...P..........LVQRVIDI..........F......DTDG...NGE
ENSGGOP00000027819  .....RT..LG...YM..PTE--------...M..........ELIEISQQ..........I......---S...GGK
ENSGGOP00000012841  .....RT..MG...YM..PTE--------...M..........ELIELSQQ..........I......NMNL...GGH
ENSGGOP00000009918  .....RT..LG...YM..PTE--------...M..........ELIEISQQ..........I......---S...GGK
ENSGGOP00000012485  .....KV..TD...DE..EAS--------...Q..........YVEGMFRA..........F......DKNG...DNT
ENSGGOP00000009782  .....RT..LG...YM..PTE--------...M..........ELLEVSQH..........I......KMRM...GGR
ENSGGOP00000009375  .....RA..LG...FD..VKK--------...A..........DVLKILKD..........Y......DREA...TGK
ENSGGOP00000023560  .....GT..CH...PV..EPG--------...C..........TALALRTT..........I......DLTC...SGH
ENSGGOP00000014947  .....RL..EP...QS..-----------...-..........--------..........-......----...---
ENSGGOP00000012603  .....--..--...--..-----------...-..........--------..........-......----...---
ENSGGOP00000017349  .....HE..VH...PI..SSG--------...L..........EAMALKST..........I......DLTC...NDY
ENSGGOP00000003738  .....HE..VH...PI..SSG--------...L..........EAMALKST..........I......DLTC...NDY
ENSGGOP00000007513  .....--..--...--..-----------...-..........--------..........-......----...---
ENSGGOP00000022235  .....RL..EP...QS..-----------...-..........--------..........-......----...---
ENSGGOP00000001928  .....KQ..LN...PT..LKE--------...A..........KIRLKFKE..........I......QKSKeklTTR
ENSGGOP00000013652  .....NR..VF...EK..CQDIKSDGFSI...E..........TCKIMVDM..........L......DSDG...SGK
ENSGGOP00000006109  .....GL..QG...LN..QKA-------N...K..........HIDQVYNT..........F......DTNK...DGF
ENSGGOP00000003219  .....RA..LG...QN..PTN--------...A..........EVLKVLGN..........P......KSDE...MNV
ENSGGOP00000022428  .....--..--...--..-----------...-..........--------..........-......----...---
ENSGGOP00000017119  .....--..--...--..-----------...-..........--------..........-......----...---
ENSGGOP00000003545  .....--..--...--..-----------...-..........--------..........-......----...---
ENSGGOP00000023406  .....RA..LG...TN..PTN--------...A..........EVRKVLGN..........P......SNEEln.AKK
ENSGGOP00000007856  .....--..--...--..---IKSDGFSI...E..........TCKIMVDM..........L......DSDG...SGK
ENSGGOP00000011697  .....RA..LG...TN..PTN--------...A..........EVRKVLGN..........P......SNEEln.AKK
ENSGGOP00000018636  .....HE..VH...QI..SSG--------...L..........EAMALKST..........I......DLTC...NDY
ENSGGOP00000017641  .....RA..LG...QN..PTN--------...A..........EVLKVLGN..........P......KSDE...MNV
ENSGGOP00000013074  .....ED..IG...AI..QSL--------...E..........EARKIFTT..........G......DVNK...DGK
ENSGGOP00000007661  .....RC..LG...AS..PTP--------...G..........EVQRHLQT..........H......GIDG...NGD
ENSGGOP00000020763  .....ND..YA...VV..MEK--------...E..........EVEELFRR..........F......DKDG...NGT
ENSGGOP00000005624  .....AS..LGk..TN..VKD--------...D..........ELDAMLKE..........A......----...SGP
ENSGGOP00000025395  .....--..-N...LD..KYE--------...V..........CIRPFFNS..........C......DTYK...DGR
ENSGGOP00000019250  .....--..-N...LD..KYE--------...V..........CIRPFFNS..........C......DTYK...DGR
ENSGGOP00000020096  .....AA..LGr..IN..VKN--------...E..........ELEAMVKE..........A......P---...-GP
ENSGGOP00000000796  .....--..--...--..----SILPICK...D..........SLGWMFNK..........L......DMNY...DLL
ENSGGOP00000004196  .....--..--...--..-----------...-..........S-------..........-......----...---
ENSGGOP00000002530  .....RA..LG...QN..PTQ--------...A..........EVLRVLGK..........P......RQEEln.TKM
ENSGGOP00000015006  .....HV..TF...GM..TDD--------...M..........IMDRVFRG..........F......DKDN...DGC
ENSGGOP00000016611  .....AA..MGr..LN..VKN--------...E..........ELDAMMKE..........A......----...SGP
ENSGGOP00000004209  .....AL..AV...NP..LGD--------...-..........---RIIES..........F......FPDG...SQR
ENSGGOP00000011570  .....--..--...--..-----------...-..........----LLQA..........A......DTSQ...SGT
ENSGGOP00000006906  .....AR..LG...GG..NPD-------P...G..........AQQGISSE..........G......DADP...DGG
ENSGGOP00000024832  .....AR..LG...GG..NPD-------P...G..........AQQGISSE..........G......DADP...DGG
ENSGGOP00000019567  .....RA..LG...QN..PTN--------...A..........EVLRVLGK..........P......KPEE...MNV
ENSGGOP00000009496  .....RA..LG...QN..PTN--------...A..........EVLRVLGK..........P......KPEE...MNV
ENSGGOP00000012555  .....RF..LR...KKs.KPK--------...K..........CVKKFVEY..........C......DVNN...DKS
ENSGGOP00000006153  .....AK..LG...LV..LDQ--------...A..........EAEGVCRK..........W......DRNG...SGT
ENSGGOP00000008018  .....RY..VK...KK..AKP-------K...K..........CARRFTDY..........C......DLNK...DKV
ENSGGOP00000007513  .....KE..VL...KL..PTA--------...-..........--------..........-......----...---
ENSGGOP00000024452  .....RY..VK...KK..AKP-------K...K..........CARRFTDY..........C......DLNK...DKV
ENSGGOP00000005045  .....KL..PV...S-..-----------...D..........VLRQLFAL..........F......DRNH...DGS
ENSGGOP00000017287  .....AA..LGr..IN..VKN--------...E..........ELEAMVKE..........A......P---...-GP
ENSGGOP00000004706  .....--..--...--..-----------...-..........--------..........-......---A...KDS
ENSGGOP00000022428  .....--..--...--..-----------...-..........--------..........-......----...---
ENSGGOP00000017119  .....--..--...--..-----------...-..........--------..........-......----...---
ENSGGOP00000003545  .....--..--...--..-----------...-..........--------..........-......----...---
ENSGGOP00000004257  .....--..--...--..------N----...P..........FRQRIAQV..........F......SEDG...DGH
ENSGGOP00000024127  .....TK..SK...LS..I----------...P..........ELSYIWEL..........S......DADC...DGA
ENSGGOP00000012291  .....MQ..SS...L-..-PQ--------...A..........QLASIWNL..........S......DIDQ...DGK
ENSGGOP00000004812  .....SQ..LGk..VS..VPE--------...E..........ELDAMLQE..........-......---G...KGP
ENSGGOP00000012046  .....ES..LG...LK..PQD--------...M..........FVESMFSL..........A......DKDG...NGY
ENSGGOP00000015625  .....TK..SK...LS..I----------...P..........ELSYIWEL..........S......DADC...DGA
ENSGGOP00000008889  .....TK..SK...LP..I----------...L..........ELSHIWEL..........S......DFDK...DGA
ENSGGOP00000008482  .....NT..EL...AA..FTK---NQKDP...G..........VLDRMMKK..........L......DTNS...DGQ
ENSGGOP00000013349  .....RR..LG...LH..RTE--------...G..........ELQKIVQA..........G......DKDL...DGQ
ENSGGOP00000011422  .....ES..LG...LK..PQD--------...M..........FVESMFSL..........A......DKDG...NGY
ENSGGOP00000018846  .....--..--...--..----------R...Q..........WKQKIVQA..........G......DKDL...DGQ
ENSGGOP00000003216  .....RA..LG...QN..PTN--------...A..........EVLKVLGN..........P......KSDElk.SRR
ENSGGOP00000021719  .....NQ..MT...WS..NLGSRQPFFSL...E..........ACQGILAL..........L......DLNA...SGT
ENSGGOP00000005693  .....HP..EE...YD..YMK-------D...I..........VVQETVED..........I......DKNA...DGF
ENSGGOP00000010676  .....--..--...--..-----------...P..........FKERIVAA..........F......SEDG...EGN
ENSGGOP00000007432  .....LQ..SN...L-..-SQ--------...T..........QLATIWTL..........A......DIDG...DGQ
ENSGGOP00000018435  .....KR..VQ...KR..YIF--------...D..........NVAKVWKD..........Y......DRDK...DDK
ENSGGOP00000006035  .....LN..SK...LP..V----------...D..........ILGRVWEL..........S......DIDH...DGM
ENSGGOP00000025507  .....LN..SK...LP..V----------...D..........ILGRVWEL..........S......DIDH...DGM
ENSGGOP00000006035  .....LK..TG...LP..S----------...T..........LLAHIWSL..........C......DTKD...CGK
ENSGGOP00000025507  .....LK..TG...LP..S----------...T..........LLAHIWSL..........C......DTKD...CGK
ENSGGOP00000003343  .....EN..ILg..LN..LPW--------...R..........SLSSNLVN..........I......DQNG...N--
ENSGGOP00000020870  .....NQ..MT...WS..NLGSRQPFFSL...E..........ACQGILAL..........L......DLNA...SGT
ENSGGOP00000002976  .....NQ..MT...WS..NLGSRQPFFSL...E..........ACQGILAL..........L......DLNA...SGT
ENSGGOP00000024041  .....HV..KE...S-..-----------...F..........FAERFFAL..........F......DSDR...SGT
ENSGGOP00000009817  .....HV..KE...S-..-----------...F..........FAERFFAL..........F......DSDR...SGT
ENSGGOP00000011240  .....--..--...--..-----SPPIRP...S..........LSEGLFNA..........F......DENR...DNH
ENSGGOP00000008587  .....HP..EE...FPh.MRD--------...I..........VIAETLED..........L......DRNK...DGY
ENSGGOP00000007432  .....LQ..SG...LP..A----------...P..........VLAEIWAL..........S......DLNK...DGK
ENSGGOP00000013302  .....MH..SG...L-..-TQ--------...N..........LLAHIWAL..........A......DTRQ...TGK
ENSGGOP00000024313  .....MH..SG...L-..-TQ--------...N..........LLAHIWAL..........A......DTRQ...TGK
ENSGGOP00000000552  .....--..--...--..-----------...-..........--------..........-......----...---
ENSGGOP00000002697  .....--..--...--..-PDLELNPIRS...K..........IVRAFFDN..........R......NLRK...GPS
ENSGGOP00000016489  .....QT..EL...SG..FLD---AQKDV...D..........AVDKVMKE..........L......DENG...DGE
ENSGGOP00000028006  .....HP..EE...VDy.MTE--------...F..........VIQEALEE..........H......DKNG...DGF
ENSGGOP00000023206  .....HP..EE...VDy.MTE--------...F..........VIQEALEE..........H......DKNG...DGF
ENSGGOP00000006503  .....KE..NF...PN..FLS-ACDKKGT...N..........YLANVFEK..........K......DKNE...DKK
ENSGGOP00000006509  .....KE..NF...PN..FLS-ACDKKGT...N..........YLANVFEK..........K......DKNE...DKK
ENSGGOP00000021892  .....NN..EL...SH..FLE---EIKEQ...E..........VVDKVMET..........L......DNDG...DGE
ENSGGOP00000004839  .....QE..LQ...QA..RKK--------...Aglelsp....EMKTFVDQ..........Y......GQRD...DGK
ENSGGOP00000019168  .....KG..FS...PD..ARD-----LSA...K..........ETKMLMAA..........G......DKDG...DGK
ENSGGOP00000003722  .....RS..LG...YM..PNE--------...V..........ELEVIIQR..........L......DMDG...DGQ
ENSGGOP00000007472  .....RS..LG...YD..LPM-VEEGEPD...P..........EFEAILDT..........V......DPNR...DGH
ENSGGOP00000027338  .....EK..EL...PG..FLQ---SGKDK...D..........AVDKLLKD..........L......DANG...DAQ
ENSGGOP00000007156  .....--..--...--..-----------...-..........--DRIINA..........F......FPEG...EDQ
ENSGGOP00000024526  .....EK..EF...PG..FLE---NQKDP...L..........AVDKIMKD..........L......DQCR...DGK
ENSGGOP00000028098  .....QR..EL...TE..FLS---CQKET...Q..........LVDKIVQD..........L......DANK...DNE
ENSGGOP00000007082  .....TR..EL...PS..FLG---KRTDE...A..........AFQKLMSN..........L......DSNR...DNE
ENSGGOP00000023859  .....--..--...--..-----------...-..........--------..........-......----...---
ENSGGOP00000019080  .....--..--...--..-----------...-..........--------..........-......----...---
ENSGGOP00000010449  .....--..--...--..-----------...-..........--------..........-......--SH...KGV
ENSGGOP00000000844  .....RK..DL...QN..F--LKKENKNE...K..........VIEHIMED..........L......DTNA...DKQ
ENSGGOP00000023819  .....KE..NF...PN..FLS-ACDKKGI...H..........YLATVFEK..........K......DKNE...DKK
ENSGGOP00000006595  .....TK..EL...AN..TIK---NIKDK...A..........VIDEIFQG..........L......DANQ...DEQ
ENSGGOP00000006390  .....HP..EH...--..-----SRGMLR...F..........MVKEIVRD..........L......DQDG...DKQ
ENSGGOP00000015096  .....EK..FN...LD..ISK--------...E..........ECQQLIIK..........Y......DLKN...NGK
ENSGGOP00000019080  .....QE..LF...QK..AREENPGQV--...-..........--------..........-......----...---
ENSGGOP00000002308  .....--..VG...TK..LPN--------...S..........VLGRIWKL..........S......DVDR...DGM
ENSGGOP00000023711  .....--..VG...TK..LPN--------...S..........VLGRIWKL..........S......DVDR...DGM
ENSGGOP00000000733  .....RD..LF...LH..HKKAISEAKLE...E..........YTGTMMKI..........F......DRNK...DGR
ENSGGOP00000023859  .....QE..LF...QK..AREENPGQV--...-..........--------..........-......----...---
ENSGGOP00000028529  .....KE..NF...PN..FLS-ACDKKGI...H..........YLATVFEK..........K......DKNE...DKK
ENSGGOP00000015096  .....TD..FL...MP..LTR--------...E..........QFQDVLAQ..........I......PLSI...SGT
ENSGGOP00000002979  .....--..VR...SK..LPN--------...S..........VLGKIWKL..........A......DIDK...DGM
ENSGGOP00000000348  .....VK..S-...-K..LPN--------...T..........VLGKIWKL..........A......DVDK...DGL
ENSGGOP00000012168  .....QH..AG...RN..PSQ--------...-..........---KTINK..........Y......WTPQ...TAK
ENSGGOP00000021101  .....MD..NM...PR..FMD-SLGQKEP...Y..........YVTELFQA..........T......DKNR...DNQ
ENSGGOP00000024236  .....MD..NM...PR..FMD-SLGQKEP...Y..........YVTELFQA..........T......DKNR...DNQ
ENSGGOP00000005783  .....IS..LG...YD..VEN---DRQGE...A..........EFNRIMSL..........V......DPNH...SGL
ENSGGOP00000011525  .....--..VT...SK..LPN--------...S..........VLGKIWKL..........A......DCDC...DGM
ENSGGOP00000011629  .....IS..MG...YD..LGE--------...A..........EFARIMTL..........V......DPNG...QGT
ENSGGOP00000009256  .....KG..FS...PD..ARD-----LSA...K..........ETKMLMAA..........G......DKDG...DGK
ENSGGOP00000022443  .....--..--...--..-----------...-..........--------..........-......----...---
ENSGGOP00000013081  .....--..--...--..-----------...-..........--------..........-......----...---
ENSGGOP00000006507  .....RI..CF...NT..PLA----PQAL...E..........DVKNVVRK..........H......ISDGva.DSG
ENSGGOP00000026277  .....RI..CF...NT..PLA----PQAL...E..........DVKNVVRK..........H......ISDGva.DSG
ENSGGOP00000026775  .....NA..EL...AA..FTK---NQKDP...G..........VLDHVMKK..........L......GTNN...DGQ
ENSGGOP00000015605  .....IS..MG...YD..LGE--------...V..........EFARIMTM..........M......DPNA...AGV
ENSGGOP00000013437  .....--..--...--..-----------...-..........--------..........-......----...---
ENSGGOP00000015096  .....KD..FC...YK..LTD--------...N..........QYHYFLRK..........L......RIHL...TPY
ENSGGOP00000015264  .....EV..PV...S-..-----------...D..........LLEDMFSL..........F......DESG...SGE
ENSGGOP00000019492  .....NQ..EL...L-..-TGPPGDMFSL...D..........ECRSLVAL..........M......ELKV...NGR
ENSGGOP00000015242  .....NQ..EL...L-..-TGPPGDMFSL...D..........ECRSLVAL..........M......ELKV...NGR
ENSGGOP00000015096  .....LH..LL...LN..LKD--------...D..........EFERFLGL..........L......GLRL...SVT
ENSGGOP00000011088  .....HH..VT...-D..LKK--------...A..........QINIVFDM..........L......DWNA...VGE
ENSGGOP00000020157  .....QK..EL...AT..WTP---TEFRE...C..........DYNKFMSV..........L......DTNK...DCE
ENSGGOP00000025587  .....EK..EF...RQ..ILK---NPDDP...D..........MVDVFMDH..........L......DIDH...NKK
ENSGGOP00000002805  .....KE..AS...LP..LPGYKVR----...E..........IVEKILSV..........A......DSNK...DGK
ENSGGOP00000013256  .....DQ..AN...LS..LDD--------...K..........LLDQLFDY..........C......DVDN...DGF
ENSGGOP00000023524  .....DQ..AN...LS..LDD--------...K..........LLDQLFDY..........C......DVDN...DGF
ENSGGOP00000013295  .....KV..FH...LE..VSE--------...K..........DFESAWLI..........L......NDNG...NGK
ENSGGOP00000018258  .....KV..FH...LE..VSE--------...K..........DFESAWLI..........L......NDNG...NGK
ENSGGOP00000005688  .....LN..IFg..ES..QPN-------P...K..........TVELLSGV..........V......DQTK...DGL
ENSGGOP00000007088  .....QK..ELtigSK..LQD--------...A..........EIARLMED..........L......DRNK...DQE
ENSGGOP00000004418  .....LA..EF...GD..ILQ---RPNDP...E..........TVETILNL..........L......DQDR...DGH
ENSGGOP00000004827  .....VM..LFg..YK..PSK--------...I..........EVDSVMSS..........I......NPNT...SGM
ENSGGOP00000023450  .....IS..LG...YD..IGN--------...D..........P-------..........-......----...---
ENSGGOP00000007087  .....KK..ELcl.GE..MKE--------...S..........RIDDLMKS..........L......DKNS...DQE
ENSGGOP00000020253  .....ET..EC...PQy.IRK--------...K..........GADVWFKE..........L......DINT...DGA
ENSGGOP00000027573  .....ET..EC...PQy.IRK--------...K..........GADVWFKE..........L......DINT...DGA
ENSGGOP00000021162  .....--..--...--..-----------...-..........--------..........-......----...---
ENSGGOP00000016495  .....TQ..QL...PH..LLK------DV...G..........SLDEKMKS..........L......DVNQ...DSE
ENSGGOP00000005787  .....--..--...--..-----------...-..........--------..........-......----...---
ENSGGOP00000020487  .....ER..EF...GA..VLR---RPHDP...K..........TVDLILEL..........L......DRDS...NGR
ENSGGOP00000016148  .....IS..MG...YN..MGE--------...A..........EFARIMSI..........V......DPNR...LGV
ENSGGOP00000015096  .....DT..FV...YQ..IPR--------...R..........IFIQLMKR..........F......GLKA...TTK
ENSGGOP00000012603  .....--..--...--..-----------...-..........--------..........-......----...---
ENSGGOP00000015201  .....KA..AC...LP..LPGYRVR----...E..........ITENLMAT..........G......DLDQ...DGR
ENSGGOP00000024915  .....NK..EL...AA..FTK---NQKDP...-..........GVLDRMKK..........L......DVSS...DGQ
ENSGGOP00000023450  .....--..--...--..-PP--------...D..........--------..........-......----...---
ENSGGOP00000001678  .....EK..LG...AP..QTH--------...L..........GLKSMIKE..........V......DEDF...DGK
ENSGGOP00000024627  .....QK..EL...NH..MLS---DTGNR...K..........AADKLIQN..........L......DANH...DGR
ENSGGOP00000018908  .....EQ..EF...AD..---VIVKPHDP...A..........TVDEVLRL..........L......DEDH...TGT
ENSGGOP00000025434  .....RA..LG...QN..PTN--------...A..........EVLKVLG-..........-......----...---
ENSGGOP00000006199  .....TK..EL...EK..VYDPKNEEDDM...Remeeerlr..MRE-----..........-......----...---
ENSGGOP00000019261  .....TK..EL...EK..VYDPKNEEDDM...Remeeerlr..MRE-----..........-......----...---
ENSGGOP00000005693  .....KF..AQ...KR..WIY--------...E..........DVERQWKG..........H......DLNE...DGL
ENSGGOP00000001807  .....EN..EF...HQ..ILK---NPNDP...D..........TVDIILQS..........L......DQDH...NKK
ENSGGOP00000024313  .....MN..SK...LP..L----------...D..........VLGRRWSL..........G......ERDS...GGS
ENSGGOP00000019354  .....ES..IN...VQ..MDE--------...N..........TLHEILNE..........V......DLNK...NGQ
ENSGGOP00000018853  .....QA..RD...L-..---------SA...K..........ETKMLMAA..........G......DKDG...DGK
ENSGGOP00000008614  .....KE..AN...MP..LPGYKVR----...E..........IIQKLMLD..........G......DRNK...DGK
ENSGGOP00000024313  .....KK..SG...L-..-SD--------...I..........ILGKIWDL..........A......DPEG...KGF
ENSGGOP00000000552  .....RK..LL...NN..HHD--------...-..........DASKFICL..........L......AKPN...CSS
ENSGGOP00000004747  .....TS..MG...MR..HRDRPTTGNTL...Ksg........LC-----Salttyf....F......GADL...KGK
ENSGGOP00000013302  .....KK..SG...L-..-SD--------...I..........ILGKIWDL..........A......DPEG...KGF
ENSGGOP00000020941  dcpkiTQ..HW...EK..VDE--------...E..........GLKKLMGN..........L......DENS...DQQ
ENSGGOP00000000504  .....RG..LN...YY..LPMVEEDEH-E...P..........KFEKFLDA..........V......DPGR...KGY
ENSGGOP00000024502  .....RG..LN...YY..LPMVEEDEH-E...P..........KFEKFLDA..........V......DPGR...KGY
ENSGGOP00000011848  .....KR..VQ...KR..YIF--------...D..........DVAKVWRD..........Y......DRDE...DD-
ENSGGOP00000024360  .....PS..TG...IN..LLD--------...E..........EFQKIVTD..........T......SRNE...NGM
ENSGGOP00000000733  .....LH..ML...MKlgTDDTVMKANLH...K..........VKQQFMTT..........Q......DASK...DGR
ENSGGOP00000024360  .....RN..IG...IK..SPK--------...E..........EVEKILQS..........G......FVSE...DNM
ENSGGOP00000021249  .....LS..SK...FP..TSR--------...L..........EMSAVADI..........F......DRDG...DGY
ENSGGOP00000019415  .....LS..SK...FP..TSR--------...L..........EMSAVADI..........F......DRDG...DGY
ENSGGOP00000013501  .....QK..SC...FG..HPL---AP---...Q..........ALEDVKTV..........V......CRNV...AGG
ENSGGOP00000021515  .....HM..LS...LE..EVA--------...P..........VLQQTLL-..........-......QDNL...LGR
ENSGGOP00000005854  .....HM..LS...LE..EVA--------...P..........VLQQTLL-..........-......QDNL...LGR
ENSGGOP00000016618  .....QE..LE...KA..RKGSGMMSKSDnfgE..........KMKEFMQK..........Y......DKNS...DGK
ENSGGOP00000024091  .....AK..LG...MN..LTK--------...H..........DVYNELKC..........A......DIDR...DGK
ENSGGOP00000013700  .....--..--...--..-----------...-..........--------..........-......----...---
ENSGGOP00000008485  .....GK..EF...PG..FLE---NQKDP...L..........AADITMKD..........M......DQCQ...DST
ENSGGOP00000011966  .....--..--...--..-----------...-..........--------..........-......----...---
ENSGGOP00000023645  .....--..--...--..-----------...-..........--------..........-......----...---
ENSGGOP00000028176  .....MS..LT...VG..-----------...-..........--------..........-......----...--N
ENSGGOP00000004508  .....LR..YT...--..--NVENTSVFL...E..........NVRY----..........-......SIPE...EKG
ENSGGOP00000018206  .....LR..YT...--..--NVENTSVFL...E..........NVRY----..........-......SIPE...EKG
ENSGGOP00000006739  .....AL..LF...P-..---WACGTHSD...V..........LASRLFQL..........L......DENG...DSL
ENSGGOP00000023979  .....AL..LF...P-..---WACGTHSD...V..........LASRLFQL..........L......DENG...DSL
ENSGGOP00000012342  .....MS..LT...VG..-----------...-..........--------..........-......----...--N
ENSGGOP00000023206  .....QM..SF...KH..YAM--------...Q..........EAKQQFVE..........Y......DKNS...DDT
ENSGGOP00000001608  .....RQ..LN...ME..-----------...E..........SVAEIMNQ..........L......GADE...NGK
ENSGGOP00000010042  .....KE..--...--..------LPLSL...E..........ELEDVFDA..........L......DADG...NGY
ENSGGOP00000028006  .....QM..SF...KH..YAM--------...Q..........EAKQQFVE..........Y......DKNS...DDT
ENSGGOP00000025507  .....KK..SG...L-..-PD--------...L..........ILGKIWDL..........A......DTDG...KGI
ENSGGOP00000020583  .....TS..MG...MR..HRDRPTTGNTL...K..........-------SglcsalttyfF......GADL...KGK
ENSGGOP00000012393  .....-A..LV...VE..HIE--------...K..........MVESVFRN..........F......DVDG...DGH
ENSGGOP00000016724  .....FE..IP...GF..LTD--------...E..........ECRLIIHL..........A......QMKGlqrSQI
ENSGGOP00000023938  .....EK..LG...AP..QTH--------...L..........GLKNMIKE..........V......DEDF...DSK
ENSGGOP00000022364  .....TS..MG...MR..HRDRPTTGNTL...K..........-------SglcsalttyfF......GADL...KGK
ENSGGOP00000005326  .....AK..LG...MN..LTK--------...H..........DVYNELKC..........A......DIDR...DGK
ENSGGOP00000008587  .....AH..TQ...QR..HIR--------...D..........SVSAAWDT..........Y......DTDR...DGR
ENSGGOP00000002982  .....AS..LT...P-..---WACGSHTP...L..........LAGRMFRL..........L......DENK...DSL
ENSGGOP00000006523  .....EK..LG...AP..QTH--------...L..........GLKNMIKE..........V......DEDF...DSK
ENSGGOP00000014183  .....KK..EF...EK..HGAVVNESHHD...A..........LVEDIFDK..........E......DEDK...DGF
ENSGGOP00000018435  .....--..--...--..-----------...-..........-VLETLED..........I......DKNG...DGF
ENSGGOP00000021184  .....--..--...--..-----------...-..........--------..........-......----...--Q
ENSGGOP00000015096  .....HV..FC...PF..LTN--------...A..........HFIKLCSK..........I......QDIG...SGR
ENSGGOP00000024360  .....CI..LR...IS..ISD--------...L..........EMRQALKT..........V......DTD-...---
ENSGGOP00000027849  .....AS..LT...P-..---WACGSHTP...L..........LAGRMFRL..........L......DENK...DSL
ENSGGOP00000022443  .....RK..IL...QN..CHD--------...D..........TAKFVHLL..........M......SPSC...N-Y
ENSGGOP00000013081  .....RK..IL...QN..CHD--------...D..........TAKFVHLL..........M......SPSC...N-Y
ENSGGOP00000022610  .....QE..LE...KA..RKGSGMMSKSDnfgE..........KMKEFMQK..........Y......DKNS...DGK
ENSGGOP00000010606  .....ES..HS...SK..LDP--------...H..........KREVLLAL..........A......DSHA...DGQ
ENSGGOP00000026802  .....QS..VG...LQ..GLE-------K...E..........ELEDLFNK..........L......DQDG...DGK
ENSGGOP00000011774  .....QG..EF...GD..FFQ----PCVL...H..........AVEKNSNL..........L......NIDS...NGI
ENSGGOP00000002441  .....QS..VG...LQ..GLE-------K...E..........ELEDLFNK..........L......DQDG...DGK
ENSGGOP00000002021  .....--..--...--..-----ISKHVQ...R..........MVDSVFKN..........Y......DHDQ...DGY
ENSGGOP00000009877  .....--..--...--..-----------...-..........----LFED..........M......DLNK...DGE
ENSGGOP00000016754  .....EK..LG...VP..KTH--------...L..........EMKKMISE..........V......TGGV...SDT
ENSGGOP00000007308  .....--..--...--..-----------...-..........---NLFEE..........I......DKDG...NGE
ENSGGOP00000012932  .....TI..LT...KP..HSG--------...-..........-FHVAFKM..........L......DTDG...NEM
ENSGGOP00000012554  .....QT..QF...RN..FTE---GQETK...P..........KYREILSE..........L......DEHT...ENK
ENSGGOP00000011621  .....LK..HE...VP..LQL--------...P..........TVKILCQR..........F......SKRG...SPE
ENSGGOP00000024380  .....--..--...--..-----------...-..........--------..........-......----...---
ENSGGOP00000000011  .....--..--...--..-----------...-..........---DILRR..........A......DKND...DGK
ENSGGOP00000007649  .....--..--...--..-----------...-..........--------..........-......----...---
ENSGGOP00000006035  .....KK..SG...L-..-PD--------...L..........ILGKIWDL..........A......DTDG...KGI
ENSGGOP00000011720  .....EK..LG...VP..KTH--------...L..........ELKKLIGE..........V......SSGS...GET
ENSGGOP00000002269  .....EQ..NEta.IN..ITTYPD-----...Qennkllrgl.CVDALIEL..........S......DENA...DWK
ENSGGOP00000018132  .....SD..LP...L-..---------TP...E..........QLEAVFES..........L......DQAH...TGF
ENSGGOP00000017534  .....EQ..NEta.IN..ITTYPD-----...Qennkllrgl.CVDALIEL..........S......DENA...DWK
ENSGGOP00000004508  .....--..--...--..-----------...-..........--------..........-......NLKE...RGV
ENSGGOP00000018206  .....--..--...--..-----------...-..........--------..........-......NLKE...RGV
ENSGGOP00000016496  .....TQ..QL...PHlmPSN--------...C..........GLEEKIAN..........L......GSCN...DSK
ENSGGOP00000012932  .....--..--...--..-----------...-..........--------..........-......DLGD...KGL
ENSGGOP00000004839  .....--..--...--..-----------...-..........--DLMLKL..........F......DSNN...DGK
ENSGGOP00000008738  .....--..--...--..-FN--------...W..........DCEFIRLH..........F......GHNR...KKH
ENSGGOP00000028586  .....QR..EF...EK..DEKPRDKSYQD...A..........VLEDIFKK..........N......DHDG...DGF
ENSGGOP00000011240  .....--..--...--..-----------...-..........--------..........-......----...--G
ENSGGOP00000007686  .....TV..YG...A-..-----------...E..........QVKDLTKY..........L......DPSG...LGV
ENSGGOP00000000151  .....KK..VL...SS..VSD--------...E..........MLKELFLK..........V......DSDC...EGF
ENSGGOP00000006499  .....--..--...--..-----------...-..........--------..........-......----...---
ENSGGOP00000023045  .....--..--...--..-----------...-..........--------..........-......----...--Q
ENSGGOP00000020565  .....--..--...--..-----------...-..........--------..........-......----...---
ENSGGOP00000012340  .....--..--...--..---ESHKHYTQ...S..........ETEFLLSC..........A......ETDE...NET
ENSGGOP00000023745  .....--..--...--..---ESHKHYTQ...S..........ETEFLLSC..........A......ETDE...NET
ENSGGOP00000008325  .....KQeeLG...KD..LFD--------...C..........TLYVLLKY..........D......DFNA...DKH
ENSGGOP00000022444  .....--..--...--..-----------...N..........TVDDISES..........L......-RQG...GGK
ENSGGOP00000024026  .....--..--...--..-----------...W..........DCEFIRLH..........F......GHNR...KKH
ENSGGOP00000003268  .....--..--...--..-----------...N..........TVDDISES..........L......-RQG...GGK
ENSGGOP00000012291  .....FQ..SG...LP..QPV--------...-..........--------..........-......----...---
ENSGGOP00000020860  .....ES..HS...SK..LDP--------...H..........KREVLLAL..........A......DSHA...DGQ
ENSGGOP00000004747  .....LA..YS...GV..QSK--KLTAMQ...R..........QLKKHFKE..........G......----...-KG
ENSGGOP00000016725  .....KK..LM...FE..QQKSILDEFKK...D..........SSVFILGN..........T......DRPD...ASA
ENSGGOP00000027884  .....KK..LM...FE..QQKSILDEFKK...D..........SSVFILGN..........T......DRPD...ASA
ENSGGOP00000008864  .....--..--...--..-----------...-..........--------..........-......----...---
ENSGGOP00000024021  .....--..--...RE..LTE--------...S..........ETKSLMAA..........A......DNDG...DGK
ENSGGOP00000002559  .....TA..AL...APg.AANSPTTNPVI...L..........IVDKVLET..........Q......DLNG...DGL
ENSGGOP00000008975  .....--..--...--..---EGQKQYTQ...S..........EIDFLLSC..........A......EADE...NDM
ENSGGOP00000015810  .....HN..LY...T-..---VLHIPHDP...V..........ALEEHFRD..........-......--DD...DGP
ENSGGOP00000022677  .....HN..LY...T-..---VLHIPHDP...V..........ALEEHFRD..........-......--DD...DGP
ENSGGOP00000001056  .....LR..FG...QG..-----------...E..........EVEKLVKY..........L......DPND...LGR
ENSGGOP00000024407  .....NN..EL...SH..FLE--------...-..........--------..........-......----...---
ENSGGOP00000008333  .....RA..IG...FY..PSE--------...E..........KIDDIFNE..........IkfgeyvDTGKl..IDK
ENSGGOP00000005688  .....VT..IR...PH..VLT-------P...F..........VEECLVAA..........A......GGTT...SHQ
ENSGGOP00000027880  .....RA..IG...FY..PSE--------...E..........KIDDIFNE..........IkfgeyvDTGKl..IDK
ENSGGOP00000015096  .....--..--...--..-----------...-..........--------..........-......----...---
ENSGGOP00000022419  .....--..--...--..-----------...-..........-----FRR..........A......DKND...DGK
ENSGGOP00000003523  .....--..--...--..-----------...-..........-----FRR..........A......DKND...DGK
ENSGGOP00000007901  .....EE..RQ...DY..ASS--------...E..........QLAAIAQL..........H......EKTR...GGG
ENSGGOP00000008530  .....HN..LC...TV..L----------...-..........--------..........-......----...---
ENSGGOP00000007957  .....--..--...--..-----------...-..........--------..........-......----...---
ENSGGOP00000010635  .....--..--...--..-----------...-..........--------..........-......----...---
ENSGGOP00000004392  .....--..--...--..-----------...-..........--------..........-......----...---
ENSGGOP00000010370  .....--..--...--..-----------...-..........--------..........-......----...---
ENSGGOP00000022364  .....RT..VAk..VE..LSD--------...H..........VCDVVFAL..........F......DCDG...NGE
ENSGGOP00000015625  .....--..--...--..-PA--------...E..........TLHQITEL..........C......GAKR...VGY
ENSGGOP00000007654  .....SQ..VN...YR..VPNMRFLRERL...T..........DLE-----..........-......--QR...SGD
ENSGGOP00000020583  .....RT..VAk..VE..LSD--------...H..........VCDVVFAL..........F......DCDG...NGE
ENSGGOP00000013302  .....MN..--...--..-----------...-..........--------..........-......----...---
ENSGGOP00000010930  .....--..--...--..-----------...-..........--------..........-......----...---
ENSGGOP00000005349  .....--..--...--..-----------...-..........--------..........-......----...--R
ENSGGOP00000008253  .....EK..EF...HP..ILK--------...-..........--------..........-......----...---
ENSGGOP00000001993  .....--..--...--..-----------...-..........--------..........-......----...---
ENSGGOP00000024222  .....KQ..VK...H-..IPE--------...S..........KLTSLAAA..........L......DENK...DGK
ENSGGOP00000002875  .....KQ..VK...H-..IPE--------...S..........KLTSLAAA..........L......DENK...DGK
ENSGGOP00000012369  .....--..--...--..-----------...E..........DLQDLFRK..........T......GQDV...DGK
ENSGGOP00000011933  .....LE..LI...PT..LPQLDGLEKSF...Ysfyvct....AVRKFFFF..........L......DPLR...TGK
ENSGGOP00000011848  .....--..--...--..-----------...-..........-------D..........N......DKNG...DGF
ENSGGOP00000018329  .....HQ..AA...KRg.DRDRALSEEQE...E..........QAARQFAA..........L......DPEH...RGH
ENSGGOP00000000391  .....HQ..AA...KRg.DRDRALSEEQE...E..........QAARQFAA..........L......DPEH...RGH
ENSGGOP00000013508  .....--..--...--..-----------...-..........--------..........-......----...---
ENSGGOP00000022560  .....--..--...--..-----------...-..........--------..........-......----...---
ENSGGOP00000019614  .....--..--...--..-----------...-..........--------..........-......----...---
ENSGGOP00000015110  .....--..--...--..---DSQKQFSG...P..........EIQFLLSC..........S......EADE...NEM
ENSGGOP00000008437  .....--..--...--..-----------...-..........--------..........-......----...---
ENSGGOP00000016998  .....--..--...--..---DSQKQFSG...P..........EIQFLLSC..........S......EADE...NEM
ENSGGOP00000024026  .....LG..LY...ND..PNS------NP...K..........IVQLLAGV..........A......DQTK...DGL
ENSGGOP00000017722  .....--..--...--..-----------...-..........--------..........-......----...---
ENSGGOP00000017757  .....--..--...--..-----------...-..........--------..........-......----...---
ENSGGOP00000002740  .....--..--...--..-----------...-..........--------..........-......----...---
ENSGGOP00000012168  .....--..--...--..-----------...-..........--------..........-......----...---
ENSGGOP00000001815  .....--..--...--..-----------...-..........--------..........-......-QGG...EQK
ENSGGOP00000020483  .....--..--...--..-----------...-..........--------..........-......-QGG...EQK
ENSGGOP00000020927  .....--..--...--..-----------...-..........--------..........-......-QGG...EQK
ENSGGOP00000002387  .....--..--...--..-----------...-..........--------..........-......----...---
ENSGGOP00000006515  .....--..--...--..-----------...-..........DAEAVFQR..........L......DADR...DGA
ENSGGOP00000008725  .....--..--...--..-----------...-..........--------..........-......----...---
ENSGGOP00000018073  .....--..--...--..-----------...-..........--------..........-......----...---
ENSGGOP00000015740  .....EA..VTg..QG..PQD--------...A..........RLQTLANS..........L......DPNG...EGP


                                   80                                                               
                                    |                                                               
d1kful1               .........LG...LKEFYILWT.......................................................
ENSGGOP00000000209  .........ID...FPEFLTMMArkmkdtd................................................
ENSGGOP00000022972  .........ID...FPEFLTMMArkmkdtd................................................
ENSGGOP00000021376  .........ID...FREFIIALSvtsrgk.................................................
ENSGGOP00000009800  .........ID...FREFIIALSvtsrgr.................................................
ENSGGOP00000011095  .........MN...FGDFLTVMTqkmsekd................................................
ENSGGOP00000003638  .........LG...FEEFKYLWN.......................................................
ENSGGOP00000025293  .........LG...FEEFKYLWN.......................................................
ENSGGOP00000002483  .........ID...FPEFLTMMArkmkdtd................................................
ENSGGOP00000028220  .........ID...FREFIIALSvtsrgk.................................................
ENSGGOP00000017724  .........ID...FPEFLTMMArkmkdtd................................................
ENSGGOP00000006566  .........VD...FPEFLGMMArkmkdtd................................................
ENSGGOP00000019618  .........ID...FPEFLTMMArkmkdtd................................................
ENSGGOP00000008245  .........IS...SDGFCRYLM.......................................................
ENSGGOP00000025102  .........ID...FREFICALSitsrgs.................................................
ENSGGOP00000010426  .........IP...QEDFTPEVYrvflnnic...............................................
ENSGGOP00000015754  .........IA...LDEWAGCFG.......................................................
ENSGGOP00000012299  .........LN...LQEFHHLWN.......................................................
ENSGGOP00000021175  .........IS...SDGFCRYLM.......................................................
ENSGGOP00000019593  .........LN...LQEFHHLWN.......................................................
ENSGGOP00000006396  .........VS...FEDFVAGLSvilrgt.................................................
ENSGGOP00000022632  .........IR...PDEFSLEIFerflnklc...............................................
ENSGGOP00000011943  .........IR...PDEFSLEIFerflnklc...............................................
ENSGGOP00000008286  .........IN...YEEFKKALEelat...................................................
ENSGGOP00000015051  .........IT...LKEWGHCFG.......................................................
ENSGGOP00000024872  .........IT...LKEWGHCFG.......................................................
ENSGGOP00000011390  .........--...---------.......................................................
ENSGGOP00000008090  .........ID...FREFICALSitsrgs.................................................
ENSGGOP00000006979  .........ID...FREFIIALSvtsrgk.................................................
ENSGGOP00000014947  .........--...--------Tttydgleqmhkdlvnvplc....................................
ENSGGOP00000000749  .........IN...PEDFPEPVYksflmslc...............................................
ENSGGOP00000022235  .........--...--------Tttydgleqmhkdlvnvplc....................................
ENSGGOP00000004772  .........IN...FTVFLTMFGeklkgad................................................
ENSGGOP00000001305  .........IS...FNDFLAVMTqkmsqkd................................................
ENSGGOP00000009619  .........IH...FEDFVVGLSillrgt.................................................
ENSGGOP00000027707  .........ID...FEEFLVMMVrqmkedakgk.............................................
ENSGGOP00000013700  makyvqgdaIG...YEGFQQFLKiylevdnv...............................................
ENSGGOP00000026634  .........VG...FPEFVTMRArkmkdag................................................
ENSGGOP00000027354  .........VK...FEDFVTALSillrgt.................................................
ENSGGOP00000007591  .........LG...LVEFNILWN.......................................................
ENSGGOP00000024754  .........LG...LVEFNILWN.......................................................
ENSGGOP00000000341  .........IT...FEQFQEALE.......................................................
ENSGGOP00000006559  .........IS...FQEFLTAAKkara...................................................
ENSGGOP00000001194  .........IE...FSEFIQALSvtsrgt.................................................
ENSGGOP00000020610  .........LE...DEEIEAFYKmlt....................................................
ENSGGOP00000003736  .........LE...DEEIEAFYKmlt....................................................
ENSGGOP00000004196  .........IK...FSAYRTAMKlrrvqkalrldlv..........................................
ENSGGOP00000015532  .........VD...FDEFLVMMVrcmkddskgk.............................................
ENSGGOP00000000785  .........MG...FNEFKELWA.......................................................
ENSGGOP00000014368  .........LEgaeIEEFLRQLL.......................................................
ENSGGOP00000023413  .........VK...FEDFVTALSillrgt.................................................
ENSGGOP00000007126  .........VK...FEDFVTALSillrgt.................................................
ENSGGOP00000008349  .........LD...FKEYVIALHmttagk.................................................
ENSGGOP00000011020  .........LEgaeIEEFLRQLL.......................................................
ENSGGOP00000015507  .........ID...VYGFSALWK.......................................................
ENSGGOP00000012471  .........ID...FMEYVAALSlvlkgk.................................................
ENSGGOP00000012549  .........LE...FDEFKVFWD.......................................................
ENSGGOP00000019099  .........LG...LLEFKILWK.......................................................
ENSGGOP00000003031  .........LG...LLEFKILWK.......................................................
ENSGGOP00000005101  .........IT...FQQFKEAVKelgqkr.................................................
ENSGGOP00000024511  .........ID...FMEYVAALSlvlkgk.................................................
ENSGGOP00000018250  .........IN...FTMFLTMFGeklngtd................................................
ENSGGOP00000003074  .........VD...FDDFVELMTpkllaetagmi............................................
ENSGGOP00000012477  .........ID...FMEYVAALSlvlkgk.................................................
ENSGGOP00000010001  .........LG...FEEFCAFYKmms....................................................
ENSGGOP00000020622  .........LG...FEEFCAFYKmms....................................................
ENSGGOP00000010490  .........FN...CDGFLALMGvyhekaqn...............................................
ENSGGOP00000015637  ......gteVT...KEEFIEVFHelc....................................................
ENSGGOP00000011144  .........IN...FTMFLTMFGeklngtd................................................
ENSGGOP00000026982  .........IN...FTMFLTMFGeklngtd................................................
ENSGGOP00000003975  .........IN...FTMFLTMFGeklngtd................................................
ENSGGOP00000004885  .........IT...IEEFRAIYRiit....................................................
ENSGGOP00000014678  .........MG...FNAFKELWA.......................................................
ENSGGOP00000013437  .........ID...FEGFKLFMKtfleael................................................
ENSGGOP00000011390  .........--...---------.......................................................
ENSGGOP00000010036  .........VD...FKEFIEGVSqfsvkgd................................................
ENSGGOP00000027819  .........VD...FEDFVELMGpkllaetadmi............................................
ENSGGOP00000012841  .........VD...FDDFVELMGpkllaetadmi............................................
ENSGGOP00000009918  .........VD...FEDFVELMGpkllaetadmi............................................
ENSGGOP00000012485  .........ID...FLEYVAALNlvlrgt.................................................
ENSGGOP00000009782  .........VD...FEEFVELIGpklreetahml............................................
ENSGGOP00000009375  .........IT...FEDFNETVVtdwilerd...............................................
ENSGGOP00000023560  .........VS...IFEFDVFTR.......................................................
ENSGGOP00000014947  .........--...---------.......................................................
ENSGGOP00000012603  .........IS...YDVFKLFMR.......................................................
ENSGGOP00000017349  .........IS...VFEFDIFTR.......................................................
ENSGGOP00000003738  .........IS...VFEFDIFTR.......................................................
ENSGGOP00000007513  .........--...---------.......................................................
ENSGGOP00000022235  .........--...---------.......................................................
ENSGGOP00000001928  .........VT...EEEFCEAFCelc....................................................
ENSGGOP00000013652  .........LG...LKEFYILWT.......................................................
ENSGGOP00000006109  .........ID...FLEFIAAVNlivqek.................................................
ENSGGOP00000003219  .......kvLD...FEHFLPMLQtvaknkdqg..............................................
ENSGGOP00000022428  .........--...---------.......................................................
ENSGGOP00000017119  .........--...---------.......................................................
ENSGGOP00000003545  .........--...---------.......................................................
ENSGGOP00000023406  .........IE...FEQFLPMMQaisnnkdqa..............................................
ENSGGOP00000007856  .........LG...LKEFYILWT.......................................................
ENSGGOP00000011697  .........IE...FEQFLPMMQaisnnkdqa..............................................
ENSGGOP00000018636  .........IS...VFEFDIFT-.......................................................
ENSGGOP00000017641  .......kvLD...FEHFLPMLQtvaknkdqg..............................................
ENSGGOP00000013074  .........LD...FEEFMKYLKd......................................................
ENSGGOP00000007661  .........LD...FSTFLTIMHmqikqed................................................
ENSGGOP00000020763  .........ID...FNEFLLTLRppmsra.................................................
ENSGGOP00000005624  .........IN...FTMFLNLFGeklsgtd................................................
ENSGGOP00000025395  .........VS...TAEWCFCFW.......................................................
ENSGGOP00000019250  .........VS...TAEWCFCFW.......................................................
ENSGGOP00000020096  .........IN...FTVFLTMFGeklkgtd................................................
ENSGGOP00000000796  .........LD...PSEINAIYLdk.....................................................
ENSGGOP00000004196  .........--...---------.......................................................
ENSGGOP00000002530  .........MD...FETFLPMLQhisknkdtg..............................................
ENSGGOP00000015006  .........VN...VLEWIHGLSlflrgs.................................................
ENSGGOP00000016611  .........IN...FTVFLTMFGeklkgad................................................
ENSGGOP00000004209  .........VD...FPGFVRVLAhfrpvededtetqdpkkpeplns................................
ENSGGOP00000011570  .........LE...GEEFVQFYKalt....................................................
ENSGGOP00000006906  .........LD...LEEFSRYLQe......................................................
ENSGGOP00000024832  .........LD...LEEFSRYLQe......................................................
ENSGGOP00000019567  .......kmLD...FETFLPILQhisrnkeqg..............................................
ENSGGOP00000009496  .......kmLD...FETFLPILQhisrnkeqg..............................................
ENSGGOP00000012555  .........IS...VQELMGCLG.......................................................
ENSGGOP00000006153  .........LD...LEEFLRALRpsmsqa.................................................
ENSGGOP00000008018  .........IS...LPELKGCL-.......................................................
ENSGGOP00000007513  .........--...---------.......................................................
ENSGGOP00000024452  .........IS...LPELKGCL-.......................................................
ENSGGOP00000005045  .........ID...FREYVIGLAvlcnpsn................................................
ENSGGOP00000017287  .........IN...FTVFLTMFGeklkgtd................................................
ENSGGOP00000004706  .........LS...FEDFLDLLSvfsdtat................................................
ENSGGOP00000022428  .........--...---------.......................................................
ENSGGOP00000017119  .........--...---------.......................................................
ENSGGOP00000003545  .........--...---------.......................................................
ENSGGOP00000004257  .........MT...LDNFLDMFSvmsemap................................................
ENSGGOP00000024127  .........LT...LPEFCAAFH.......................................................
ENSGGOP00000012291  .........LT...AEEFILAMH.......................................................
ENSGGOP00000004812  .........IN...FTVFLTLFGeklngtd................................................
ENSGGOP00000012046  .........LS...FREFLDILVvfmkgs.................................................
ENSGGOP00000015625  .........LT...LPEFCAAFH.......................................................
ENSGGOP00000008889  .........LT...LDEFCAAFH.......................................................
ENSGGOP00000008482  .........LD...FSEFLNLIG.......................................................
ENSGGOP00000013349  .........LD...FEEFVHYLQd......................................................
ENSGGOP00000011422  .........LS...FREFLDILVvfmkgs.................................................
ENSGGOP00000018846  .........LD...FEEFVHYLQd......................................................
ENSGGOP00000003216  .........VD...FETFLPMLQavaknrgqg..............................................
ENSGGOP00000021719  .........MS...IQEFRDLWK.......................................................
ENSGGOP00000005693  .........ID...LEEYIGDMYshdgntdepe.............................................
ENSGGOP00000010676  .........LT...FNDFVDMFSvlcesap................................................
ENSGGOP00000007432  .........LK...AEEFILAMH.......................................................
ENSGGOP00000018435  .........IS...WEEYKQATYgyylgnpaefhdssdhhtfkk..................................
ENSGGOP00000006035  .........LD...RDEFAVAMF.......................................................
ENSGGOP00000025507  .........LD...RDEFAVAMF.......................................................
ENSGGOP00000006035  .........LS...KDQFALAFH.......................................................
ENSGGOP00000025507  .........LS...KDQFALAFH.......................................................
ENSGGOP00000003343  .........--...-VEYMSSFQniriekpvqeahstlvetlyr..................................
ENSGGOP00000020870  .........MS...IQEFRDLWK.......................................................
ENSGGOP00000002976  .........MS...IQEFRDLWK.......................................................
ENSGGOP00000024041  .........IT...LQELQEALTllihgs.................................................
ENSGGOP00000009817  .........IT...LQELQEALTllihgs.................................................
ENSGGOP00000011240  .........ID...FKELSCGLSaccrgp.................................................
ENSGGOP00000008587  .........VQ...VEEYIADLYsaepgeeepa.............................................
ENSGGOP00000007432  .........MD...QQEFSIAMK.......................................................
ENSGGOP00000013302  .........LS...KDQFALAMY.......................................................
ENSGGOP00000024313  .........LS...KDQFALAMY.......................................................
ENSGGOP00000000552  .........-S...YEHF-----.......................................................
ENSGGOP00000002697  ....gladeIN...FEDFLTIMSyfrpidttmdeeqvels......................................
ENSGGOP00000016489  .........VD...FQEYVVLVA.......................................................
ENSGGOP00000028006  .........VS...LEEFLGDYRwdptanedpew............................................
ENSGGOP00000023206  .........VS...LEEFLGDYRwdptanedpew............................................
ENSGGOP00000006503  .........ID...FSEFLSLLG.......................................................
ENSGGOP00000006509  .........ID...FSEFLSLLG.......................................................
ENSGGOP00000021892  .........CD...FQEFMAFVA.......................................................
ENSGGOP00000004839  .........IG...IVELAHVLPteenflllfrcqqlk........................................
ENSGGOP00000019168  .........IG...VDEFSTL--.......................................................
ENSGGOP00000003722  .........VD...FEEFVTLLGpklstsgipekf...........................................
ENSGGOP00000007472  .........VS...LQEYMAFMIsretenvk...............................................
ENSGGOP00000027338  .........VD...FSEFIVFVA.......................................................
ENSGGOP00000007156  .........VN...FRGFMRTLAhfrpiednekskdvngpeplns.................................
ENSGGOP00000024526  .........VG...FQSFFSLIA.......................................................
ENSGGOP00000028098  .........VD...FNEFVVMVA.......................................................
ENSGGOP00000007082  .........VD...FQEYCVFLS.......................................................
ENSGGOP00000023859  .........--...---------.......................................................
ENSGGOP00000019080  .........--...---------.......................................................
ENSGGOP00000010449  .........FS...FEDVLGMASvfseqac................................................
ENSGGOP00000000844  .........LS...FEEFIMLMA.......................................................
ENSGGOP00000023819  .........ID...FSEFLSLLG.......................................................
ENSGGOP00000006595  .........VD...FQEFISLVA.......................................................
ENSGGOP00000006390  .........LS...LPEFISLPVgtvenqqgqdiddn.........................................
ENSGGOP00000015096  .........FA...YCDFIQSCVlllkakesslmhrmkiqnahkmkeagaetpsfysallriqpkivh..........
ENSGGOP00000019080  .........--...---------.......................................................
ENSGGOP00000002308  .........LD...DEEFALASH.......................................................
ENSGGOP00000023711  .........LD...DEEFALASH.......................................................
ENSGGOP00000000733  .........LD...LNDLARILAlqenfllqfkmdacstee.....................................
ENSGGOP00000023859  .........--...---------.......................................................
ENSGGOP00000028529  .........ID...FSEFLSLLG.......................................................
ENSGGOP00000015096  .........VP...YLAFLSRFGgidlyingikrrgggnemnccrtlreleiqvgekvfk..................
ENSGGOP00000002979  .........LD...DEEFALANH.......................................................
ENSGGOP00000000348  .........LD...DEEFALANH.......................................................
ENSGGOP00000012168  .........LN...FDDFCIILRkekpt..................................................
ENSGGOP00000021101  .........IC...FDEFLYILGklv....................................................
ENSGGOP00000024236  .........IC...FDEFLYILGklv....................................................
ENSGGOP00000005783  .........VT...FQAFIDFMSrettdtd................................................
ENSGGOP00000011525  .........LD...EEEFALAKH.......................................................
ENSGGOP00000011629  .........VT...FQSFIDFMTretadtd................................................
ENSGGOP00000009256  .........IG...VDGF-----.......................................................
ENSGGOP00000022443  .........--...YE-------.......................................................
ENSGGOP00000013081  .........--...YE-------.......................................................
ENSGGOP00000006507  .........LT...LKGFLFLHTlfiqrgrhettwtvlrrfgydddldltpeylfpllkippdcttelnhh.......
ENSGGOP00000026277  .........LT...LKGFLFLHTlfiqrgrhettwtvlrrfgydddldltpeylfpllkippdcttelnhh.......
ENSGGOP00000026775  .........LD...FSEFLKLIG.......................................................
ENSGGOP00000015605  .........VT...FQAFIDFMTretaetd................................................
ENSGGOP00000013437  .........--...----VCYLSllergr.................................................
ENSGGOP00000015096  .........IN...WKYFLQNFScfleetadewaekmpkgppptspkatadrdilarlhkvvts..............
ENSGGOP00000015264  .........VD...LRECVVALSvvcrpar................................................
ENSGGOP00000019492  .........LD...QEEFAQLWK.......................................................
ENSGGOP00000015242  .........LD...QEEFAQLWK.......................................................
ENSGGOP00000015096  .........LN...FREFQNLCEkrpwrtdeapqrlirpkqkvadselaceqahqylvtkakn...............
ENSGGOP00000011088  .........IG...FEKFYMLVCmllahqnhlegqf..........................................
ENSGGOP00000020157  .........VD...FVEYVRSLA.......................................................
ENSGGOP00000025587  .........ID...FTEFLLMVF.......................................................
ENSGGOP00000002805  .........IS...FEEFVSLMQel.....................................................
ENSGGOP00000013256  .........IN...YLEFANFLNwkdk...................................................
ENSGGOP00000023524  .........IN...YLEFANFLNwkdk...................................................
ENSGGOP00000013295  .........VD...YGEFKRGIIgemney.................................................
ENSGGOP00000018258  .........VD...YGEFKRGIIgemney.................................................
ENSGGOP00000005688  .........IS...FQEFVAFESvlca...................................................
ENSGGOP00000007088  .........VN...FQEYVTFLG.......................................................
ENSGGOP00000004418  .........ID...FHEYLLLVF.......................................................
ENSGGOP00000004827  .........L-...LEGFLNIVRkkkeaqr................................................
ENSGGOP00000023450  .........--...---------.......................................................
ENSGGOP00000007087  .........ID...FKEYSVFLT.......................................................
ENSGGOP00000020253  .........VN...FQEFLILVI.......................................................
ENSGGOP00000027573  .........VN...FQEFLILVI.......................................................
ENSGGOP00000021162  .........--...--------Etlyr...................................................
ENSGGOP00000016495  .........LK...FNEYWRLIG.......................................................
ENSGGOP00000005787  .........--...---------.......................................................
ENSGGOP00000020487  .........VD...FNEFLLFIF.......................................................
ENSGGOP00000016148  .........VT...FQAFIDFMSretadtd................................................
ENSGGOP00000015096  .........IN...WKQFLTSFHepqrlqvsskdpltkrnsinsrnesrkeniitklfrhted...............
ENSGGOP00000012603  .........--...--------Etgr....................................................
ENSGGOP00000015201  .........IS...FDEFIKIFHgl.....................................................
ENSGGOP00000024915  .........LD...FPKFLNLIG.......................................................
ENSGGOP00000023450  .........--...---------.......................................................
ENSGGOP00000001678  .........LS...FREFLLIFH.......................................................
ENSGGOP00000024627  .........IS...FDEYWTLIG.......................................................
ENSGGOP00000018908  .........VE...FKEFLVLVF.......................................................
ENSGGOP00000025434  .........--...---------.......................................................
ENSGGOP00000006199  .........--...---------.......................................................
ENSGGOP00000019261  .........--...---------.......................................................
ENSGGOP00000005693  .........VS...WEEYKNAT-.......................................................
ENSGGOP00000001807  .........VD...FTEYLLMIF.......................................................
ENSGGOP00000024313  .........LG...ITEHLQAMH.......................................................
ENSGGOP00000019354  .........VE...LNEFLQLMS.......................................................
ENSGGOP00000018853  .........IG...V--------.......................................................
ENSGGOP00000008614  .........IS...FDEFVYIFQev.....................................................
ENSGGOP00000024313  .........LD...KQGFYVALR.......................................................
ENSGGOP00000000552  .........LE...QEDFIPLLQdvvdthpgltflkdapefhsry.................................
ENSGGOP00000004747  .........LT...IKNFLEFQR.......................................................
ENSGGOP00000013302  .........LD...KQGFYVALR.......................................................
ENSGGOP00000020941  .........VD...FQEYAVFLA.......................................................
ENSGGOP00000000504  .........VS...LEDYTAFLIdkesenik...............................................
ENSGGOP00000024502  .........VS...LEDYTAFLIdkesenik...............................................
ENSGGOP00000011848  .........--...-EEYKQATYdlgnpaefhdssdhytfkk....................................
ENSGGOP00000024360  .........VE...LDDFISALAkersfp.................................................
ENSGGOP00000000733  .........IR...MKELAGMFLsedenflllfrqenpld......................................
ENSGGOP00000024360  .........VN...IKDCMRALRdtqkfssyidfrkeasnlklp..................................
ENSGGOP00000021249  .........ID...YYEFVAALH.......................................................
ENSGGOP00000019415  .........ID...YYEFVAALH.......................................................
ENSGGOP00000013501  ....vwedrLT...LDGFLFLNTlfiqrgrhettwtilrrfgysdaleltadylsppihvppgcstelnhl.......
ENSGGOP00000021515  .........VH...FDQFKEALIlilsr..................................................
ENSGGOP00000005854  .........VH...FDQFKEALIlilsr..................................................
ENSGGOP00000016618  .........IE...MAELAQILPteenfllcfrqhvgssaefmegmkl..............................
ENSGGOP00000024091  .........VN...FSDFIKVLT.......................................................
ENSGGOP00000013700  .........--...---FQQFLKiylevdnvprhlslalfqsfetghclnetnvtkdvvclndvscyfslleggr...
ENSGGOP00000008485  .........LN...FQNLFSLT-.......................................................
ENSGGOP00000011966  .........--...---------.......................................................
ENSGGOP00000023645  .........--...---------.......................................................
ENSGGOP00000028176  .........LA...EQEFVTIARhyrvpegtcsdmdflialahekfkknmfe..........................
ENSGGOP00000004508  .........IT...FDEFRSFFQfln....................................................
ENSGGOP00000018206  .........IT...FDEFRSFFQfln....................................................
ENSGGOP00000006739  .........IN...FREFVSGLSaachgd.................................................
ENSGGOP00000023979  .........IN...FREFVSGLSaachgd.................................................
ENSGGOP00000012342  .........LA...EQEFVTIARhyrvpegtcsdmdflialahekfkknmfe..........................
ENSGGOP00000023206  .........VT...WDEYNIQMYdrvidfdentalddaeeesfrk.................................
ENSGGOP00000001608  .........IS...FQDFTRCR-.......................................................
ENSGGOP00000010042  .........LT...PQEFTTGF-.......................................................
ENSGGOP00000028006  .........VT...WDEYNIQMYdrvidfdentalddaeeesfrkefaickkh.........................
ENSGGOP00000025507  .........LN...KQQIFKCCT.......................................................
ENSGGOP00000020583  .........LT...IKNFLEFQR.......................................................
ENSGGOP00000012393  .........IS...QEEFQIIRG.......................................................
ENSGGOP00000016724  .........LP...TEEYEEAMSt......................................................
ENSGGOP00000023938  .........LS...FREFLLIFR.......................................................
ENSGGOP00000022364  .........LT...IKNFLEFQR.......................................................
ENSGGOP00000005326  .........VN...FSDFIKV--.......................................................
ENSGGOP00000008587  .........VG...WEELRNATY.......................................................
ENSGGOP00000002982  .........IN...FKEFVTGMSgmyhgd.................................................
ENSGGOP00000006523  .........LS...FREFLLIFR.......................................................
ENSGGOP00000014183  .........IS...AREF-----.......................................................
ENSGGOP00000018435  .........VD...QDEYIADMFsheengpepd.............................................
ENSGGOP00000021184  .........ID...CQQFRVLYHllspwahsan.............................................
ENSGGOP00000015096  .........IL...YKKLLAHIGidgpptvs...............................................
ENSGGOP00000024360  .........--...---------.......................................................
ENSGGOP00000027849  .........IN...FKEFVTGMSgmyhgd.................................................
ENSGGOP00000022443  .........LV...QEDFVPFLQdvvnthpglsflkeasefhsry.................................
ENSGGOP00000013081  .........LV...QEDFVPFLQdvvnthpglsflkeasefhsry.................................
ENSGGOP00000022610  .........IE...MAELAQILP.......................................................
ENSGGOP00000010606  .........IG...YQDFVSLMS.......................................................
ENSGGOP00000026802  .........VS...LEEFQL---.......................................................
ENSGGOP00000011774  .........IS...FDEFVLTIF.......................................................
ENSGGOP00000002441  .........VS...LEEFQL---.......................................................
ENSGGOP00000002021  .........IS...QEEFEKIAA.......................................................
ENSGGOP00000009877  .........VP...PEEFSTFIKaqvsegkgrlmpgqd........................................
ENSGGOP00000016754  .........IS...YRDFVNMML.......................................................
ENSGGOP00000007308  .........VL...LEEFSEYIHaqvasgkgklapgfd........................................
ENSGGOP00000012932  .........IE...KREFFKLQKiiskqddlmtvktnetgyqeaivke..............................
ENSGGOP00000012554  .........LD...FEDFMILLL.......................................................
ENSGGOP00000011621  ........mVN...YEKLLWFLNsaasdypqqnkaaadlrkteshgthsqstppqhsssqpevnrslleilkmalrtt
ENSGGOP00000024380  .........--...---------.......................................................
ENSGGOP00000000011  .........LS...FEEFKAYFAdgvl...................................................
ENSGGOP00000007649  .........--...---------.......................................................
ENSGGOP00000006035  .........LN...---------.......................................................
ENSGGOP00000011720  .........FS...YPDFLRMML.......................................................
ENSGGOP00000002269  .........LS...FQEFLKC--.......................................................
ENSGGOP00000018132  .........LT...AREFCLG--.......................................................
ENSGGOP00000017534  .........LS...FQEFLKC--.......................................................
ENSGGOP00000004508  .........IS...YTEYLFLLCiltk...................................................
ENSGGOP00000018206  .........IS...YTEYLFLLCiltk...................................................
ENSGGOP00000016496  .........LE...FRSFWELI-.......................................................
ENSGGOP00000012932  .........IS...YTEYLFLLTiltk...................................................
ENSGGOP00000004839  .........LE...LTEMARRLLpvqenfllkfqgikm........................................
ENSGGOP00000008738  .........LN...YTEFTQFLQel.....................................................
ENSGGOP00000028586  .........IS...PKEY-----.......................................................
ENSGGOP00000011240  .........LH...FNNLIVGLVlltrgk.................................................
ENSGGOP00000007686  .........IS...FEDFYQGI-.......................................................
ENSGGOP00000000151  .........VT...WQKYVDYMM.......................................................
ENSGGOP00000006499  .........--...---------.......................................................
ENSGGOP00000023045  .........ID...CQQFRVLYHllspwahsan.............................................
ENSGGOP00000020565  .........--...---------.......................................................
ENSGGOP00000012340  .........LD...YEEFVK---.......................................................
ENSGGOP00000023745  .........LD...YEEFVK---.......................................................
ENSGGOP00000008325  .........LA...LEEFYRAFQ.......................................................
ENSGGOP00000022444  .........LN...FDELRQDLKgkgh...................................................
ENSGGOP00000024026  .........LN...YTEFTQFLQel.....................................................
ENSGGOP00000003268  .........LN...FDELRQDLKgkgh...................................................
ENSGGOP00000012291  .........--...---------.......................................................
ENSGGOP00000020860  .........IG...YQDFVSLM-.......................................................
ENSGGOP00000004747  .........LT...FQEVENFFTflknindvdtalsfyhmag....................................
ENSGGOP00000016725  .........VY...LHDFQRFLI.......................................................
ENSGGOP00000027884  .........VY...LHDFQRFLI.......................................................
ENSGGOP00000008864  .........--...---------.......................................................
ENSGGOP00000024021  .........IG...AEEFQEM--.......................................................
ENSGGOP00000002559  .........MT...PAELI----.......................................................
ENSGGOP00000008975  .........FN...YIDFVD---.......................................................
ENSGGOP00000015810  .........VS...SQGYMPYLNkyildkveegafvke........................................
ENSGGOP00000022677  .........VS...SQGYMPYLNkyildkveegafvke........................................
ENSGGOP00000001056  .........IN...FKDFCRGV-.......................................................
ENSGGOP00000024407  .........--...---------.......................................................
ENSGGOP00000008333  .........IN...LPDFLKVYLnhkppfgntms............................................
ENSGGOP00000005688  .........VS...FSYFNGFNSlln....................................................
ENSGGOP00000027880  .........IN...LPDFLKVYLnhkppfgntms............................................
ENSGGOP00000015096  .........--...--------D.......................................................
ENSGGOP00000022419  .........LS...FEEFQNYFA.......................................................
ENSGGOP00000003523  .........LS...FEEFQNYFA.......................................................
ENSGGOP00000007901  .........VN...INEFFKG--.......................................................
ENSGGOP00000008530  .........--...---------.......................................................
ENSGGOP00000007957  .........--...FEELQCDVSve.....................................................
ENSGGOP00000010635  .........--...---------.......................................................
ENSGGOP00000004392  .........--...---------.......................................................
ENSGGOP00000010370  .........--...---------.......................................................
ENSGGOP00000022364  .........LS...NKEFVSIM-.......................................................
ENSGGOP00000015625  .........FG...PTQFYIALK.......................................................
ENSGGOP00000007654  .........IT...YGQFAQLYRslmy...................................................
ENSGGOP00000020583  .........LS...NKEFVSIM-.......................................................
ENSGGOP00000013302  .........--...---------.......................................................
ENSGGOP00000010930  .........--...---------.......................................................
ENSGGOP00000005349  .........ID...ARQFAHLFQlvspwtcgah.............................................
ENSGGOP00000008253  .........--...---------.......................................................
ENSGGOP00000001993  .........VT...LEQFRELLEargagc.................................................
ENSGGOP00000024222  .........VN...IDDLVKVM-.......................................................
ENSGGOP00000002875  .........VN...IDDLVKVM-.......................................................
ENSGGOP00000012369  .........LT...YQEIWTSLG.......................................................
ENSGGOP00000011933  .........IK...IQDILACSFlddllelrdeelskesqetnwfsap..............................
ENSGGOP00000011848  .........VD...QDEYIVVMFsheengsepd.............................................
ENSGGOP00000018329  .........IE...WPDFLS---.......................................................
ENSGGOP00000000391  .........IE...WPDFLS---.......................................................
ENSGGOP00000013508  .........--...---------.......................................................
ENSGGOP00000022560  .........--...---------.......................................................
ENSGGOP00000019614  .........--...---------.......................................................
ENSGGOP00000015110  .........IN...CEEFAN---.......................................................
ENSGGOP00000008437  .........--...---------.......................................................
ENSGGOP00000016998  .........IN...CEEFAN---.......................................................
ENSGGOP00000024026  .........VV...YGLFLAFRKillhynalcilyfrveressgngsg..............................
ENSGGOP00000017722  .........--...---------.......................................................
ENSGGOP00000017757  .........--...---------.......................................................
ENSGGOP00000002740  .........--...---------.......................................................
ENSGGOP00000012168  .........--...---------.......................................................
ENSGGOP00000001815  .........IQ...FEDFTNTLRelghaeh................................................
ENSGGOP00000020483  .........IQ...FEDFTNTLRelghaeh................................................
ENSGGOP00000020927  .........IQ...FEDFTNTLRelghaeh................................................
ENSGGOP00000002387  .........--...---------.......................................................
ENSGGOP00000006515  .........IT...FQEFARGF-.......................................................
ENSGGOP00000008725  .........--...---------.......................................................
ENSGGOP00000018073  .........--...---------.......................................................
ENSGGOP00000015740  ......katVD...LDTFLVVMR.......................................................


                          90                                                                        
                           |                                                                        
d1kful1               ....KI........................................................................
ENSGGOP00000000209  ....SE........................................................................
ENSGGOP00000022972  ....SE........................................................................
ENSGGOP00000021376  ....LE........................................................................
ENSGGOP00000009800  ....LE........................................................................
ENSGGOP00000011095  ....TK........................................................................
ENSGGOP00000003638  ....NI........................................................................
ENSGGOP00000025293  ....NI........................................................................
ENSGGOP00000002483  ....SE........................................................................
ENSGGOP00000028220  ....LE........................................................................
ENSGGOP00000017724  ....SE........................................................................
ENSGGOP00000006566  ....NE........................................................................
ENSGGOP00000019618  ....SE........................................................................
ENSGGOP00000008245  ....--........................................................................
ENSGGOP00000025102  ....FE........................................................................
ENSGGOP00000010426  ....PR........................................................................
ENSGGOP00000015754  ....--........................................................................
ENSGGOP00000012299  ....KI........................................................................
ENSGGOP00000021175  ....--........................................................................
ENSGGOP00000019593  ....KI........................................................................
ENSGGOP00000006396  ....VD........................................................................
ENSGGOP00000022632  ....LR........................................................................
ENSGGOP00000011943  ....LR........................................................................
ENSGGOP00000008286  ....K-........................................................................
ENSGGOP00000015051  ....--........................................................................
ENSGGOP00000024872  ....--........................................................................
ENSGGOP00000011390  ....--........................................................................
ENSGGOP00000008090  ....FE........................................................................
ENSGGOP00000006979  ....LE........................................................................
ENSGGOP00000014947  ....VD........................................................................
ENSGGOP00000000749  ....PR........................................................................
ENSGGOP00000022235  ....VD........................................................................
ENSGGOP00000004772  ....PE........................................................................
ENSGGOP00000001305  ....TK........................................................................
ENSGGOP00000009619  ....VH........................................................................
ENSGGOP00000027707  ....SE........................................................................
ENSGGOP00000013700  ....P-........................................................................
ENSGGOP00000026634  ....SE........................................................................
ENSGGOP00000027354  ....VH........................................................................
ENSGGOP00000007591  ....RI........................................................................
ENSGGOP00000024754  ....RI........................................................................
ENSGGOP00000000341  ....--........................................................................
ENSGGOP00000006559  ....GL........................................................................
ENSGGOP00000001194  ....LD........................................................................
ENSGGOP00000020610  ....QR........................................................................
ENSGGOP00000003736  ....QR........................................................................
ENSGGOP00000004196  ....TL........................................................................
ENSGGOP00000015532  ....SE........................................................................
ENSGGOP00000000785  ....VL........................................................................
ENSGGOP00000014368  ....KR........................................................................
ENSGGOP00000023413  ....VH........................................................................
ENSGGOP00000007126  ....VH........................................................................
ENSGGOP00000008349  ....TN........................................................................
ENSGGOP00000011020  ....KR........................................................................
ENSGGOP00000015507  ....FI........................................................................
ENSGGOP00000012471  ....VE........................................................................
ENSGGOP00000012549  ....KL........................................................................
ENSGGOP00000019099  ....KL........................................................................
ENSGGOP00000003031  ....KL........................................................................
ENSGGOP00000005101  ....F-........................................................................
ENSGGOP00000024511  ....VE........................................................................
ENSGGOP00000018250  ....PE........................................................................
ENSGGOP00000003074  ....GV........................................................................
ENSGGOP00000012477  ....VE........................................................................
ENSGGOP00000010001  ....TR........................................................................
ENSGGOP00000020622  ....TR........................................................................
ENSGGOP00000010490  ....QE........................................................................
ENSGGOP00000015637  ....TR........................................................................
ENSGGOP00000011144  ....PE........................................................................
ENSGGOP00000026982  ....PE........................................................................
ENSGGOP00000003975  ....PE........................................................................
ENSGGOP00000004885  ....HR........................................................................
ENSGGOP00000014678  ....AL........................................................................
ENSGGOP00000013437  ....P-........................................................................
ENSGGOP00000011390  ....--........................................................................
ENSGGOP00000010036  ....KE........................................................................
ENSGGOP00000027819  ....GV........................................................................
ENSGGOP00000012841  ....GV........................................................................
ENSGGOP00000009918  ....GV........................................................................
ENSGGOP00000012485  ....LE........................................................................
ENSGGOP00000009782  ....GV........................................................................
ENSGGOP00000009375  ....PH........................................................................
ENSGGOP00000023560  ....--........................................................................
ENSGGOP00000014947  ....--........................................................................
ENSGGOP00000012603  ....--........................................................................
ENSGGOP00000017349  ....--........................................................................
ENSGGOP00000003738  ....--........................................................................
ENSGGOP00000007513  ....--........................................................................
ENSGGOP00000022235  ....--........................................................................
ENSGGOP00000001928  ....TR........................................................................
ENSGGOP00000013652  ....KI........................................................................
ENSGGOP00000006109  ....ME........................................................................
ENSGGOP00000003219  ....TY........................................................................
ENSGGOP00000022428  ....--........................................................................
ENSGGOP00000017119  ....--........................................................................
ENSGGOP00000003545  ....--........................................................................
ENSGGOP00000023406  ....TY........................................................................
ENSGGOP00000007856  ....KI........................................................................
ENSGGOP00000011697  ....TY........................................................................
ENSGGOP00000018636  ....--........................................................................
ENSGGOP00000017641  ....TY........................................................................
ENSGGOP00000013074  ....HE........................................................................
ENSGGOP00000007661  ....PR........................................................................
ENSGGOP00000020763  ....RK........................................................................
ENSGGOP00000005624  ....AE........................................................................
ENSGGOP00000025395  ....--........................................................................
ENSGGOP00000019250  ....--........................................................................
ENSGGOP00000020096  ....PE........................................................................
ENSGGOP00000000796  ....YE........................................................................
ENSGGOP00000004196  ....--........................................................................
ENSGGOP00000002530  ....TY........................................................................
ENSGGOP00000015006  ....LE........................................................................
ENSGGOP00000016611  ....PE........................................................................
ENSGGOP00000004209  ....RR........................................................................
ENSGGOP00000011570  ....KR........................................................................
ENSGGOP00000006906  ....RE........................................................................
ENSGGOP00000024832  ....RE........................................................................
ENSGGOP00000019567  ....TY........................................................................
ENSGGOP00000009496  ....TY........................................................................
ENSGGOP00000012555  ....--........................................................................
ENSGGOP00000006153  ....RE........................................................................
ENSGGOP00000008018  ....--........................................................................
ENSGGOP00000007513  ....--........................................................................
ENSGGOP00000024452  ....--........................................................................
ENSGGOP00000005045  ....TE........................................................................
ENSGGOP00000017287  ....PE........................................................................
ENSGGOP00000004706  ....PD........................................................................
ENSGGOP00000022428  ....--........................................................................
ENSGGOP00000017119  ....--........................................................................
ENSGGOP00000003545  ....--........................................................................
ENSGGOP00000004257  ....RD........................................................................
ENSGGOP00000024127  ....--........................................................................
ENSGGOP00000012291  ....--........................................................................
ENSGGOP00000004812  ....PE........................................................................
ENSGGOP00000012046  ....PE........................................................................
ENSGGOP00000015625  ....--........................................................................
ENSGGOP00000008889  ....--........................................................................
ENSGGOP00000008482  ....--........................................................................
ENSGGOP00000013349  ....HE........................................................................
ENSGGOP00000011422  ....PE........................................................................
ENSGGOP00000018846  ....HE........................................................................
ENSGGOP00000003216  ....TY........................................................................
ENSGGOP00000021719  ....QL........................................................................
ENSGGOP00000005693  ....WV........................................................................
ENSGGOP00000010676  ....RE........................................................................
ENSGGOP00000007432  ....--........................................................................
ENSGGOP00000018435  ....ML........................................................................
ENSGGOP00000006035  ....--........................................................................
ENSGGOP00000025507  ....--........................................................................
ENSGGOP00000006035  ....--........................................................................
ENSGGOP00000025507  ....--........................................................................
ENSGGOP00000003343  ....YR........................................................................
ENSGGOP00000020870  ....QL........................................................................
ENSGGOP00000002976  ....QL........................................................................
ENSGGOP00000024041  ....PM........................................................................
ENSGGOP00000009817  ....PM........................................................................
ENSGGOP00000011240  ....LA........................................................................
ENSGGOP00000008587  ....WV........................................................................
ENSGGOP00000007432  ....--........................................................................
ENSGGOP00000013302  ....FI........................................................................
ENSGGOP00000024313  ....FI........................................................................
ENSGGOP00000000552  ....--........................................................................
ENSGGOP00000002697  ....RK........................................................................
ENSGGOP00000016489  ....--........................................................................
ENSGGOP00000028006  ....IL........................................................................
ENSGGOP00000023206  ....IL........................................................................
ENSGGOP00000006503  ....--........................................................................
ENSGGOP00000006509  ....--........................................................................
ENSGGOP00000021892  ....--........................................................................
ENSGGOP00000004839  ....SC........................................................................
ENSGGOP00000019168  ....--........................................................................
ENSGGOP00000003722  ....HG........................................................................
ENSGGOP00000007472  ....SS........................................................................
ENSGGOP00000027338  ....--........................................................................
ENSGGOP00000007156  ....RS........................................................................
ENSGGOP00000024526  ....--........................................................................
ENSGGOP00000028098  ....--........................................................................
ENSGGOP00000007082  ....CI........................................................................
ENSGGOP00000023859  ....--........................................................................
ENSGGOP00000019080  ....--........................................................................
ENSGGOP00000010449  ....PS........................................................................
ENSGGOP00000000844  ....--........................................................................
ENSGGOP00000023819  ....--........................................................................
ENSGGOP00000006595  ....--........................................................................
ENSGGOP00000006390  ....WV........................................................................
ENSGGOP00000015096  ....CW........................................................................
ENSGGOP00000019080  ....--........................................................................
ENSGGOP00000002308  ....--........................................................................
ENSGGOP00000023711  ....--........................................................................
ENSGGOP00000000733  ....RK........................................................................
ENSGGOP00000023859  ....--........................................................................
ENSGGOP00000028529  ....--........................................................................
ENSGGOP00000015096  ....NI........................................................................
ENSGGOP00000002979  ....--........................................................................
ENSGGOP00000000348  ....--........................................................................
ENSGGOP00000012168  ....SK........................................................................
ENSGGOP00000021101  ....K-........................................................................
ENSGGOP00000024236  ....K-........................................................................
ENSGGOP00000005783  ....TA........................................................................
ENSGGOP00000011525  ....--........................................................................
ENSGGOP00000011629  ....TA........................................................................
ENSGGOP00000009256  ....--........................................................................
ENSGGOP00000022443  ....HF........................................................................
ENSGGOP00000013081  ....HF........................................................................
ENSGGOP00000006507  ....AY........................................................................
ENSGGOP00000026277  ....AY........................................................................
ENSGGOP00000026775  ....--........................................................................
ENSGGOP00000015605  ....TT........................................................................
ENSGGOP00000013437  ....PE........................................................................
ENSGGOP00000015096  ....HY........................................................................
ENSGGOP00000015264  ....TL........................................................................
ENSGGOP00000019492  ....HL........................................................................
ENSGGOP00000015242  ....HL........................................................................
ENSGGOP00000015096  ....RW........................................................................
ENSGGOP00000011088  ....MY........................................................................
ENSGGOP00000020157  ....--........................................................................
ENSGGOP00000025587  ....--........................................................................
ENSGGOP00000002805  ....KS........................................................................
ENSGGOP00000013256  ....MLlkeyeerviikgrkpdcvnpteanieepeptllikpedivlkeagstektlrtllrpsdkvsnyykttssei
ENSGGOP00000023524  ....MLlkeyeerviikgrkpdcvnpteanieepeptllikpedivlkeagstektlrtllrpsdkvsnyykttssei
ENSGGOP00000013295  ....RK........................................................................
ENSGGOP00000018258  ....RK........................................................................
ENSGGOP00000005688  ....PD........................................................................
ENSGGOP00000007088  ....--........................................................................
ENSGGOP00000004418  ....--........................................................................
ENSGGOP00000004827  ....YR........................................................................
ENSGGOP00000023450  ....--........................................................................
ENSGGOP00000007087  ....T-........................................................................
ENSGGOP00000020253  ....--........................................................................
ENSGGOP00000027573  ....--........................................................................
ENSGGOP00000021162  ....YR........................................................................
ENSGGOP00000016495  ....--........................................................................
ENSGGOP00000005787  ....--........................................................................
ENSGGOP00000020487  ....--........................................................................
ENSGGOP00000016148  ....TA........................................................................
ENSGGOP00000015096  ....RC........................................................................
ENSGGOP00000012603  ....PQ........................................................................
ENSGGOP00000015201  ....KS........................................................................
ENSGGOP00000024915  ....--........................................................................
ENSGGOP00000023450  ....--........................................................................
ENSGGOP00000001678  ....--........................................................................
ENSGGOP00000024627  ....--........................................................................
ENSGGOP00000018908  ....--........................................................................
ENSGGOP00000025434  ....--........................................................................
ENSGGOP00000006199  ....--........................................................................
ENSGGOP00000019261  ....--........................................................................
ENSGGOP00000005693  ....--........................................................................
ENSGGOP00000001807  ....--........................................................................
ENSGGOP00000024313  ....--........................................................................
ENSGGOP00000019354  ....--........................................................................
ENSGGOP00000018853  ....--........................................................................
ENSGGOP00000008614  ....KS........................................................................
ENSGGOP00000024313  ....--........................................................................
ENSGGOP00000000552  ....IT........................................................................
ENSGGOP00000004747  ....--........................................................................
ENSGGOP00000013302  ....--........................................................................
ENSGGOP00000020941  ....--........................................................................
ENSGGOP00000000504  ....SS........................................................................
ENSGGOP00000024502  ....SS........................................................................
ENSGGOP00000011848  ....ML........................................................................
ENSGGOP00000024360  ....EC........................................................................
ENSGGOP00000000733  ....SS........................................................................
ENSGGOP00000024360  ....KV........................................................................
ENSGGOP00000021249  ....--........................................................................
ENSGGOP00000019415  ....--........................................................................
ENSGGOP00000013501  ....GY........................................................................
ENSGGOP00000021515  ....TLsneehfqepdcsleaqpkyvrggkrygrrslpefqesveefpevtviepldeearpshipasdcsehwktqr
ENSGGOP00000005854  ....TLsneehfqepdcsleaqpkyvrggkrygrrslpefqesveefpevtviepldeearpshipasdcsehwktqr
ENSGGOP00000016618  ....TS........................................................................
ENSGGOP00000024091  ....--........................................................................
ENSGGOP00000013700  ....PE........................................................................
ENSGGOP00000008485  ....--........................................................................
ENSGGOP00000011966  ....--........................................................................
ENSGGOP00000023645  ....CK........................................................................
ENSGGOP00000028176  ....NF........................................................................
ENSGGOP00000004508  ....NL........................................................................
ENSGGOP00000018206  ....NL........................................................................
ENSGGOP00000006739  ....LT........................................................................
ENSGGOP00000023979  ....LT........................................................................
ENSGGOP00000012342  ....NF........................................................................
ENSGGOP00000023206  ....LH........................................................................
ENSGGOP00000001608  ....--........................................................................
ENSGGOP00000010042  ....--........................................................................
ENSGGOP00000028006  ....SF........................................................................
ENSGGOP00000025507  ....--........................................................................
ENSGGOP00000020583  ....--........................................................................
ENSGGOP00000012393  ....-N........................................................................
ENSGGOP00000016724  ....MQ........................................................................
ENSGGOP00000023938  ....--........................................................................
ENSGGOP00000022364  ....--........................................................................
ENSGGOP00000005326  ....--........................................................................
ENSGGOP00000008587  ....--........................................................................
ENSGGOP00000002982  ....LT........................................................................
ENSGGOP00000006523  ....--........................................................................
ENSGGOP00000014183  ....--........................................................................
ENSGGOP00000018435  ....WV........................................................................
ENSGGOP00000021184  ....KD........................................................................
ENSGGOP00000015096  ....PVlvpkdqllsehlqkdeqqqpdlsertkltedkttltkkmtteeviekfkkciqqqh................
ENSGGOP00000024360  ....--........................................................................
ENSGGOP00000027849  ....LT........................................................................
ENSGGOP00000022443  ....IT........................................................................
ENSGGOP00000013081  ....IT........................................................................
ENSGGOP00000022610  ....TEenfllcfrqhvgssaefmekgrqrnkmrskllparslkwslsspkrlvlsdftkprslelfslnekrkdalm
ENSGGOP00000010606  ....--........................................................................
ENSGGOP00000026802  ....--........................................................................
ENSGGOP00000011774  ....--........................................................................
ENSGGOP00000002441  ....--........................................................................
ENSGGOP00000002021  ....--........................................................................
ENSGGOP00000009877  ....PE........................................................................
ENSGGOP00000016754  ....--........................................................................
ENSGGOP00000007308  ....AE........................................................................
ENSGGOP00000012932  ....PE........................................................................
ENSGGOP00000012554  ....--........................................................................
ENSGGOP00000011621  ngrlNI........................................................................
ENSGGOP00000024380  ....--........................................................................
ENSGGOP00000000011  ....SG........................................................................
ENSGGOP00000007649  ....--........................................................................
ENSGGOP00000006035  ....--........................................................................
ENSGGOP00000011720  ....--........................................................................
ENSGGOP00000002269  ....--........................................................................
ENSGGOP00000018132  ....--........................................................................
ENSGGOP00000017534  ....--........................................................................
ENSGGOP00000004508  ....PH........................................................................
ENSGGOP00000018206  ....PH........................................................................
ENSGGOP00000016496  ....--........................................................................
ENSGGOP00000012932  ....PH........................................................................
ENSGGOP00000004839  ....CG........................................................................
ENSGGOP00000008738  ....QL........................................................................
ENSGGOP00000028586  ....--........................................................................
ENSGGOP00000011240  ....DE........................................................................
ENSGGOP00000007686  ....--........................................................................
ENSGGOP00000000151  ....RE........................................................................
ENSGGOP00000006499  ....--........................................................................
ENSGGOP00000023045  ....KD........................................................................
ENSGGOP00000020565  ....--........................................................................
ENSGGOP00000012340  ....--........................................................................
ENSGGOP00000023745  ....--........................................................................
ENSGGOP00000008325  ....--........................................................................
ENSGGOP00000022444  ....TD........................................................................
ENSGGOP00000024026  ....QL........................................................................
ENSGGOP00000003268  ....TD........................................................................
ENSGGOP00000012291  ....--........................................................................
ENSGGOP00000020860  ....--........................................................................
ENSGGOP00000004747  ....A-........................................................................
ENSGGOP00000016725  ....HE........................................................................
ENSGGOP00000027884  ....HE........................................................................
ENSGGOP00000008864  ....--........................................................................
ENSGGOP00000024021  ....--........................................................................
ENSGGOP00000002559  ....--........................................................................
ENSGGOP00000008975  ....--........................................................................
ENSGGOP00000015810  ....HF........................................................................
ENSGGOP00000022677  ....HF........................................................................
ENSGGOP00000001056  ....--........................................................................
ENSGGOP00000024407  ....--........................................................................
ENSGGOP00000008333  ....GI........................................................................
ENSGGOP00000005688  ....NM........................................................................
ENSGGOP00000027880  ....GI........................................................................
ENSGGOP00000015096  ....RH........................................................................
ENSGGOP00000022419  ....--........................................................................
ENSGGOP00000003523  ....--........................................................................
ENSGGOP00000007901  ....--........................................................................
ENSGGOP00000008530  ....--........................................................................
ENSGGOP00000007957  ....ED........................................................................
ENSGGOP00000010635  ....--........................................................................
ENSGGOP00000004392  ....--........................................................................
ENSGGOP00000010370  ....--........................................................................
ENSGGOP00000022364  ....--........................................................................
ENSGGOP00000015625  ....--........................................................................
ENSGGOP00000007654  ....S-........................................................................
ENSGGOP00000020583  ....--........................................................................
ENSGGOP00000013302  ....--........................................................................
ENSGGOP00000010930  ....--........................................................................
ENSGGOP00000005349  ....TE........................................................................
ENSGGOP00000008253  ....--........................................................................
ENSGGOP00000001993  ....SS........................................................................
ENSGGOP00000024222  ....--........................................................................
ENSGGOP00000002875  ....--........................................................................
ENSGGOP00000012369  ....SA........................................................................
ENSGGOP00000011933  ....SA........................................................................
ENSGGOP00000011848  ....WV........................................................................
ENSGGOP00000018329  ....--........................................................................
ENSGGOP00000000391  ....--........................................................................
ENSGGOP00000013508  ....--........................................................................
ENSGGOP00000022560  ....--........................................................................
ENSGGOP00000019614  ....--........................................................................
ENSGGOP00000015110  ....--........................................................................
ENSGGOP00000008437  ....--........................................................................
ENSGGOP00000016998  ....--........................................................................
ENSGGOP00000024026  ....VF........................................................................
ENSGGOP00000017722  ....-K........................................................................
ENSGGOP00000017757  ....--........................................................................
ENSGGOP00000002740  ....--........................................................................
ENSGGOP00000012168  ....--........................................................................
ENSGGOP00000001815  ....EI........................................................................
ENSGGOP00000020483  ....EI........................................................................
ENSGGOP00000020927  ....EI........................................................................
ENSGGOP00000002387  ....--........................................................................
ENSGGOP00000006515  ....--........................................................................
ENSGGOP00000008725  ....--........................................................................
ENSGGOP00000018073  ....--........................................................................
ENSGGOP00000015740  ....--........................................................................


                                                                                      100           
                                                                                        |           
d1kful1               .........................................................QKYQKIYREI.......DVD.
ENSGGOP00000000209  .........................................................EEIREAFRVF.......DKD.
ENSGGOP00000022972  .........................................................EEIREAFRVF.......DKD.
ENSGGOP00000021376  .........................................................QKLKWAFSMY.......DLD.
ENSGGOP00000009800  .........................................................QKLMWAFSMY.......DLD.
ENSGGOP00000011095  .........................................................EEILKAFKLF.......DDD.
ENSGGOP00000003638  .........................................................KRWQAIYKQF.......DTD.
ENSGGOP00000025293  .........................................................KRWQAIYKQF.......DTD.
ENSGGOP00000002483  .........................................................EEIREAFRVF.......DKD.
ENSGGOP00000028220  .........................................................QKLKWAFSMY.......DLD.
ENSGGOP00000017724  .........................................................EEIREAFRVF.......DKD.
ENSGGOP00000006566  .........................................................EEIREAFRVF.......DKD.
ENSGGOP00000019618  .........................................................EEIREAFRVF.......DKD.
ENSGGOP00000008245  .........................................................----------.......---.
ENSGGOP00000025102  .........................................................QKLNWAFNMY.......DLD.
ENSGGOP00000010426  .........................................................PEIDNIFSEF.......GAK.
ENSGGOP00000015754  .........................................................----------.......---.
ENSGGOP00000012299  .........................................................KAWQKIFKHY.......DTD.
ENSGGOP00000021175  .........................................................----------.......---.
ENSGGOP00000019593  .........................................................KAWQKIFKHY.......DTD.
ENSGGOP00000006396  .........................................................DRLNWAFNLY.......DLN.
ENSGGOP00000022632  .........................................................PDIDKILLEI.......GAK.
ENSGGOP00000011943  .........................................................PDIDKILLEI.......GAK.
ENSGGOP00000008286  .........................................................----------.......---.
ENSGGOP00000015051  .........................................................----------.......---.
ENSGGOP00000024872  .........................................................----------.......---.
ENSGGOP00000011390  .........................................................MCLNWLLNVY.......DTG.
ENSGGOP00000008090  .........................................................QKLNWAFNMY.......DLD.
ENSGGOP00000006979  .........................................................QKLKWAFSMY.......DLD.
ENSGGOP00000014947  .........................................................MCLNWLLNVY.......DTG.
ENSGGOP00000000749  .........................................................PEIDEIFTSY.......HAK.
ENSGGOP00000022235  .........................................................MCLNWLLNVY.......DTG.
ENSGGOP00000004772  .........................................................ETILNAFKVF.......DPE.
ENSGGOP00000001305  .........................................................EEILKAFRLF.......DDD.
ENSGGOP00000009619  .........................................................EKLKWAFNLY.......DIN.
ENSGGOP00000027707  .........................................................EELAECFRIF.......DRN.
ENSGGOP00000013700  .........................................................----------.......---.
ENSGGOP00000026634  .........................................................EEMREAFRVF.......DKD.
ENSGGOP00000027354  .........................................................EKLRWTFNLY.......DIN.
ENSGGOP00000007591  .........................................................RNYLSIFRKF.......DLD.
ENSGGOP00000024754  .........................................................RNYLSIFRKF.......DLD.
ENSGGOP00000000341  .........................................................----------.......---.
ENSGGOP00000006559  .........................................................EDLQVAFRAF.......DQD.
ENSGGOP00000001194  .........................................................EKLRWAFKLY.......DLD.
ENSGGOP00000020610  .........................................................VEIDRTFAEA.......-AG.
ENSGGOP00000003736  .........................................................VEIDRTFAEA.......-AG.
ENSGGOP00000004196  .........................................................TTALEIFNEH.......DLQ.
ENSGGOP00000015532  .........................................................EELSDLFRMF.......DKN.
ENSGGOP00000000785  .........................................................NGWRQHFISF.......DTD.
ENSGGOP00000014368  .........................................................PELEEIFHQY.......-SG.
ENSGGOP00000023413  .........................................................EKLRWTFNLY.......DIN.
ENSGGOP00000007126  .........................................................EKLRWTFNLY.......DIN.
ENSGGOP00000008349  .........................................................QKLEWAFSLY.......DVD.
ENSGGOP00000011020  .........................................................PELEEIFHQY.......-SG.
ENSGGOP00000015507  .........................................................QQWKNLFQQY.......DRD.
ENSGGOP00000012471  .........................................................QKLRWYFKLY.......DVD.
ENSGGOP00000012549  .........................................................KQWINLFLRF.......DAD.
ENSGGOP00000019099  .........................................................KKWMDIFREC.......DQD.
ENSGGOP00000003031  .........................................................KKWMDIFREC.......DQD.
ENSGGOP00000005101  .........................................................----------.......---.
ENSGGOP00000024511  .........................................................QKLRWYFKLY.......DVD.
ENSGGOP00000018250  .........................................................DVIRNAFACF.......DEE.
ENSGGOP00000003074  .........................................................QEMRDAFKEF.......DTN.
ENSGGOP00000012477  .........................................................QKLRWYFKLY.......DVD.
ENSGGOP00000010001  .........................................................RDLYLLMLTY.......-SN.
ENSGGOP00000020622  .........................................................RDLYLLMLTY.......-SN.
ENSGGOP00000010490  .........................................................SELRAAFRVF.......DKE.
ENSGGOP00000015637  .........................................................PEIYFLLVQF.......-SS.
ENSGGOP00000011144  .........................................................DVIRNAFACF.......DEE.
ENSGGOP00000026982  .........................................................DVIRNAFACF.......DEE.
ENSGGOP00000003975  .........................................................DVIRNAFACF.......DEE.
ENSGGOP00000004885  .........................................................EEIIEIFNTY.......-SE.
ENSGGOP00000014678  .........................................................NAWKENFMTV.......DQD.
ENSGGOP00000013437  .........................................................----------.......---.
ENSGGOP00000011390  .........................................................----------.......---.
ENSGGOP00000010036  .........................................................QKLRFAFRIY.......DMD.
ENSGGOP00000027819  .........................................................RELRDAFREF.......DTN.
ENSGGOP00000012841  .........................................................KELRDAFREF.......DTN.
ENSGGOP00000009918  .........................................................RELRDAFREF.......DTN.
ENSGGOP00000012485  .........................................................HKLKWTFKIY.......DKD.
ENSGGOP00000009782  .........................................................RELRIAFREF.......DRD.
ENSGGOP00000009375  .........................................................EEILKAFKLF.......DDD.
ENSGGOP00000023560  .........................................................----------.......---.
ENSGGOP00000014947  .........................................................----------.......---.
ENSGGOP00000012603  .........................................................----------.......---.
ENSGGOP00000017349  .........................................................----------.......---.
ENSGGOP00000003738  .........................................................----------.......---.
ENSGGOP00000007513  .........................................................----------.......TLD.
ENSGGOP00000022235  .........................................................----------.......---.
ENSGGOP00000001928  .........................................................PEVYFLLVQI.......-SK.
ENSGGOP00000013652  .........................................................QKYQKIYREI.......DID.
ENSGGOP00000006109  .........................................................QKLKWYFKLY.......DAD.
ENSGGOP00000003219  .........................................................EDYVEGLRVF.......DKE.
ENSGGOP00000022428  .........................................................-LLNFLLAAF.......DPE.
ENSGGOP00000017119  .........................................................-LLNFLLAAF.......DPE.
ENSGGOP00000003545  .........................................................-LLNFLLAAF.......DPE.
ENSGGOP00000023406  .........................................................EDFVEGLRVF.......DKE.
ENSGGOP00000007856  .........................................................QKYQKIYREI.......DID.
ENSGGOP00000011697  .........................................................EDFVEGLRVF.......DKE.
ENSGGOP00000018636  .........................................................----------.......---.
ENSGGOP00000017641  .........................................................EDYVEGLRVF.......DKE.
ENSGGOP00000013074  .........................................................KKMKLAFKSL.......DKN.
ENSGGOP00000007661  .........................................................KEILLAMLMA.......DKE.
ENSGGOP00000020763  .........................................................EVIMQAFRKL.......DKT.
ENSGGOP00000005624  .........................................................ETILNAFKML.......DSD.
ENSGGOP00000025395  .........................................................----------.......---.
ENSGGOP00000019250  .........................................................----------.......---.
ENSGGOP00000020096  .........................................................ETILHAFKVF.......DTE.
ENSGGOP00000000796  .........................................................PCIKPLFNSC.......DSF.
ENSGGOP00000004196  .........................................................----------.......---.
ENSGGOP00000002530  .........................................................EDFVEGLRVF.......DKE.
ENSGGOP00000015006  .........................................................EKMKYCFEVF.......DLN.
ENSGGOP00000016611  .........................................................DVITGAFKVL.......DPE.
ENSGGOP00000004209  .........................................................NKLHYAFQLY.......DLD.
ENSGGOP00000011570  .........................................................AEVQELFESF.......SAD.
ENSGGOP00000006906  .........................................................QRLLLMFHSL.......DRN.
ENSGGOP00000024832  .........................................................QRLLLMFHSL.......DRN.
ENSGGOP00000019567  .........................................................EDFVEGLRVF.......DKE.
ENSGGOP00000009496  .........................................................EDFVEGLRVF.......DKE.
ENSGGOP00000012555  .........................................................----------.......---.
ENSGGOP00000006153  .........................................................AVIAAAFAKL.......DRS.
ENSGGOP00000008018  .........................................................----------.......---.
ENSGGOP00000007513  .........................................................----------.......---.
ENSGGOP00000024452  .........................................................----------.......---.
ENSGGOP00000005045  .........................................................EIIQVAFKLF.......DVD.
ENSGGOP00000017287  .........................................................ETILHAFKVF.......DTE.
ENSGGOP00000004706  .........................................................IKSHYAFRIF.......DFD.
ENSGGOP00000022428  .........................................................----------.......---.
ENSGGOP00000017119  .........................................................----------.......---.
ENSGGOP00000003545  .........................................................----------.......---.
ENSGGOP00000004257  .........................................................LKAYYAFKIY.......DFN.
ENSGGOP00000024127  .........................................................----------.......---.
ENSGGOP00000012291  .........................................................----------.......---.
ENSGGOP00000004812  .........................................................EAILSAFRMF.......DPS.
ENSGGOP00000012046  .........................................................EKSRLMFRMY.......DFD.
ENSGGOP00000015625  .........................................................----------.......---.
ENSGGOP00000008889  .........................................................----------.......---.
ENSGGOP00000008482  .........................................................----------.......---.
ENSGGOP00000013349  .........................................................KKLRLVFKSL.......DKK.
ENSGGOP00000011422  .........................................................DKSRLMFTMY.......DLD.
ENSGGOP00000018846  .........................................................KKLRLVFKSL.......DKK.
ENSGGOP00000003216  .........................................................EDYLEGLRVF.......DKE.
ENSGGOP00000021719  .........................................................KLSQKVFHKQ.......D-R.
ENSGGOP00000005693  .........................................................KTEREQFVEFr......DKN.
ENSGGOP00000010676  .........................................................LKANYAFKIY.......DFN.
ENSGGOP00000007432  .........................................................----------.......---.
ENSGGOP00000018435  .........................................................PRDERRFKAA.......DLN.
ENSGGOP00000006035  .........................................................----------.......---.
ENSGGOP00000025507  .........................................................----------.......---.
ENSGGOP00000006035  .........................................................----------.......---.
ENSGGOP00000025507  .........................................................----------.......---.
ENSGGOP00000003343  .........................................................SDLEIIFNAI.......DTD.
ENSGGOP00000020870  .........................................................KLSQKVFHKQ.......D-R.
ENSGGOP00000002976  .........................................................KLSQKVFHKQ.......D-R.
ENSGGOP00000024041  .........................................................DKLKFLFQVY.......DIDv
ENSGGOP00000009817  .........................................................DKLKFLFQVY.......DIDv
ENSGGOP00000011240  .........................................................ERQKFCFKVF.......DVD.
ENSGGOP00000008587  .........................................................QTERQQFRDFr......DLN.
ENSGGOP00000007432  .........................................................----------.......---.
ENSGGOP00000013302  .........................................................----------.......---.
ENSGGOP00000024313  .........................................................----------.......---.
ENSGGOP00000000552  .........................................................YVIYCKFWEL.......DTD.
ENSGGOP00000002697  .........................................................EKLRFLFHMY.......DSD.
ENSGGOP00000016489  .........................................................----------.......---.
ENSGGOP00000028006  .........................................................VEKDRFVNDY.......DKD.
ENSGGOP00000023206  .........................................................VEKDRFVNDY.......DKD.
ENSGGOP00000006503  .........................................................----------.......---.
ENSGGOP00000006509  .........................................................----------.......---.
ENSGGOP00000021892  .........................................................----------.......---.
ENSGGOP00000004839  .........................................................EEFMKTWRKY.......DTD.
ENSGGOP00000019168  .........................................................----------.......---.
ENSGGOP00000003722  .........................................................TDFDTVFWKC.......DMQ.
ENSGGOP00000007472  .........................................................EEIESAFRAL.......SSE.
ENSGGOP00000027338  .........................................................----------.......---.
ENSGGOP00000007156  .........................................................NKLHFAFRLY.......DLD.
ENSGGOP00000024526  .........................................................----------.......---.
ENSGGOP00000028098  .........................................................----------.......---.
ENSGGOP00000007082  .........................................................AMM-------.......---.
ENSGGOP00000023859  .........................................................----------.......---.
ENSGGOP00000019080  .........................................................----------.......---.
ENSGGOP00000010449  .........................................................LKIEYAFRIY.......DFN.
ENSGGOP00000000844  .........................................................----------.......---.
ENSGGOP00000023819  .........................................................----------.......---.
ENSGGOP00000006595  .........................................................----------.......---.
ENSGGOP00000006390  .........................................................KDRKKEFEELi......DSN.
ENSGGOP00000015096  .........................................................RPMRRTFKSY.......DET.
ENSGGOP00000019080  .........................................................----------.......---.
ENSGGOP00000002308  .........................................................----------.......---.
ENSGGOP00000023711  .........................................................----------.......---.
ENSGGOP00000000733  .........................................................RDFEKIFAYY.......DVS.
ENSGGOP00000023859  .........................................................----------.......---.
ENSGGOP00000028529  .........................................................----------.......---.
ENSGGOP00000015096  .........................................................KTVMKAFELI.......DVN.
ENSGGOP00000002979  .........................................................----------.......---.
ENSGGOP00000000348  .........................................................----------.......---.
ENSGGOP00000012168  .........................................................AELLKSFKQL.......DVN.
ENSGGOP00000021101  .........................................................----------.......---.
ENSGGOP00000024236  .........................................................----------.......---.
ENSGGOP00000005783  .........................................................DQVIASFKVL.......-AG.
ENSGGOP00000011525  .........................................................----------.......---.
ENSGGOP00000011629  .........................................................EQVIASFRIL.......-AS.
ENSGGOP00000009256  .........................................................----------.......---.
ENSGGOP00000022443  .........................................................YVIYCKFWEL.......DTD.
ENSGGOP00000013081  .........................................................YVIYCKFWEL.......DTD.
ENSGGOP00000006507  .........................................................LFLQSTFDKH.......DLD.
ENSGGOP00000026277  .........................................................LFLQSTFDKH.......DLD.
ENSGGOP00000026775  .........................................................----------.......---.
ENSGGOP00000015605  .........................................................EQVVASFKIL.......-AG.
ENSGGOP00000013437  .........................................................DKLEFMFRLY.......DTD.
ENSGGOP00000015096  .........................................................HAITQEFENF.......DTM.
ENSGGOP00000015264  .........................................................DTIQLAFKMY.......GAQ.
ENSGGOP00000019492  .........................................................VHYQHVFQKV.......-QT.
ENSGGOP00000015242  .........................................................VHYQHVFQKV.......-QT.
ENSGGOP00000015096  .........................................................SDLSKNFLET.......DNE.
ENSGGOP00000011088  .........................................................RHSRPVFDLL.......DLK.
ENSGGOP00000020157  .........................................................----------.......---.
ENSGGOP00000025587  .........................................................----------.......---.
ENSGGOP00000002805  .........................................................KDISKTFRKI.......---.
ENSGGOP00000013256  naivgaipstcypicgvptirsdipaprirrisdrtnygeegsaysllyptifaqkgVFERDFFKTR.......---.
ENSGGOP00000023524  naivgaipstcypicgvptirsdipaprirrisdrtnygeegsaysllyptifaqkgVFERDFFKTR.......---.
ENSGGOP00000013295  .........................................................SYVRKAFMKL.......DFN.
ENSGGOP00000018258  .........................................................SYVRKAFMKL.......DFN.
ENSGGOP00000005688  .........................................................ALFMVAFQLF.......DKA.
ENSGGOP00000007088  .........................................................----------.......---.
ENSGGOP00000004418  .........................................................----------.......---.
ENSGGOP00000004827  .........................................................NEVRHIFTAF.......DTY.
ENSGGOP00000023450  .........................................................----------.......-QK.
ENSGGOP00000007087  .........................................................----------.......---.
ENSGGOP00000020253  .........................................................----------.......---.
ENSGGOP00000027573  .........................................................----------.......---.
ENSGGOP00000021162  .........................................................SDLEIIFNAI.......DTD.
ENSGGOP00000016495  .........................................................----------.......---.
ENSGGOP00000005787  .........................................................---KTFFKLH.......DVN.
ENSGGOP00000020487  .........................................................----------.......---.
ENSGGOP00000016148  .........................................................DQVMASFKIL.......---.
ENSGGOP00000015096  .........................................................ASLKKALLII.......NTK.
ENSGGOP00000012603  .........................................................DKLEFMFRLY.......DSD.
ENSGGOP00000015201  .........................................................TDVAKTFR--.......---.
ENSGGOP00000024915  .........................................................----------.......---.
ENSGGOP00000023450  .........................................................----------.......---.
ENSGGOP00000001678  .........................................................----------.......---.
ENSGGOP00000024627  .........................................................----------.......---.
ENSGGOP00000018908  .........................................................----------.......---.
ENSGGOP00000025434  .........................................................----------.......---.
ENSGGOP00000006199  .........................................................----------.......---.
ENSGGOP00000019261  .........................................................----------.......---.
ENSGGOP00000005693  .........................................................----------.......---.
ENSGGOP00000001807  .........................................................----------.......---.
ENSGGOP00000024313  .........................................................----------.......---.
ENSGGOP00000019354  .........................................................----------.......---.
ENSGGOP00000018853  .........................................................----------.......---.
ENSGGOP00000008614  .........................................................SDIAKTFRKA.......---.
ENSGGOP00000024313  .........................................................----------.......---.
ENSGGOP00000000552  .........................................................TVIQRIFYTV.......NRS.
ENSGGOP00000004747  .........................................................----------.......---.
ENSGGOP00000013302  .........................................................----------.......---.
ENSGGOP00000020941  .........................................................----------.......---.
ENSGGOP00000000504  .........................................................DEIENAFQAL.......-AE.
ENSGGOP00000024502  .........................................................DEIENAFQAL.......-AE.
ENSGGOP00000011848  .........................................................PRDERRFKAA.......DLD.
ENSGGOP00000024360  .........................................................NALPGVVKAI.......DKI.
ENSGGOP00000000733  .........................................................VEFMQIWRKY.......DAD.
ENSGGOP00000024360  .........................................................NEIKEAANIL.......SHV.
ENSGGOP00000021249  .........................................................----------.......---.
ENSGGOP00000019415  .........................................................----------.......---.
ENSGGOP00000013501  .........................................................QFVQRVFEKH.......DQD.
ENSGGOP00000021515  ........................seeyeaegqlrfwnpddlnasqsgssppqdwieEKLQEVCEDL.......GIT.
ENSGGOP00000005854  ........................seeyeaegqlrfwnpddlnasqsgssppqdwieEKLQEVCEDL.......GIT.
ENSGGOP00000016618  .........................................................EEFNAIFTFY.......DKD.
ENSGGOP00000024091  .........................................................----------.......---.
ENSGGOP00000013700  .........................................................DKLEFTFKLY.......DTD.
ENSGGOP00000008485  .........................................................----------.......---.
ENSGGOP00000011966  .........................................................-LQLHYFKMH.......DYD.
ENSGGOP00000023645  .........................................................DNIREAFQIY.......DKE.
ENSGGOP00000028176  .........................................................DT-------FiyscvyeDRE.
ENSGGOP00000004508  .........................................................EDFAIALNMY.......-NF.
ENSGGOP00000018206  .........................................................EDFAIALNMY.......-NF.
ENSGGOP00000006739  .........................................................EKLKLLYKM-.......---.
ENSGGOP00000023979  .........................................................EKLKLLYKM-.......---.
ENSGGOP00000012342  .........................................................DT-------FiyscvyeDRE.
ENSGGOP00000023206  .........................................................LKDKKRFEKA.......NQD.
ENSGGOP00000001608  .........................................................----------.......---.
ENSGGOP00000010042  .........................................................----------.......---.
ENSGGOP00000028006  .........................................................CFWLLRFNLH.......---.
ENSGGOP00000025507  .........................................................----------.......---.
ENSGGOP00000020583  .........................................................----------.......---.
ENSGGOP00000012393  .........................................................FPYLSAFGDL.......DQN.
ENSGGOP00000016724  .........................................................VSQLDLFRLL.......DQN.
ENSGGOP00000023938  .........................................................----------.......---.
ENSGGOP00000022364  .........................................................----------.......---.
ENSGGOP00000005326  .........................................................----------.......---.
ENSGGOP00000008587  .........................................................----------.......---.
ENSGGOP00000002982  .........................................................EKLKVLYKL-.......---.
ENSGGOP00000006523  .........................................................----------.......---.
ENSGGOP00000014183  .........................................................----------.......---.
ENSGGOP00000018435  .........................................................LSEREQFNEFr......DLN.
ENSGGOP00000021184  .........................................................SLALWTFRLL.......DEN.
ENSGGOP00000015096  .........................................................PAFKKRFLDF.......SKE.
ENSGGOP00000024360  .........................................................-AFQDALKIF.......CRI.
ENSGGOP00000027849  .........................................................EKLKVLYK--.......---.
ENSGGOP00000022443  .........................................................TVIQRIFYAV.......NRS.
ENSGGOP00000013081  .........................................................TVIQRIFYAV.......NRS.
ENSGGOP00000022610  ..................................mmsttllllslipwflqgmkltsEEFNAIFTFY.......DKD.
ENSGGOP00000010606  .........................................................----------.......---.
ENSGGOP00000026802  .........................................................----------.......---.
ENSGGOP00000011774  .........................................................----------.......---.
ENSGGOP00000002441  .........................................................----------.......---.
ENSGGOP00000002021  .........................................................-SFPFSFCVM.......DKD.
ENSGGOP00000009877  .........................................................KTIGDMFQNQ.......DRN.
ENSGGOP00000016754  .........................................................----------.......---.
ENSGGOP00000007308  .........................................................LIVKNMFTNQ.......DRN.
ENSGGOP00000012932  .........................................................INTTLQMRFF.......GKR.
ENSGGOP00000012554  .........................................................----------.......---.
ENSGGOP00000011621  .........................................................DNLNLSFRKE.......DRS.
ENSGGOP00000024380  .........................................................----------.......---.
ENSGGOP00000000011  .........................................................EELHELFHTI.......DTH.
ENSGGOP00000007649  .........................................................----------.......---.
ENSGGOP00000006035  .........................................................----------.......---.
ENSGGOP00000011720  .........................................................----------.......---.
ENSGGOP00000002269  .........................................................----------.......---.
ENSGGOP00000018132  .........................................................----------.......---.
ENSGGOP00000017534  .........................................................----------.......---.
ENSGGOP00000004508  .........................................................AGFRIAFNMF.......DTD.
ENSGGOP00000018206  .........................................................AGFRIAFNMF.......DTD.
ENSGGOP00000016496  .........................................................----------.......---.
ENSGGOP00000012932  .........................................................SGFHVAFKML.......DTD.
ENSGGOP00000004839  .........................................................KEFNKAFELY.......DQD.
ENSGGOP00000008738  .........................................................EHARQAFALK.......DKS.
ENSGGOP00000028586  .........................................................----------.......---.
ENSGGOP00000011240  .........................................................EKAKYTFSLF.......SSQ.
ENSGGOP00000007686  .........................................................----------.......---.
ENSGGOP00000000151  .........................................................----------.......---.
ENSGGOP00000006499  .........................................................----------.......---.
ENSGGOP00000023045  .........................................................SLALWTFRLL.......DEN.
ENSGGOP00000020565  .........................................................----------.......---.
ENSGGOP00000012340  .........................................................----------.......---.
ENSGGOP00000023745  .........................................................----------.......---.
ENSGGOP00000008325  .........................................................----------.......---.
ENSGGOP00000022444  .........................................................AEIEAIFTKY.......DQD.
ENSGGOP00000024026  .........................................................EHARQAFALK.......DKS.
ENSGGOP00000003268  .........................................................AEIEAIFTKY.......DQD.
ENSGGOP00000012291  .........................................................----------.......---.
ENSGGOP00000020860  .........................................................----------.......---.
ENSGGOP00000004747  .........................................................----------.......---.
ENSGGOP00000016725  .........................................................QQE-------.......---.
ENSGGOP00000027884  .........................................................QQE-------.......---.
ENSGGOP00000008864  .........................................................----------.......---.
ENSGGOP00000024021  .........................................................----------.......---.
ENSGGOP00000002559  .........................................................----------.......---.
ENSGGOP00000008975  .........................................................----------.......---.
ENSGGOP00000015810  .........................................................DEL-------.......---.
ENSGGOP00000022677  .........................................................DEL-------.......---.
ENSGGOP00000001056  .........................................................----------.......---.
ENSGGOP00000024407  .........................................................----------.......---.
ENSGGOP00000008333  .........................................................HKSFEVLGYT.......NSK.
ENSGGOP00000005688  .........................................................ELIRKIYSTLa......GTR.
ENSGGOP00000027880  .........................................................HKSFEVLGYT.......NSK.
ENSGGOP00000015096  .........................................................QDISKAFTKT.......DQS.
ENSGGOP00000022419  .........................................................----------.......---.
ENSGGOP00000003523  .........................................................----------.......---.
ENSGGOP00000007901  .........................................................----------.......---.
ENSGGOP00000008530  .........................................................----------.......---.
ENSGGOP00000007957  .........................................................SRQEWTFTLY.......DFD.
ENSGGOP00000010635  .........................................................EQARRVFQTY.......DPE.
ENSGGOP00000004392  .........................................................----------.......---.
ENSGGOP00000010370  .........................................................---VAMFEMM.......DSS.
ENSGGOP00000022364  .........................................................----------.......---.
ENSGGOP00000015625  .........................................................----------.......---.
ENSGGOP00000007654  .........................................................----------.......---.
ENSGGOP00000020583  .........................................................----------.......---.
ENSGGOP00000013302  .........................................................----------.......---.
ENSGGOP00000010930  .........................................................-----LFRDL.......DAD.
ENSGGOP00000005349  .........................................................ILAERTFRLL.......DDN.
ENSGGOP00000008253  .........................................................----------.......---.
ENSGGOP00000001993  .........................................................EQFEEAFAQF.......DAE.
ENSGGOP00000024222  .........................................................----------.......---.
ENSGGOP00000002875  .........................................................----------.......---.
ENSGGOP00000012369  .........................................................MPEPESLRAF.......DSD.
ENSGGOP00000011933  .........................................................LRVYGQYLNL.......DKD.
ENSGGOP00000011848  .........................................................LSEREQFNEFr......DLN.
ENSGGOP00000018329  .........................................................----------.......---.
ENSGGOP00000000391  .........................................................----------.......---.
ENSGGOP00000013508  .........................................................-------QQL.......DPE.
ENSGGOP00000022560  .........................................................--------QL.......DPE.
ENSGGOP00000019614  .........................................................----------.......---.
ENSGGOP00000015110  .........................................................----------.......---.
ENSGGOP00000008437  .........................................................----------.......---.
ENSGGOP00000016998  .........................................................----------.......---.
ENSGGOP00000024026  .........................................................ENVKEIFGQT.......---.
ENSGGOP00000017722  .........................................................IKILEIFHKV.......GQG.
ENSGGOP00000017757  .........................................................--LLMAFVYF.......DQS.
ENSGGOP00000002740  .........................................................--LLMAFVYF.......DQS.
ENSGGOP00000012168  .........................................................---SDIFEVI.......DLD.
ENSGGOP00000001815  .........................................................TELTATFTKF.......DRD.
ENSGGOP00000020483  .........................................................TELTATFTKF.......DRD.
ENSGGOP00000020927  .........................................................TELTATFTKF.......DRD.
ENSGGOP00000002387  .........................................................-DCLLAFVFF.......DAN.
ENSGGOP00000006515  .........................................................----------.......---.
ENSGGOP00000008725  .........................................................----------.......---.
ENSGGOP00000018073  .........................................................----------.......---.
ENSGGOP00000015740  .........................................................----------.......---.


                                                      110       120                         130     
                                                        |         |                           |     
d1kful1               ...........................RSG.TMNSYEMRKALEEA.................GFK.MPCQLHQVIVAR
ENSGGOP00000000209  ...........................GNG.YISAAELRHVMTNL.................GEK.LTDEEVD-----
ENSGGOP00000022972  ...........................GNG.YISAAELRHVMTNL.................GEK.LTDEEVD-----
ENSGGOP00000021376  ...........................GNG.YISKAEMLEIVQAIykmvss...........VMK.MPEDEST-----
ENSGGOP00000009800  ...........................GNG.YISREEMLEIVQAIykmvss...........VMK.MPEDEST-----
ENSGGOP00000011095  ...........................ETG.KISFKNLKRVAKEL.................GEN.LTDEELQ-----
ENSGGOP00000003638  ...........................RSG.TICSSELPGAFEAA.................GFH.LNEHLYNMIIRR
ENSGGOP00000025293  ...........................RSG.TICSSELPGAFEAA.................GFH.LNEHLYNMIIRR
ENSGGOP00000002483  ...........................GNG.YISAAELRHVMTNL.................GEK.LTDEEVD-----
ENSGGOP00000028220  ...........................GNG.YISRSEMLEIVQAIykmvssvmkmpe.....DES.TPEKRTD-----
ENSGGOP00000017724  ...........................GNG.YISAAELRHVMTNL.................GEK.LTDEEVD-----
ENSGGOP00000006566  ...........................GNG.FVSAAELRHVMTRL.................GEK.LSDEEVD-----
ENSGGOP00000019618  ...........................GNG.YISAAELRHVMTNL.................GEK.LTDEEVD-----
ENSGGOP00000008245  ...........................---.--------------.................---.------------
ENSGGOP00000025102  ...........................GDG.KITRVEMLEIIEAI.................YKM.VGTVIMMKMNED
ENSGGOP00000010426  ...........................SKP.YLTVDQMMDFINLKqrdprlneil.......YPP.LKQEQVQVLIEK
ENSGGOP00000015754  ...........................---.--------------.................---.------------
ENSGGOP00000012299  ...........................QSG.TINSYEMRNAVNDA.................GFH.LNNQLYDIITMR
ENSGGOP00000021175  ...........................---.--------------.................---.------------
ENSGGOP00000019593  ...........................QSG.TINSYEMRNAVNDA.................GFH.LNNQLYDIITMR
ENSGGOP00000006396  ...........................KDG.CITKEEMLDIMKSIydmmgkytypal.....REE.APREHVE-----
ENSGGOP00000022632  ...........................GKP.YLTLEQLMDFINQ-.................---.------------
ENSGGOP00000011943  ...........................GKP.YLTLEQLMDFINQ-.................---.------------
ENSGGOP00000008286  ...........................---.--------------.................---.------------
ENSGGOP00000015051  ...........................---.--------------.................---.------------
ENSGGOP00000024872  ...........................---.--------------.................---.------------
ENSGGOP00000011390  ...........................RTG.RIRVLSFK------.................---.------------
ENSGGOP00000008090  ...........................GDG.KITRVEMLEIIEAI.................YKM.VGTVIMMKMNED
ENSGGOP00000006979  ...........................GNG.YISKAEMLEIVQAIykmvss...........VMK.MPEDEST-----
ENSGGOP00000014947  ...........................RTG.KIRVQSLKIGLMSL.................---.------------
ENSGGOP00000000749  ...........................AKP.YMTKEHLTKFINQK.................---.------------
ENSGGOP00000022235  ...........................RTG.KIRVQSLKIGLMSL.................---.------------
ENSGGOP00000004772  ...........................GKG.VLKADYVREMLTTQ.................AER.FSKEEVD-----
ENSGGOP00000001305  ...........................ETG.KISFKNLKRVANEL.................GEN.LTDEELQ-----
ENSGGOP00000009619  ...........................KDG.YITKEEMLAIMKSI.................YDM.MGRHTYPILRED
ENSGGOP00000027707  ...........................ADG.YIDPEELAEIFRAS.................GEH.VTDEEIE-----
ENSGGOP00000013700  ...........................---.--------------.................---.------------
ENSGGOP00000026634  ...........................GNG.YISAAELHHAMTNL.................GEK.LTDEAVD-----
ENSGGOP00000027354  ...........................KDG.YINKEEMMDIVKAIydmmgkytypvl.....KED.TPRQHVD-----
ENSGGOP00000007591  ...........................KSG.SMSAYEMRMAIESA.................GFK.LNKKLYELIITR
ENSGGOP00000024754  ...........................KSG.SMSAYEMRMAIESA.................GFK.LNKKLYELIITR
ENSGGOP00000000341  ...........................---.--------------.................---.------------
ENSGGOP00000006559  ...........................GDG.HITVDELKQAMAGL.................GQP.LPQEELD-----
ENSGGOP00000001194  ...........................NDG.YITRNEMLDIVDAIyqmvgntvelpe.....EEN.TPEKRVD-----
ENSGGOP00000020610  ...........................SGE.TLSVDQLVTFLQHQqr...............EEV.AGPALALSLIER
ENSGGOP00000003736  ...........................SGE.TLSVDQLVTFLQHQqr...............EEV.AGPALALSLIER
ENSGGOP00000004196  ...........................ASEhVMDVVEVIHCLTAL.................YER.LEEE--------
ENSGGOP00000015532  ...........................ADG.YIDLDELKIMLQAT.................GET.ITEDDIE-----
ENSGGOP00000000785  ...........................RSG.TVDPQELQKALTTMg................RFR.LSPQAVNSIAKR
ENSGGOP00000014368  ...........................EDR.VLSAPELLEFLEDQ.................GEEgATLARAQQLIQT
ENSGGOP00000023413  ...........................KDG.YINKEEMMDIVKAIydmmgkytypvl.....KED.TPRQHVD-----
ENSGGOP00000007126  ...........................KDG.YINKEEMMDIVKAIydmmgkytypvl.....KED.TPRQHVD-----
ENSGGOP00000008349  ...........................GNG.TISKNEVLEIVMAI.................FKM.ITPEDVKLLPDD
ENSGGOP00000011020  ...........................EDR.VLSAPELLEFLEDQ.................GEEgATLARAQQLIQT
ENSGGOP00000015507  ...........................RSG.SISYTELQQALSQM.................GYN.LSPQFTQLLVSR
ENSGGOP00000012471  ...........................GNG.CIDRDELLTIIQAIrainpcsd.........S--.------------
ENSGGOP00000012549  ...........................KSG.TMSTYELRTALKAA.................GFQ.LSSHLLQLIVLR
ENSGGOP00000019099  ...........................HSG.TLNSYEMRLAIEKA.................GIK.LNNKVMQVLVAR
ENSGGOP00000003031  ...........................HSG.TLNSYEMRLAIEKA.................GIK.LNNKVMQVLVAR
ENSGGOP00000005101  ...........................---.--------------.................---.------------
ENSGGOP00000024511  ...........................GNG.CIDRDELLTIIQVQragp.............G--.LA-------IRA
ENSGGOP00000018250  ...........................ASG.FIHEDHLRELLTTM.................GDR.FTDEEVD-----
ENSGGOP00000003074  ...........................GDG.EITLAELQQAMQRLl................GER.LTPREIS-----
ENSGGOP00000012477  ...........................GNG.CIDRDELLTIIQ--.................---.FPHQYQKTAIRA
ENSGGOP00000010001  ...........................HKD.HLDAASLQRFLQVEqkmt.............G--.VTLESCQDIIEQ
ENSGGOP00000020622  ...........................HKD.HLDAASLQRFLQVEqkmt.............G--.VTLESCQDIIEQ
ENSGGOP00000010490  ...........................GKG.YIDWNTLKYVLMNA.................GEP.LNEVEAE-----
ENSGGOP00000015637  ...........................NKE.FLDTKDLMMFLEAEqg...............VAH.INEEISLEIIHK
ENSGGOP00000011144  ...........................ATG.TIQEDYLRELLTTM.................GDR.FTDEEVD-----
ENSGGOP00000026982  ...........................ATG.TIQEDYLRELLTTM.................GDR.FTDEEVD-----
ENSGGOP00000003975  ...........................ATG.TIQEDYLRELLTTM.................GDR.FTDEEVD-----
ENSGGOP00000004885  ...........................NRK.ILLESNLAQFLTQEqy...............AAE.MSKAIAFEIIQK
ENSGGOP00000014678  ...........................GSG.TVEHHELRQAIGLM.................GYR.LSPQTLTTIVKR
ENSGGOP00000013437  ...........................---.--------------.................---.------------
ENSGGOP00000011390  ...........................---.--------------.................---.------------
ENSGGOP00000010036  ...........................KDG.YISNGELFQVLKMMv................GNN.LKDTQLQQIVD-
ENSGGOP00000027819  ...........................GDG.RISVGELRAALKALl................GER.LSQREVD-----
ENSGGOP00000012841  ...........................GDG.EISTSELREAMRKLl................GHQ.VGHRDIE-----
ENSGGOP00000009918  ...........................GDG.RISVGELRAALKALl................GER.LSQREVD-----
ENSGGOP00000012485  ...........................GNG.CIDRLELLNIVEGIyqlkkacrrelqteqg.QLL.TPEEVVD-----
ENSGGOP00000009782  ...........................RDG.RITVAELREAVPALl................GEP.LAGPELD-----
ENSGGOP00000009375  ...........................DSG.KISLRNLRRVAREL.................GEN.MSDEELR-----
ENSGGOP00000023560  ...........................---.--------------.................---.------------
ENSGGOP00000014947  ...........................---.--------------.................---.------------
ENSGGOP00000012603  ...........................---.--------------.................---.------------
ENSGGOP00000017349  ...........................---.--------------.................---.------------
ENSGGOP00000003738  ...........................---.--------------.................---.------------
ENSGGOP00000007513  ...........................HTT.EISVSRLETVISSI.................YYQ.LNKRLPS-----
ENSGGOP00000022235  ...........................---.--------------.................---.------------
ENSGGOP00000001928  ...........................NKE.YLDANDLMLFLEAEqg...............VTH.ITEDMCLDIIRR
ENSGGOP00000013652  ...........................RSG.TMNSYEMRKALEEA.................GFK.MPCQLHQVIVAR
ENSGGOP00000006109  ...........................GNG.SIDKNELLDMFMAV.................---.------------
ENSGGOP00000003219  ...........................GNG.TVMGAEIRHVLVTL.................GEK.MTEEEVEMLVAG
ENSGGOP00000022428  ...........................GHG.KISVFAVKMALAT-.................---.------------
ENSGGOP00000017119  ...........................GHG.KISVFAVKMALAT-.................---.------------
ENSGGOP00000003545  ...........................GHG.KISVFAVKMALAT-.................---.------------
ENSGGOP00000023406  ...........................GNG.TVMGAELRHVLATL.................GEK.MKEEEVEALMAG
ENSGGOP00000007856  ...........................RSG.TMNSYEMRKALEEA.................GFK.MPCQLHQVIVAR
ENSGGOP00000011697  ...........................GNG.TVMGAELRHVLATL.................GEK.MKEEEVEALMAG
ENSGGOP00000018636  ...........................---.--------------.................---.------------
ENSGGOP00000017641  ...........................GNG.TVMGAEIRHVLVTL.................GEK.MTEEEVEMLVAG
ENSGGOP00000013074  ...........................NDG.KIEASEIVQSLQTL.................GLT.ISEQQAE-----
ENSGGOP00000007661  ...........................KKG.YIMASDLRSKLTSL.................GEK.LTHKEVD-----
ENSGGOP00000020763  ...........................GDG.VITIEDLREVYNAKhhpkyqn..........GEW.SEEQVFRKFLDN
ENSGGOP00000005624  ...........................GKG.KINKEYIKRLLMSQ.................ADK.MTAEEVD-----
ENSGGOP00000025395  ...........................---.--------------.................---.------------
ENSGGOP00000019250  ...........................---.--------------.................---.------------
ENSGGOP00000020096  ...........................GKG.FVKADVIKEKLMTQ.................ADR.FSEEEVK-----
ENSGGOP00000000796  ...........................KDG.KLSNNEWCYCFQK-.................---.------------
ENSGGOP00000004196  ...........................---.--------------.................---.------------
ENSGGOP00000002530  ...........................GNG.TVMGAELRHVLATL.................GER.LTEDEVEKLMAG
ENSGGOP00000015006  ...........................GDG.FISKEEMFHMLKNSllkqp............SEE.DPDEGIKDLVE-
ENSGGOP00000016611  ...........................GKG.TIKKKFLEELLTTQ.................CDR.FSQEEIKNMWAA
ENSGGOP00000004209  ...........................RDG.KISRHEMLQVLRLMv................GVQ.VTEEQLENIAD-
ENSGGOP00000011570  ...........................GQ-.KLTLLEFLDFLREKqk...............ERD.CTSELALELIDR
ENSGGOP00000006906  ...........................QDG.HIDVSEIQQSFRAL.................GIS.ISLEQAE-----
ENSGGOP00000024832  ...........................QDG.HIDVSEIQQSFRAL.................GIS.ISLEQAE-----
ENSGGOP00000019567  ...........................SNG.TVMGAELRHVLATL.................GEK.MTEAEVEQLLAG
ENSGGOP00000009496  ...........................SNG.TVMGAELRHVLATL.................GEK.MTEAEVEQLLAG
ENSGGOP00000012555  ...........................---.--------------.................---.------------
ENSGGOP00000006153  ...........................GDG.VVTVDDLRGVYSGRahpkvrs..........GEW.TEDQVLRRFLDN
ENSGGOP00000008018  ...........................---.--------------.................---.------------
ENSGGOP00000007513  ...........................---.--------------.................---.------------
ENSGGOP00000024452  ...........................---.--------------.................---.------------
ENSGGOP00000005045  ...........................EDG.YITEEEFSTILQASl................G--.VPDLDVSGLFKE
ENSGGOP00000017287  ...........................GKG.FVKADVIKEKLMTQ.................ADR.FSEEEVK-----
ENSGGOP00000004706  ...........................DDG.TLNREDLSRLVNCLtgege............DTR.LSASEMKQLID-
ENSGGOP00000022428  ...........................---.-MVYGRYDQFLREVlklptav..........FEG.PSFGYTEQSARS
ENSGGOP00000017119  ...........................---.-MVYGRYDQFLREVlklptav..........FEG.PSFGYTEQSARS
ENSGGOP00000003545  ...........................---.-MVYGRYDQFLREVlklptav..........FEG.PSFGYTEQSARS
ENSGGOP00000004257  ...........................NDD.YICAWDLEQTVTKLt................RGE.LSAEEVSLVCE-
ENSGGOP00000024127  ...........................---.--------------.................---.------------
ENSGGOP00000012291  ...........................---.--------------.................---.------------
ENSGGOP00000004812  ...........................GKG.VVNKDEFKQLLLTQ.................ADK.FSPAEVE-----
ENSGGOP00000012046  ...........................GNG.LISKDEFIRMLRSFieis.............NNC.LSKAQLAEVVE-
ENSGGOP00000015625  ...........................---.--------------.................---.------------
ENSGGOP00000008889  ...........................---.--------------.................---.------------
ENSGGOP00000008482  ...........................---.--------------.................---.------------
ENSGGOP00000013349  ...........................NDG.RIDAQEIMQSLRDL.................GVK.ISEQQAEKILKR
ENSGGOP00000011422  ...........................ENG.FLSKDEFFTMMRSFieis.............NNC.LSKAQLAEVVE-
ENSGGOP00000018846  ...........................NDG.RIDAQEIMQSLRDL.................GVK.ISEQQAE-----
ENSGGOP00000003216  ...........................GNG.KVMGAELRHVLTTL.................GE-.------------
ENSGGOP00000021719  ...........................GSG.YLNWEQLHAAMREA.................GIM.LSDDVCQLMLIC
ENSGGOP00000005693  ...........................RDG.KMDKEETKDWILPS.................DYD.HAEAEAR-----
ENSGGOP00000010676  ...........................TDN.FICKEDLELTLARLt................KSE.LDEEEVVLVCD-
ENSGGOP00000007432  ...........................---.--------------.................---.------------
ENSGGOP00000018435  ...........................GDL.TATREEFTAFLHPEe................FEH.MKEIVVL-----
ENSGGOP00000006035  ...........................---.--------------.................---.------------
ENSGGOP00000025507  ...........................---.--------------.................---.------------
ENSGGOP00000006035  ...........................---.--------------.................---.------------
ENSGGOP00000025507  ...........................---.--------------.................---.------------
ENSGGOP00000003343  ...........................HSG.LISMEEFRAMWKLFsshy.............NVL.IDDSQVN-----
ENSGGOP00000020870  ...........................GSG.YLNWEQLHAAMREA.................GIM.LSDDVCQLMLIC
ENSGGOP00000002976  ...........................GSG.YLNWEQLHAAMREA.................GIM.LSDDVCQLMLIC
ENSGGOP00000024041  cawqgasagtewgagagphwassplgtGSG.SIDPDELRTVLQSClres.............AIS.LPDEKLDQLTL-
ENSGGOP00000009817  cawqgasagtewgagagphwassplgtGSG.SIDPDELRTVLQSClres.............AIS.LPDEKLDQLTL-
ENSGGOP00000011240  ...........................RDG.VLSRVELRDMVVAL.................LEV.WKDNRTDDIPEL
ENSGGOP00000008587  ...........................KDG.HLDGSEVGHWVLPP.................AQD.QPLVEAN-----
ENSGGOP00000007432  ...........................---.--------------.................---.------------
ENSGGOP00000013302  ...........................---.--------------.................---.------------
ENSGGOP00000024313  ...........................---.--------------.................---.------------
ENSGGOP00000000552  ...........................HDL.YISQADLSRYNDQA.................---.SSSRIIERIFSG
ENSGGOP00000002697  ...........................SDG.RITLEEYRNVVEELlsgnphiekesarsiadGAM.MEAASVCMGQME
ENSGGOP00000016489  ...........................---.--------------.................---.------------
ENSGGOP00000028006  ...........................NDG.RLDPQELLPWVVPN.................NQG.IAQEEAL-----
ENSGGOP00000023206  ...........................NDG.RLDPQELLPWVVPN.................NQG.IAQEEAL-----
ENSGGOP00000006503  ...........................---.--------------.................---.------------
ENSGGOP00000006509  ...........................---.--------------.................---.------------
ENSGGOP00000021892  ...........................---.--------------.................---.------------
ENSGGOP00000004839  ...........................HSG.FIETEELKNFLKDL.................LEK.ANKTVDDTKLAE
ENSGGOP00000019168  ...........................---.--------------.................---.------------
ENSGGOP00000003722  ...........................K--.-LTVDELKRLLYDTf................CEH.LSMKDIE-----
ENSGGOP00000007472  ...........................GKP.YVTKEELYQNLTRE.................---.----Q-------
ENSGGOP00000027338  ...........................---.--------------.................---.------------
ENSGGOP00000007156  ...........................KDE.KISRDELLQVLRMMv................GVN.ISDEQLGSIAD-
ENSGGOP00000024526  ...........................---.--------------.................---.------------
ENSGGOP00000028098  ...........................---.--------------.................---.------------
ENSGGOP00000007082  ...........................---.--------------.................---.------------
ENSGGOP00000023859  ...........................---.--------------.................---.------------
ENSGGOP00000019080  ...........................---.--------------.................---.------------
ENSGGOP00000010449  ...........................ENG.FIDEEDLQRIILRLln...............SDD.MSEDLLMDLTN-
ENSGGOP00000000844  ...........................---.--------------.................---.------------
ENSGGOP00000023819  ...........................---.--------------.................---.------------
ENSGGOP00000006595  ...........................---.--------------.................---.------------
ENSGGOP00000006390  ...........................HDG.IVTAEELESYMDPM.................NEY.NALNEAK-----
ENSGGOP00000015096  ...........................GTG.LLSVADFRTVLRQY.................SIN.LSEEEFF-----
ENSGGOP00000019080  ...........................---.--------------.................---.------------
ENSGGOP00000002308  ...........................---.--------------.................---.------------
ENSGGOP00000023711  ...........................---.--------------.................---.------------
ENSGGOP00000000733  ...........................KTG.ALEGPEVDGFVKDM.................MEL.VQPSISG-----
ENSGGOP00000023859  ...........................---.--------------.................---.------------
ENSGGOP00000028529  ...........................---.--------------.................---.------------
ENSGGOP00000015096  ...........................KTG.LVRPQELRRVLETF.................CLK.LRDEEYEKFSKH
ENSGGOP00000002979  ...........................---.--------------.................---.------------
ENSGGOP00000000348  ...........................---.--------------.................---.------------
ENSGGOP00000012168  ...........................DDG.CILHTDLYKFLTKR.................GEK.MTREEVN-----
ENSGGOP00000021101  ...........................---.--------------.................---.------------
ENSGGOP00000024236  ...........................---.--------------.................---.------------
ENSGGOP00000005783  ...........................DKN.FITAEELRREL---.................---.------------
ENSGGOP00000011525  ...........................---.--------------.................---.------------
ENSGGOP00000011629  ...........................DKP.YILAEELRRE----.................---.------------
ENSGGOP00000009256  ...........................---.--------------.................---.------------
ENSGGOP00000022443  ...........................HDL.LIDADDLARHNDHAis...............TKM.IDRIFSGAVTRG
ENSGGOP00000013081  ...........................HDL.LIDADDLARHNDHAis...............TKM.IDRIFSGAVTRG
ENSGGOP00000006507  ...........................RDC.ALSPDELKDLFKVFpyipw............GPD.VNNTVCT-----
ENSGGOP00000026277  ...........................RDC.ALSPDELKDLFKVFpyipw............GPD.VNNTVCT-----
ENSGGOP00000026775  ...........................---.--------------.................---.------------
ENSGGOP00000015605  ...........................DKN.YITPEELRREL---.................---.------------
ENSGGOP00000013437  ...........................GNG.FLDSSELENIISQMmhvae............YLE.WDVTELNPILH-
ENSGGOP00000015096  ...........................KTN.TISREEFRAICNRH.................VQI.LTDEQFD-----
ENSGGOP00000015264  ...........................EDG.SVGEGDLSCILKTAl................G--.VAELTVT-----
ENSGGOP00000019492  ...........................SPG.VLLSSDLWKAIENTdflr.............GIF.ISRELLHLVTLR
ENSGGOP00000015242  ...........................SPG.VLLSSDLWKAIENTdflr.............GIF.ISRELLHLVTLR
ENSGGOP00000015096  ...........................GNG.ILRRRDIKNALYSF.................DIA.LTPREFEKLWA-
ENSGGOP00000011088  ...........................GDL.RIGAKNFEMYRFLF.................N--.IQKQELK-----
ENSGGOP00000020157  ...........................---.--------------.................---.------------
ENSGGOP00000025587  ...........................---.--------------.................---.------------
ENSGGOP00000002805  ...........................---.--------------.................---.------------
ENSGGOP00000013256  ...........................---.--SKEEIAEILCNI.................GVK.LSDEEFE-----
ENSGGOP00000023524  ...........................---.--SKEEIAEILCNI.................GVK.LSDEEFE-----
ENSGGOP00000013295  ...........................KSG.SVPIINIRK-----.................---.------------
ENSGGOP00000018258  ...........................KSG.SVPIINIRK-----.................---.------------
ENSGGOP00000005688  ...........................GKG.EVTFEDVKQVFGQTti...............HQH.IPFNWDSEFVQL
ENSGGOP00000007088  ...........................---.--------------.................---.------------
ENSGGOP00000004418  ...........................---.--------------.................---.------------
ENSGGOP00000004827  ...........................YRG.FLTLEDFKKAFRQV.................APK.LPERTVL-----
ENSGGOP00000023450  ...........................KTG.MMDTDDFRACLISM.................GYN.MGEAEFA-----
ENSGGOP00000007087  ...........................---.--------------.................---.------------
ENSGGOP00000020253  ...........................---.--------------.................---.------------
ENSGGOP00000027573  ...........................---.--------------.................---.------------
ENSGGOP00000021162  ...........................HSG.LISMEEFRAMWKLFsshy.............NVL.IDDSQVN-----
ENSGGOP00000016495  ...........................---.--------------.................---.------------
ENSGGOP00000005787  ...........................SDG.FLDEQELEALFTKElekvydpk.........N--.------E-----
ENSGGOP00000020487  ...........................---.--------------.................---.------------
ENSGGOP00000016148  ...........................---.--------------.................---.------------
ENSGGOP00000015096  ...........................PNG.PITREEFRYILNCV.................AVK.LSNSEFK-----
ENSGGOP00000012603  ...........................ENG.LLDQAEMDCIVNQMlhiaq............YLE.WDPTELRPILK-
ENSGGOP00000015201  ...........................---.--------------.................---.------------
ENSGGOP00000024915  ...........................---.--------------.................---.------------
ENSGGOP00000023450  ...........................---.--------------.................---.------------
ENSGGOP00000001678  ...........................---.--------------.................---.------------
ENSGGOP00000024627  ...........................---.--------------.................---.------------
ENSGGOP00000018908  ...........................---.--------------.................---.------------
ENSGGOP00000025434  ...........................---.--------------.................---.------------
ENSGGOP00000006199  ...........................---.--------------.................---.------------
ENSGGOP00000019261  ...........................---.--------------.................---.------------
ENSGGOP00000005693  ...........................---.--------------.................---.------------
ENSGGOP00000001807  ...........................---.--------------.................---.------------
ENSGGOP00000024313  ...........................---.--------------.................---.------------
ENSGGOP00000019354  ...........................---.--------------.................---.------------
ENSGGOP00000018853  ...........................---.--------------.................---.------------
ENSGGOP00000008614  ...........................---.--------------.................---.------------
ENSGGOP00000024313  ...........................---.--------------.................---.------------
ENSGGOP00000000552  ...........................WSG.KITSTEIR------.................---.------------
ENSGGOP00000004747  ...........................---.--------------.................--K.LQHDVLKLEFER
ENSGGOP00000013302  ...........................---.--------------.................---.------------
ENSGGOP00000020941  ...........................---.--------------.................---.------------
ENSGGOP00000000504  ...........................GKS.YITKEDMKQALTPE.................Q--.--VSFCATHMQQ
ENSGGOP00000024502  ...........................GKS.YITKEDMKQALTPE.................Q--.--VSFCATHMQQ
ENSGGOP00000011848  ...........................GAL.TATREEFTAFLHTEe................FEH.MKEIVVL-----
ENSGGOP00000024360  ...........................KDK.NVDYEDLNTCLQNF.................GIY.LSKPEFKKITEL
ENSGGOP00000000733  ...........................SSG.FISAAELRNFLRDL.................FLH.HKKAISE-----
ENSGGOP00000024360  ...........................DNG.KIGIPDLEHALKCL.................NVN.LTEEDFG-----
ENSGGOP00000021249  ...........................---.--------------.................---.------------
ENSGGOP00000019415  ...........................---.--------------.................---.------------
ENSGGOP00000013501  ...........................RDG.ALSPVELQSLFSVF.................---.------------
ENSGGOP00000021515  ...........................RDG.HLNRKKLVSICEQY.................GLQ.NVDGEMLEEVFH
ENSGGOP00000005854  ...........................RDG.HLNRKKLVSICEQY.................GLQ.NVDGEMLEEVFH
ENSGGOP00000016618  ...........................GSG.YIDEHELDALLKD-.................---.------------
ENSGGOP00000024091  ...........................---.--------------.................---.------------
ENSGGOP00000013700  ...........................RNG.ILDSSEVDKIILQMmrvae............YLD.WDVSELRPILQ-
ENSGGOP00000008485  ...........................---.--------------.................---.------------
ENSGGOP00000011966  ...........................GNN.LLDGLELSTAITHVhkeegseq.........APL.MSEDELINIID-
ENSGGOP00000023645  ...........................ASG.YVDRDMFFKICESL.................NVP.VDDSLVKELIRM
ENSGGOP00000028176  ...........................KKN.VLPTKDIRRLCKSS.................RLP.LSDDLLESLLSS
ENSGGOP00000004508  ...........................ASR.SIGQDEFKRAVYVAt................GLK.FSPHLVN-----
ENSGGOP00000018206  ...........................ASR.SIGQDEFKRAVYVAt................GLK.FSPHLVN-----
ENSGGOP00000006739  ...........................---.--------------.................---.------------
ENSGGOP00000023979  ...........................---.--------------.................---.------------
ENSGGOP00000012342  ...........................KKN.VLPTKDIRRLCKSS.................RLP.LSDDLLESLLSR
ENSGGOP00000023206  ...........................SGP.GLSLEEFI------.................---.------------
ENSGGOP00000001608  ...........................---.--------------.................---.------------
ENSGGOP00000010042  ...........................---.--------------.................---.------------
ENSGGOP00000028006  ...........................---.--------------.................---.LKDK--------
ENSGGOP00000025507  ...........................---.--------------.................---.------------
ENSGGOP00000020583  ...........................---.--------------.................--K.LQHDVLKLEFER
ENSGGOP00000012393  ...........................QDG.CISREEMVSYFL--.................---.------------
ENSGGOP00000016724  ...........................RDG.HLQLREVLAQTRLGn................GWW.MTPESIQ-----
ENSGGOP00000023938  ...........................---.--------------.................---.------------
ENSGGOP00000022364  ...........................---.--------------.................--K.LQHDVLKLEFER
ENSGGOP00000005326  ...........................---.--------------.................---.------------
ENSGGOP00000008587  ...........................---.--------------.................---.------------
ENSGGOP00000002982  ...........................---.--------------.................---.------------
ENSGGOP00000006523  ...........................---.--------------.................---.------------
ENSGGOP00000014183  ...........................---.--------------.................---.------------
ENSGGOP00000018435  ...........................KDG.KLDKDEIRHWILPQ.................DYD.HAQAEAR-----
ENSGGOP00000021184  ...........................SDC.LINFKEFSSAIDIMyn...............G--.------------
ENSGGOP00000015096  ...........................PNG.KINVRDFKKVLEDT.................GMP.MDDDQYALLTTK
ENSGGOP00000024360  ...........................KGG.RVSTDDVFAVLDSM.................GIP.INREILEEVTKH
ENSGGOP00000027849  ...........................---.--------------.................---.------------
ENSGGOP00000022443  ...........................WSG.RITCAELRR-----.................---.------------
ENSGGOP00000013081  ...........................WSG.RITCAELRR-----.................---.------------
ENSGGOP00000022610  ...........................GSG.YIDEHELDALLKDL.................YEK.NK----------
ENSGGOP00000010606  ...........................---.--------------.................---.------------
ENSGGOP00000026802  ...........................---.--------------.................---.------------
ENSGGOP00000011774  ...........................---.--------------.................---.------------
ENSGGOP00000002441  ...........................---.--------------.................---.------------
ENSGGOP00000002021  ...........................REG.LISRDEITAYFM--.................---.------------
ENSGGOP00000009877  ...........................QDG.KITVDELK------.................---.------------
ENSGGOP00000016754  ...........................---.--------------.................---.------------
ENSGGOP00000007308  ...........................GDG.KVTAEEFK------.................---.------------
ENSGGOP00000012932  ...........................GQR.KLHYKEFRRFMENL.................---.-QTEIQEMEFLQ
ENSGGOP00000012554  ...........................---.--------------.................---.------------
ENSGGOP00000011621  ...........................FSG.CLPPPKVRAICGKH.................GLY.LTLSLLETLLNH
ENSGGOP00000024380  ...........................---.--------DFLVNCq................GEH.CTYDEILSIIQK
ENSGGOP00000000011  ...........................NTN.NLDTEELCEYFSQH.................---.------------
ENSGGOP00000007649  ...........................---.--------DFLVNCq................GEH.CTYDEILSIIQK
ENSGGOP00000006035  ...........................---.--------------.................---.------------
ENSGGOP00000011720  ...........................---.--------------.................---.------------
ENSGGOP00000002269  ...........................---.--------------.................---.------------
ENSGGOP00000018132  ...........................---.--------------.................---.------------
ENSGGOP00000017534  ...........................---.--------------.................---.------------
ENSGGOP00000004508  ...........................GNE.MVDKKEFLVLQEIFrkknekretk.......GDE.EKRAMLRLQLYG
ENSGGOP00000018206  ...........................GNE.MVDKKEFLVLQEIFrkknekretk.......GDE.EKRAMLRLQLYG
ENSGGOP00000016496  ...........................---.--------------.................---.------------
ENSGGOP00000012932  ...........................GNE.MIEKREFFKLQKIIskqddlmtvkt......N--.------------
ENSGGOP00000004839  ...........................GNG.YIDENELDALLKDL.................CEK.------------
ENSGGOP00000008738  ...........................KSG.MISGLDFSDIMVTIr................SHM.LTPFVEENLV--
ENSGGOP00000028586  ...........................---.--------------.................---.------------
ENSGGOP00000011240  ...........................SGN.YIIREEMERMLHVV.................DGK.VPDTL-----RK
ENSGGOP00000007686  ...........................---.--------------.................---.------------
ENSGGOP00000000151  ...........................---.--------------.................---.------------
ENSGGOP00000006499  ...........................---.FISLDEFRQTWKLF.................SSH.MNIDITDDCIC-
ENSGGOP00000023045  ...........................SDC.LINFKEFSSAIDIM.................---.------------
ENSGGOP00000020565  ...........................---.FISLDEFRQTWKLF.................SSH.MNIDITDDCIC-
ENSGGOP00000012340  ...........................---.--------------.................---.------------
ENSGGOP00000023745  ...........................---.--------------.................---.------------
ENSGGOP00000008325  ...........................---.--------------.................---.------------
ENSGGOP00000022444  ...........................GDQ.ELTEHE--------.................---.------------
ENSGGOP00000024026  ...........................KSG.MISGLDFSDIMVTIr................SHM.LTPFVEENLVS-
ENSGGOP00000003268  ...........................GDQ.ELTEHE--------.................---.------------
ENSGGOP00000012291  ...........................---.--------------.................---.------------
ENSGGOP00000020860  ...........................---.--------------.................---.------------
ENSGGOP00000004747  ...........................---.SLDKVTMQQVARTVa................KVE.LSDHVCD-----
ENSGGOP00000016725  ...........................---.--------------.................---.------------
ENSGGOP00000027884  ...........................---.--------------.................---.------------
ENSGGOP00000008864  ...........................---.--------------.................---.------------
ENSGGOP00000024021  ...........................---.--------------.................---.------------
ENSGGOP00000002559  ...........................---.--------------.................---.------------
ENSGGOP00000008975  ...........................---.--------------.................---.------------
ENSGGOP00000015810  ...........................---.--------------.................---.------------
ENSGGOP00000022677  ...........................---.--------------.................---.------------
ENSGGOP00000001056  ...........................---.--------------.................---.------------
ENSGGOP00000024407  ...........................---.--------------.................---.------------
ENSGGOP00000008333  ...........................GKK.AIRREDFLRLLVTK.................GEH.MTEEEMLD----
ENSGGOP00000005688  ...........................KDV.EVTKEEFVLAAQKF.................G-Q.VTPMEV------
ENSGGOP00000027880  ...........................GKK.AIRREDFLRLLVTK.................GEH.MTEEEMLD----
ENSGGOP00000015096  ...........................KTN.YISICKMQEVLEEC.................GCS.FTEEELTHLLNR
ENSGGOP00000022419  ...........................-DG.VLSPGELQELFSGI.................DGH.LTDNLETE----
ENSGGOP00000003523  ...........................-DG.VLSPGELQELFSGI.................DGH.LTDNLETE----
ENSGGOP00000007901  ...........................---.--------------.................---.------------
ENSGGOP00000008530  ...........................---.--------------.................---.------------
ENSGGOP00000007957  ...........................NNG.KVTREDITSLLHTI.................YEV.V-----------
ENSGGOP00000010635  ...........................DNG.FIPDSLLEDVMKAL.................DLV.SDPEYIN-----
ENSGGOP00000004392  ...........................---.-----------HTI.................Y--.------------
ENSGGOP00000010370  ...........................GRG.TISFVQYKEALKTL.................GLS.TEDEDLQ-----
ENSGGOP00000022364  ...........................---.--------------.................---.------------
ENSGGOP00000015625  ...........................---.--------------.................---.------------
ENSGGOP00000007654  ...........................---.--------------.................---.------------
ENSGGOP00000020583  ...........................---.--------------.................---.------------
ENSGGOP00000013302  ...........................---.--------------.................---.------------
ENSGGOP00000010930  ...........................GNG.HLSSSELAQHVLKKqdldedllgcsp.....G--.------------
ENSGGOP00000005349  ...........................MDQ.LIEFKAFVSCLDIM.................---.------------
ENSGGOP00000008253  ...........................---.--------------.................---.------------
ENSGGOP00000001993  ...........................GDG.TVDAENMLEALKNSs................GAN.LQGELSH-----
ENSGGOP00000024222  ...........................---.--------------.................---.------------
ENSGGOP00000002875  ...........................---.--------------.................---.------------
ENSGGOP00000012369  ...........................GDG.RYSFLELRAAL---.................---.------------
ENSGGOP00000011933  ...........................HNG.MLSKEELSRYGTAT.................---.MTNVFLD-----
ENSGGOP00000011848  ...........................KDR.KLDKDEIRHWILSQ.................DYD.H-----------
ENSGGOP00000018329  ...........................---.--------------.................---.------------
ENSGGOP00000000391  ...........................---.--------------.................---.------------
ENSGGOP00000013508  ...........................NTG.FIGADTFAGLVHSH.................ELP.LDPAKLDMLVAL
ENSGGOP00000022560  ...........................NTG.FIGADTFAGLVHSH.................ELP.LDPAKLDMLVAL
ENSGGOP00000019614  ...........................---.--------------.................---.------------
ENSGGOP00000015110  ...........................---.--------------.................---.------------
ENSGGOP00000008437  ...........................---.--------------.................---.------------
ENSGGOP00000016998  ...........................---.--------------.................---.------------
ENSGGOP00000024026  ...........................---.------------II.................HHH.IPFNWDCEFIRL
ENSGGOP00000017722  ...........................ENQ.RITREEFIAAIKAV.................GVP.LKNQEVEDIVIY
ENSGGOP00000017757  ...........................HCG.YLLEKDLEEILYTL.................GLH.LSRAQVKKLL--
ENSGGOP00000002740  ...........................HCG.YLLEKDLEEILYTL.................GLH.LSRAQVKKLL--
ENSGGOP00000012168  ...........................GNG.LLSLEEYNFFELRTs................GEK.CDEDAWAVCREN
ENSGGOP00000001815  ...........................GNR.ILDEKE--------.................---.------------
ENSGGOP00000020483  ...........................GNR.ILDEKE--------.................---.------------
ENSGGOP00000020927  ...........................GNR.ILDEKE--------.................---.------------
ENSGGOP00000002387  ...........................WCG.YLHRRDLERILLTL.................GIR.LSAEQAKQLVS-
ENSGGOP00000006515  ...........................---.--------------.................---.------------
ENSGGOP00000008725  ...........................---.--------------.................---.------------
ENSGGOP00000018073  ...........................---.--------------.................---.------------
ENSGGOP00000015740  ...........................---.--------------.................---.------------


                                  140           150                                                 
                                    |             |                                                 
d1kful1               FA......DD....QLI....IDFDNFVRCLV..............................................
ENSGGOP00000000209  --......--....---....-----------..............................................
ENSGGOP00000022972  --......--....---....-----------..............................................
ENSGGOP00000021376  --......--....---....-----------..............................................
ENSGGOP00000009800  --......--....---....-----------..............................................
ENSGGOP00000011095  --......--....---....-----------..............................................
ENSGGOP00000003638  YS......DE....SGN....MDFDNFISCLV..............................................
ENSGGOP00000025293  YS......DE....SGN....MDFDNFISCLV..............................................
ENSGGOP00000002483  --......--....---....-----------..............................................
ENSGGOP00000028220  --......--....---....-----------..............................................
ENSGGOP00000017724  --......--....---....-----------..............................................
ENSGGOP00000006566  --......--....---....-----------..............................................
ENSGGOP00000019618  --......--....---....-----------..............................................
ENSGGOP00000008245  --......--....---....-----------..............................................
ENSGGOP00000025102  GL......TP....EQR....VD---------..............................................
ENSGGOP00000010426  YEp.....NNslarKGQ....ISVDGFMRYLS..............................................
ENSGGOP00000015754  --......--....---....-----------..............................................
ENSGGOP00000012299  YA......DK....HMN....IDFDSFICCFV..............................................
ENSGGOP00000021175  --......--....---....-----------..............................................
ENSGGOP00000019593  YA......DK....HMN....IDFDSFICCFV..............................................
ENSGGOP00000006396  --......--....---....-----------..............................................
ENSGGOP00000022632  --......--....---....-----------..............................................
ENSGGOP00000011943  --......--....---....-----------..............................................
ENSGGOP00000008286  --......--....---....-----------..............................................
ENSGGOP00000015051  --......--....---....-----------..............................................
ENSGGOP00000024872  --......--....---....-----------..............................................
ENSGGOP00000011390  --......--....---....-----------..............................................
ENSGGOP00000008090  GL......TP....EQR....VD---------..............................................
ENSGGOP00000006979  --......--....---....-----------..............................................
ENSGGOP00000014947  --......--....---....-----------..............................................
ENSGGOP00000000749  --......--....---....-----------..............................................
ENSGGOP00000022235  --......--....---....-----------..............................................
ENSGGOP00000004772  --......--....---....-----------..............................................
ENSGGOP00000001305  --......--....---....-----------..............................................
ENSGGOP00000009619  AP......--....---....-----------..............................................
ENSGGOP00000027707  --......--....---....-----------..............................................
ENSGGOP00000013700  --......--....---....-----------..............................................
ENSGGOP00000026634  --......--....---....-----------..............................................
ENSGGOP00000027354  --......--....---....-----------..............................................
ENSGGOP00000007591  YS......EP....DLA....VDFDNFVCCLV..............................................
ENSGGOP00000024754  YS......EP....DLA....VDFDNFVCCLV..............................................
ENSGGOP00000000341  --......--....---....-----------..............................................
ENSGGOP00000006559  --......--....---....-----------..............................................
ENSGGOP00000001194  --......--....---....-----------..............................................
ENSGGOP00000020610  YEpseta.KA....QRQ....MTKDGFLMYL-..............................................
ENSGGOP00000003736  YEpseta.KA....QRQ....MTKDGFLMYL-..............................................
ENSGGOP00000004196  --......--....---....-----------..............................................
ENSGGOP00000015532  --......--....---....-----------..............................................
ENSGGOP00000000785  YS......-T....NGK....ITFDDYIACCV..............................................
ENSGGOP00000014368  YElneta.KQ....HEL....MTLDGFMMYLL..............................................
ENSGGOP00000023413  --......--....---....-----------..............................................
ENSGGOP00000007126  --......--....---....-----------..............................................
ENSGGOP00000008349  EN......TP....EKR....AE---------..............................................
ENSGGOP00000011020  YEptpaa.KQ....HEL....MTLDGFMMYLL..............................................
ENSGGOP00000015507  YCpr....SA....NPA....MQLDRFIQVCT..............................................
ENSGGOP00000012471  --......--....--T....MTAEEFTD---..............................................
ENSGGOP00000012549  YA......DE....ELQ....LDFDDFLNCLV..............................................
ENSGGOP00000019099  YA......DD....DLI....IDFDSFISCFL..............................................
ENSGGOP00000003031  YA......DD....DLI....IDFDSFISCFL..............................................
ENSGGOP00000005101  --......--....---....-----------..............................................
ENSGGOP00000024511  INp.....CS....DST....MTAEEFTD---..............................................
ENSGGOP00000018250  --......--....---....-----------..............................................
ENSGGOP00000003074  --......--....---....-----------..............................................
ENSGGOP00000012477  INp.....CS....DST....MTAEEFTD---..............................................
ENSGGOP00000010001  FEpcpen.KS....KGL....LGIDGFTNYT-..............................................
ENSGGOP00000020622  FEpcpen.KS....KGL....LGIDGFTNYT-..............................................
ENSGGOP00000010490  --......--....---....-----------..............................................
ENSGGOP00000015637  YEpskeg.RE....KGC....LSIDGFTNYLM..............................................
ENSGGOP00000011144  --......--....---....-----------..............................................
ENSGGOP00000026982  --......--....---....-----------..............................................
ENSGGOP00000003975  --......--....---....-----------..............................................
ENSGGOP00000004885  YEpieev.RK....AHQ....MSLEGFTRYMD..............................................
ENSGGOP00000014678  YS......-K....NGR....IFFDDYVACCV..............................................
ENSGGOP00000013437  --......--....---....-----------..............................................
ENSGGOP00000011390  --......--....---....-----------..............................................
ENSGGOP00000010036  --......--....---....-----------..............................................
ENSGGOP00000027819  --......--....---....-----------..............................................
ENSGGOP00000012841  --......--....---....-----------..............................................
ENSGGOP00000009918  --......--....---....-----------..............................................
ENSGGOP00000012485  --......--....---....-----------..............................................
ENSGGOP00000009782  --......--....---....-----------..............................................
ENSGGOP00000009375  --......--....---....-----------..............................................
ENSGGOP00000023560  --......--....---....-----------..............................................
ENSGGOP00000014947  --......--....---....-----------..............................................
ENSGGOP00000012603  --......--....---....-----------..............................................
ENSGGOP00000017349  --......--....---....-----------..............................................
ENSGGOP00000003738  --......--....---....-----------..............................................
ENSGGOP00000007513  --......--....THQ....ISVEQSISLLL..............................................
ENSGGOP00000022235  --......--....---....-----------..............................................
ENSGGOP00000001928  YElseeg.RQ....KGF....LAIDGFTQYLL..............................................
ENSGGOP00000013652  FA......DD....QLI....INFDNFVRCLV..............................................
ENSGGOP00000006109  QAl.....NG....QQT....LSPEEFIN---..............................................
ENSGGOP00000003219  HE......DS....NGC....INYEAFVRHI-..............................................
ENSGGOP00000022428  --......--....---....-----------..............................................
ENSGGOP00000017119  --......--....---....-----------..............................................
ENSGGOP00000003545  --......--....---....-----------..............................................
ENSGGOP00000023406  QE......DS....NGC....INYEAFVKHIM..............................................
ENSGGOP00000007856  FA......DD....QLI....INFDNFVRCLV..............................................
ENSGGOP00000011697  QE......DS....NGC....INYEAFVKHIM..............................................
ENSGGOP00000018636  --......--....---....-----------..............................................
ENSGGOP00000017641  HE......DS....NGC....INYEAFVRHI-..............................................
ENSGGOP00000013074  --......--....---....-----------..............................................
ENSGGOP00000007661  --......--....---....-----------..............................................
ENSGGOP00000020763  FDspy...DK....DGL....VTPEEFMNYYA..............................................
ENSGGOP00000005624  --......--....---....-----------..............................................
ENSGGOP00000025395  --......--....---....-----------..............................................
ENSGGOP00000019250  --......--....---....-----------..............................................
ENSGGOP00000020096  --......--....---....-----------..............................................
ENSGGOP00000000796  --......--....---....-----------..............................................
ENSGGOP00000004196  --......--....---....-----------..............................................
ENSGGOP00000002530  QE......DS....NGC....INYEAFVKHIM..............................................
ENSGGOP00000015006  --......--....---....-----------..............................................
ENSGGOP00000016611  FPp.....DV....GGN....VDYKNICYV--..............................................
ENSGGOP00000004209  --......--....---....-----------..............................................
ENSGGOP00000011570  YEp.....SD....SGKlrhvLSMDGFLSYLC..............................................
ENSGGOP00000006906  --......--....---....-----------..............................................
ENSGGOP00000024832  --......--....---....-----------..............................................
ENSGGOP00000019567  QE......DA....NGC....INYEAFVKHIM..............................................
ENSGGOP00000009496  QE......DA....NGC....INYEAFVKHIM..............................................
ENSGGOP00000012555  --......--....---....-----------..............................................
ENSGGOP00000006153  FDss....EK....DGQ....VTLAEFQDYYS..............................................
ENSGGOP00000008018  --......--....---....-----------..............................................
ENSGGOP00000007513  --......--....---....-----------..............................................
ENSGGOP00000024452  --......--....---....-----------..............................................
ENSGGOP00000005045  IA......Q-....GDS....ISYEEFKSFAL..............................................
ENSGGOP00000017287  --......--....---....-----------..............................................
ENSGGOP00000004706  --......--....---....-----------..............................................
ENSGGOP00000022428  CF......SQ....QKK....VTLNGFLD---..............................................
ENSGGOP00000017119  CF......SQ....QKK....VTLNGFLD---..............................................
ENSGGOP00000003545  CF......SQ....QKK....VTLNGFLD---..............................................
ENSGGOP00000004257  --......--....---....-----------..............................................
ENSGGOP00000024127  --......--....---....-----------..............................................
ENSGGOP00000012291  --......--....---....-----------..............................................
ENSGGOP00000004812  --......--....---....-----------..............................................
ENSGGOP00000012046  --......--....---....-----------..............................................
ENSGGOP00000015625  --......--....---....-----------..............................................
ENSGGOP00000008889  --......--....---....-----------..............................................
ENSGGOP00000008482  --......--....---....-----------..............................................
ENSGGOP00000013349  IR......TG....HFW....-----------..............................................
ENSGGOP00000011422  --......--....---....-----------..............................................
ENSGGOP00000018846  --......--....---....-----------..............................................
ENSGGOP00000003216  --......--....---....-----------..............................................
ENSGGOP00000021719  YG......GP....RLQ....MDFVSFIHLML..............................................
ENSGGOP00000005693  --......--....---....-----------..............................................
ENSGGOP00000010676  --......--....---....-----------..............................................
ENSGGOP00000007432  --......--....---....-----------..............................................
ENSGGOP00000018435  --......--....---....-----------..............................................
ENSGGOP00000006035  --......--....---....-----------..............................................
ENSGGOP00000025507  --......--....---....-----------..............................................
ENSGGOP00000006035  --......--....---....-----------..............................................
ENSGGOP00000025507  --......--....---....-----------..............................................
ENSGGOP00000003343  --......--....---....-----------..............................................
ENSGGOP00000020870  YG......GP....RLQ....MDFVSFIHLML..............................................
ENSGGOP00000002976  YG......GP....RLQ....MDFVSFIHLML..............................................
ENSGGOP00000024041  --......--....---....-----------..............................................
ENSGGOP00000009817  --......--....---....-----------..............................................
ENSGGOP00000011240  HM......DL....SDI....VE---------..............................................
ENSGGOP00000008587  --......--....---....-----------..............................................
ENSGGOP00000007432  --......--....---....-----------..............................................
ENSGGOP00000013302  --......--....---....-----------..............................................
ENSGGOP00000024313  --......--....---....-----------..............................................
ENSGGOP00000000552  AVtrgktiQK....EGR....MSYADFVWFLI..............................................
ENSGGOP00000002697  PD......QV....YEG....ITFEDFLKIWQ..............................................
ENSGGOP00000016489  --......--....---....-----------..............................................
ENSGGOP00000028006  --......--....---....-----------..............................................
ENSGGOP00000023206  --......--....---....-----------..............................................
ENSGGOP00000006503  --......--....---....-----------..............................................
ENSGGOP00000006509  --......--....---....-----------..............................................
ENSGGOP00000021892  --......--....---....-----------..............................................
ENSGGOP00000004839  YT......D-....---....-----------..............................................
ENSGGOP00000019168  --......--....---....-----------..............................................
ENSGGOP00000003722  --......--....---....-----------..............................................
ENSGGOP00000007472  --......--....---....-----------..............................................
ENSGGOP00000027338  --......--....---....-----------..............................................
ENSGGOP00000007156  --......--....---....-----------..............................................
ENSGGOP00000024526  --......--....---....-----------..............................................
ENSGGOP00000028098  --......--....---....-----------..............................................
ENSGGOP00000007082  --......--....---....-----------..............................................
ENSGGOP00000023859  --......--....---....-----------..............................................
ENSGGOP00000019080  --......--....---....-----------..............................................
ENSGGOP00000010449  --......--....---....-----------..............................................
ENSGGOP00000000844  --......--....---....-----------..............................................
ENSGGOP00000023819  --......--....---....-----------..............................................
ENSGGOP00000006595  --......--....---....-----------..............................................
ENSGGOP00000006390  --......--....---....-----------..............................................
ENSGGOP00000015096  --......--....---....-----------..............................................
ENSGGOP00000019080  --......--....---....-----------..............................................
ENSGGOP00000002308  --......--....---....-----------..............................................
ENSGGOP00000023711  --......--....---....-----------..............................................
ENSGGOP00000000733  --......--....---....VDLDKFRE---..............................................
ENSGGOP00000023859  --......--....---....-----------..............................................
ENSGGOP00000028529  --......--....---....-----------..............................................
ENSGGOP00000015096  YNi.....HN....DTA....VDYNVFLKNL-..............................................
ENSGGOP00000002979  --......--....---....-----------..............................................
ENSGGOP00000000348  --......--....---....-----------..............................................
ENSGGOP00000012168  --......--....---....-----------..............................................
ENSGGOP00000021101  --......--....---....-----------..............................................
ENSGGOP00000024236  --......--....---....-----------..............................................
ENSGGOP00000005783  --......--....---....-----------..............................................
ENSGGOP00000011525  --......--....---....-----------..............................................
ENSGGOP00000011629  --......--....---....-----------..............................................
ENSGGOP00000009256  --......--....---....-----------..............................................
ENSGGOP00000022443  RKv.....QK....EGK....ISYAVFVWFLI..............................................
ENSGGOP00000013081  RKv.....QK....EGK....ISYAVFVWFLI..............................................
ENSGGOP00000006507  --......NE....RGW....ITYQGFLSQWT..............................................
ENSGGOP00000026277  --......NE....RGW....ITYQGFLSQWT..............................................
ENSGGOP00000026775  --......--....---....-----------..............................................
ENSGGOP00000015605  --......--....---....-----------..............................................
ENSGGOP00000013437  --......--....---....-----------..............................................
ENSGGOP00000015096  --......--....---....-----------..............................................
ENSGGOP00000015264  --......--....---....-----------..............................................
ENSGGOP00000019492  YS......DS....VGR....VSFPSLVCFLM..............................................
ENSGGOP00000015242  YS......DS....VGR....VSFPSLVCFLM..............................................
ENSGGOP00000015096  --......--....---....-----------..............................................
ENSGGOP00000011088  --......--....---....-----------..............................................
ENSGGOP00000020157  --......--....---....-----------..............................................
ENSGGOP00000025587  --......--....---....-----------..............................................
ENSGGOP00000002805  --......--....---....-----------..............................................
ENSGGOP00000013256  --......--....---....-----------..............................................
ENSGGOP00000023524  --......--....---....-----------..............................................
ENSGGOP00000013295  --......--....---....-----------..............................................
ENSGGOP00000018258  --......--....---....-----------..............................................
ENSGGOP00000005688  HFgk....ER....KRH....LTYAEFTQFLL..............................................
ENSGGOP00000007088  --......--....---....-----------..............................................
ENSGGOP00000004418  --......--....---....-----------..............................................
ENSGGOP00000004827  --......--....---....-----------..............................................
ENSGGOP00000023450  --......--....---....-----------..............................................
ENSGGOP00000007087  --......--....---....-----------..............................................
ENSGGOP00000020253  --......--....---....-----------..............................................
ENSGGOP00000027573  --......--....---....-----------..............................................
ENSGGOP00000021162  --......--....---....-----------..............................................
ENSGGOP00000016495  --......--....---....-----------..............................................
ENSGGOP00000005787  --......-E....DDM....VEMEEE-----..............................................
ENSGGOP00000020487  --......--....---....-----------..............................................
ENSGGOP00000016148  --......--....---....-----------..............................................
ENSGGOP00000015096  --......--....---....-----------..............................................
ENSGGOP00000012603  --......--....---....-----------..............................................
ENSGGOP00000015201  --......--....---....-----------..............................................
ENSGGOP00000024915  --......--....---....-----------..............................................
ENSGGOP00000023450  --......--....---....-----------..............................................
ENSGGOP00000001678  --......--....---....-----------..............................................
ENSGGOP00000024627  --......--....---....-----------..............................................
ENSGGOP00000018908  --......--....---....-----------..............................................
ENSGGOP00000025434  --......--....---....-----------..............................................
ENSGGOP00000006199  --......--....---....-----------..............................................
ENSGGOP00000019261  --......--....---....-----------..............................................
ENSGGOP00000005693  --......--....---....-----------..............................................
ENSGGOP00000001807  --......--....---....-----------..............................................
ENSGGOP00000024313  --......--....---....-----------..............................................
ENSGGOP00000019354  --......--....---....-----------..............................................
ENSGGOP00000018853  --......--....---....-----------..............................................
ENSGGOP00000008614  --......--....---....-----------..............................................
ENSGGOP00000024313  --......--....---....-----------..............................................
ENSGGOP00000000552  --......--....---....-----------..............................................
ENSGGOP00000004747  HD......PV....DGR....ITERQFGGMLLaysgvqskkltamqrqlkkhfkegkgltfqevenfftflknindvd
ENSGGOP00000013302  --......--....---....-----------..............................................
ENSGGOP00000020941  --......--....---....-----------..............................................
ENSGGOP00000000504  YM......--....---....-----------..............................................
ENSGGOP00000024502  YM......--....---....-----------..............................................
ENSGGOP00000011848  --......--....---....-----------..............................................
ENSGGOP00000024360  TEa.....GE....GDE....VQFEEFPK---..............................................
ENSGGOP00000000733  --......--....---....-----------..............................................
ENSGGOP00000024360  --......--....---....-----------..............................................
ENSGGOP00000021249  --......--....---....-----------..............................................
ENSGGOP00000019415  --......--....---....-----------..............................................
ENSGGOP00000013501  --......--....---....-----------..............................................
ENSGGOP00000021515  NL......DP....DGT....MSVEDFFYG--..............................................
ENSGGOP00000005854  NL......DP....DGT....MSVEDFFYG--..............................................
ENSGGOP00000016618  --......--....---....-----------..............................................
ENSGGOP00000024091  --......--....---....-----------..............................................
ENSGGOP00000013700  --......--....---....-----------..............................................
ENSGGOP00000008485  --......--....---....-----------..............................................
ENSGGOP00000011966  --......--....---....-----------..............................................
ENSGGOP00000023645  CS......HG....EGK....INYYNFVRA--..............................................
ENSGGOP00000028176  RFe.....DS....EKQ....IDYKSFFSA--..............................................
ENSGGOP00000004508  --......--....---....-----------..............................................
ENSGGOP00000018206  --......--....---....-----------..............................................
ENSGGOP00000006739  --......--....---....-----------..............................................
ENSGGOP00000023979  --......--....---....-----------..............................................
ENSGGOP00000012342  FE......DS....EKQ....IDYKSFFSA--..............................................
ENSGGOP00000023206  --......--....---....-----------..............................................
ENSGGOP00000001608  --......--....---....-----------..............................................
ENSGGOP00000010042  --......--....---....-----------..............................................
ENSGGOP00000028006  --......--....---....-----------..............................................
ENSGGOP00000025507  --......--....---....-----------..............................................
ENSGGOP00000020583  HD......PV....DGR....ITERQFGGMLLaysgvqskkltamqrqlkkhfkegkgltfqevenfftflknindvd
ENSGGOP00000012393  --......--....---....-----------..............................................
ENSGGOP00000016724  --......--....---....-----------..............................................
ENSGGOP00000023938  --......--....---....-----------..............................................
ENSGGOP00000022364  HD......PV....DGR....ITERQFGGMLLaysgvqskkltamqrqlkkhfkegkgltfqevenfftflknindvd
ENSGGOP00000005326  --......--....---....-----------..............................................
ENSGGOP00000008587  --......--....---....-----------..............................................
ENSGGOP00000002982  --......--....---....-----------..............................................
ENSGGOP00000006523  --......--....---....-----------..............................................
ENSGGOP00000014183  --......--....---....-----------..............................................
ENSGGOP00000018435  --......--....---....-----------..............................................
ENSGGOP00000021184  --......--....---....-----------..............................................
ENSGGOP00000015096  --......--....---....-----------..............................................
ENSGGOP00000024360  TYi.....DS....NHM....VDIGDIIF---..............................................
ENSGGOP00000027849  --......--....---....-----------..............................................
ENSGGOP00000022443  --......--....---....-----------..............................................
ENSGGOP00000013081  --......--....---....-----------..............................................
ENSGGOP00000022610  --......--....---....-----------..............................................
ENSGGOP00000010606  --......--....---....-----------..............................................
ENSGGOP00000026802  --......--....---....-----------..............................................
ENSGGOP00000011774  --......--....---....-----------..............................................
ENSGGOP00000002441  --......--....---....-----------..............................................
ENSGGOP00000002021  --......--....---....-----------..............................................
ENSGGOP00000009877  --......--....---....-----------..............................................
ENSGGOP00000016754  --......--....---....-----------..............................................
ENSGGOP00000007308  --......--....---....-----------..............................................
ENSGGOP00000012932  FS......KG....LSF....MRKEDFAEWLLfftntenkdiywknvreklsagesisldefksfchftthledfaia
ENSGGOP00000012554  --......--....---....-----------..............................................
ENSGGOP00000011621  QDf.....SY....QNE....IKWQNFVEML-..............................................
ENSGGOP00000024380  FEpsism.CH....QGL....MSFEGFARFLM..............................................
ENSGGOP00000000011  --......--....---....-----------..............................................
ENSGGOP00000007649  FEpsism.CH....QGL....MSFEGFARFLM..............................................
ENSGGOP00000006035  --......--....---....-----------..............................................
ENSGGOP00000011720  --......--....---....-----------..............................................
ENSGGOP00000002269  --......--....---....-----------..............................................
ENSGGOP00000018132  --......--....---....-----------..............................................
ENSGGOP00000017534  --......--....---....-----------..............................................
ENSGGOP00000004508  YHspt...NS....VLK....TDAEELVSRSYwdtlrrntsqalfsdlaeraddits.....................
ENSGGOP00000018206  YHspt...NS....VLK....TDAEELVSRSYwdtlrrntsqalfsdlaeraddits.....................
ENSGGOP00000016496  --......--....---....-----------..............................................
ENSGGOP00000012932  --......--....---....--ETGYQEAIV..............................................
ENSGGOP00000004839  --......--....---....-----------..............................................
ENSGGOP00000008738  --......--....---....-----------..............................................
ENSGGOP00000028586  --......--....---....-----------..............................................
ENSGGOP00000011240  CF......SE....GEK....VNYEKFRNWLF..............................................
ENSGGOP00000007686  --......--....---....-----------..............................................
ENSGGOP00000000151  --......--....---....-----------..............................................
ENSGGOP00000006499  --......--....---....-----------..............................................
ENSGGOP00000023045  --......--....---....-----------..............................................
ENSGGOP00000020565  --......--....---....-----------..............................................
ENSGGOP00000012340  --......--....---....-----------..............................................
ENSGGOP00000023745  --......--....---....-----------..............................................
ENSGGOP00000008325  --......--....---....-----------..............................................
ENSGGOP00000022444  --......--....---....-----------..............................................
ENSGGOP00000024026  --......--....---....-----------..............................................
ENSGGOP00000003268  --......--....---....-----------..............................................
ENSGGOP00000012291  --......--....---....-----------..............................................
ENSGGOP00000020860  --......--....---....-----------..............................................
ENSGGOP00000004747  --......--....---....-----------..............................................
ENSGGOP00000016725  --......--....---....-----------..............................................
ENSGGOP00000027884  --......--....---....-----------..............................................
ENSGGOP00000008864  --......--....---....-----------..............................................
ENSGGOP00000024021  --......--....---....-----------..............................................
ENSGGOP00000002559  --......--....---....-----------..............................................
ENSGGOP00000008975  --......--....---....-----------..............................................
ENSGGOP00000015810  --......--....---....-----------..............................................
ENSGGOP00000022677  --......--....---....-----------..............................................
ENSGGOP00000001056  --......--....---....-----------..............................................
ENSGGOP00000024407  --......--....---....-----------..............................................
ENSGGOP00000008333  --......--....---....-----------..............................................
ENSGGOP00000005688  --......--....---....-----------..............................................
ENSGGOP00000027880  --......--....---....-----------..............................................
ENSGGOP00000015096  TSwgvs..RH....DNT....INYLDFL----..............................................
ENSGGOP00000022419  --......--....---....-----------..............................................
ENSGGOP00000003523  --......--....---....-----------..............................................
ENSGGOP00000007901  --......--....---....-----------..............................................
ENSGGOP00000008530  --......--....---....-----------..............................................
ENSGGOP00000007957  --......--....---....-----------..............................................
ENSGGOP00000010635  --......--....---....-----------..............................................
ENSGGOP00000004392  --......--....---....-----------..............................................
ENSGGOP00000010370  --......DD....GHK....ITLDKF-----..............................................
ENSGGOP00000022364  --......--....---....-----------..............................................
ENSGGOP00000015625  --......--....---....-----------..............................................
ENSGGOP00000007654  --......--....---....-----------..............................................
ENSGGOP00000020583  --......--....---....-----------..............................................
ENSGGOP00000013302  --......--....---....-----------..............................................
ENSGGOP00000010930  --......--....---....-----------..............................................
ENSGGOP00000005349  --......--....---....-----------..............................................
ENSGGOP00000008253  --......--....---....-----------..............................................
ENSGGOP00000001993  --......--....---....-----------..............................................
ENSGGOP00000024222  --......--....---....-----------..............................................
ENSGGOP00000002875  --......--....---....-----------..............................................
ENSGGOP00000012369  --......--....---....-----------..............................................
ENSGGOP00000011933  --......--....---....-----------..............................................
ENSGGOP00000011848  --......--....---....-----------..............................................
ENSGGOP00000018329  --......--....---....-----------..............................................
ENSGGOP00000000391  --......--....---....-----------..............................................
ENSGGOP00000013508  AQs.....NE....QGQ....VCYQELVDLI-..............................................
ENSGGOP00000022560  AQs.....NE....QGQ....VCYQELVDLI-..............................................
ENSGGOP00000019614  --......--....---....-----------..............................................
ENSGGOP00000015110  --......--....---....-----------..............................................
ENSGGOP00000008437  --......--....---....-----------..............................................
ENSGGOP00000016998  --......--....---....-----------..............................................
ENSGGOP00000024026  HFgh....NR....KKH....LNYTEFTQFL-..............................................
ENSGGOP00000017722  LSsl....GK....HNT....IT---------..............................................
ENSGGOP00000017757  --......--....---....-----------..............................................
ENSGGOP00000002740  --......--....---....-----------..............................................
ENSGGOP00000012168  FD......TK....MNE....LTRQGFMD---..............................................
ENSGGOP00000001815  --......--....---....-----------..............................................
ENSGGOP00000020483  --......--....---....-----------..............................................
ENSGGOP00000020927  --......--....---....-----------..............................................
ENSGGOP00000002387  --......--....---....-----------..............................................
ENSGGOP00000006515  --......--....---....-----------..............................................
ENSGGOP00000008725  --......--....---....-----------..............................................
ENSGGOP00000018073  --......--....---....-----------..............................................
ENSGGOP00000015740  --......--....---....-----------..............................................


                                                              160         170       180             
                                                                |           |         |             
d1kful1               ..............................RLET......LFKIFKQL..DPENTGTIELDLISWLC----fsvl...
ENSGGOP00000000209  ..............................----......--EMIREA..DIDGDGQV--NYEEFVQMM--.......
ENSGGOP00000022972  ..............................----......--EMIREA..DIDGDGQV--NYEEFVQMM--.......
ENSGGOP00000021376  ..............................PEKR......TEKIFRQM..DTNRDGKL--SLEEFIR----g......
ENSGGOP00000009800  ..............................PEKR......TEKIFRQM..DTNNDGKL--SLEEFIR----g......
ENSGGOP00000011095  ..............................----......--EMIDEA..DRDGDGEV--SEQEFLRIM--kktsl..
ENSGGOP00000003638  ..............................RLDA......MFRAFKSL..DRDGTGQIQVNIQEWLQLT--m......
ENSGGOP00000025293  ..............................RLDA......MFRAFKSL..DRDGTGQIQVNIQEWLQLT--m......
ENSGGOP00000002483  ..............................----......--EMIREA..DIDGDGQV--NYEEFVQMM--t......
ENSGGOP00000028220  ..............................----......--KIFRQM..DTNNDGKL--SLEEFIK----gaksdps
ENSGGOP00000017724  ..............................----......--EMIREA..DIDGDGQV--NYEEFVQMM--t......
ENSGGOP00000006566  ..............................----......--EMIRAA..DTDGDGQV--NYEEFVRV---lv.....
ENSGGOP00000019618  ..............................----......--EMIREA..DIDGDGQV--NYEEFVQMM--t......
ENSGGOP00000008245  ..............................----......--------..---------------------sdenapv
ENSGGOP00000025102  ..............................----......--KIFSKM..DKNKDDQI--TLDEFKE----aaksdps
ENSGGOP00000010426  ..............................GEE-......--------..---------------------ngvvspe
ENSGGOP00000015754  ..............................----......--------..---------------------ikqkdid
ENSGGOP00000012299  ..............................RLEG......MFRAFHAF..DKDGDGIIKLNVLEWLQLT--m......
ENSGGOP00000021175  ..............................----......--------..---------------------sdenapv
ENSGGOP00000019593  ..............................RLEG......MFRAFHAF..DKDGDGIIKLNVLEWLQLTM-y......
ENSGGOP00000006396  ..............................----......--SFFQKM..DRNKDGVV--TIEEFIE----scqkden
ENSGGOP00000022632  ..............................----......--------..---------------------kqrdprl
ENSGGOP00000011943  ..............................----......--------..---------------------kqrdprl
ENSGGOP00000008286  ..............................----......--------..---------------------rfkgksk
ENSGGOP00000015051  ..............................----......--------..---------------------ikeedid
ENSGGOP00000024872  ..............................----......--------..---------------------ikeedid
ENSGGOP00000011390  ..............................----......--------..---------------------tgiislc
ENSGGOP00000008090  ..............................----......--KIFSKM..DKNKDDQI--TLDEFKE----aaksdps
ENSGGOP00000006979  ..............................PEKR......TEKIFRQM..DTNRDGQL-------------.......
ENSGGOP00000014947  ..............................----......--------..---------------------skg....
ENSGGOP00000000749  ..............................----......--------..---------------------qrdsrln
ENSGGOP00000022235  ..............................----......--------..---------------------skg....
ENSGGOP00000004772  ..............................----......--QMFAAF..PPDVTGNL--DYKNLV-----hi.....
ENSGGOP00000001305  ..............................----......--EMIDEA..DRDGDGEV--NEEEFLRIM--kk.....
ENSGGOP00000009619  ..............................-AEH......VERFFEKM..DRNQDGVV--TIEEFLE----tcqkden
ENSGGOP00000027707  ..............................----......--SLMKDG..DKNNDGRI--DFDEFLKMM--.......
ENSGGOP00000013700  ..............................----......--------..---------------------rhlslal
ENSGGOP00000026634  ..............................----......--EMIREA..DIDGDGQV--NCEEFAHYV--t......
ENSGGOP00000027354  ..............................----......--VFFQKM..DKNKDGIV--TLDEFLE----scqeddn
ENSGGOP00000007591  ..............................RLET......MFRFFKTL..DTDLDGVVTFDLFKWLQL---tm.....
ENSGGOP00000024754  ..............................RLET......MFRFFKTL..DTDLDGVVTFDLFKWLQL---tm.....
ENSGGOP00000000341  ..............................----......--------..---------------------elakkrf
ENSGGOP00000006559  ..............................----......--AMIREA..DVDQDGRV--NYEEFARI---l......
ENSGGOP00000001194  ..............................----......--RIFAMM..DKNADGKL--TLQEFQE----gskadps
ENSGGOP00000020610  ..............................----......--------..---------------------lsadgsa
ENSGGOP00000003736  ..............................----......--------..---------------------lsadgsa
ENSGGOP00000004196  ..............................----......--------..---------------------rgilvnv
ENSGGOP00000015532  ..............................----......--ELMKDG..DKNNDGRI--DYDEFLEFM--kg.....
ENSGGOP00000000785  ..............................KLRA......LTDSFRRR..DTAQQGVVNFPYDDFIQCVM-s......
ENSGGOP00000014368  ..............................SPE-......--------..---------------------gaaldnt
ENSGGOP00000023413  ..............................----......--VFFQKM..DKNKDGIV--TLDEFLE----scqeddn
ENSGGOP00000007126  ..............................----......--VFFQKM..DKNKDGIV--TLDEFLE----scqeddn
ENSGGOP00000008349  ..............................----......--KIWKYF..GKNDDDKL--TEKEFIEG---tlankei
ENSGGOP00000011020  ..............................SPE-......--------..---------------------gaaldnt
ENSGGOP00000015507  ..............................QLQV......LTEAFREK..DTAVQGNIRLSFEDFVTM---t......
ENSGGOP00000012471  ..............................----......--TVFSKI..DVNGDGEL--SLEEFIEG---vqkdqml
ENSGGOP00000012549  ..............................RLEN......ASRVFQAL..STKNKEFIHLNINEFIHL---t......
ENSGGOP00000019099  ..............................RLKT......MFTFFLTM..DPKNTGHICLNLEQWLQMT--m......
ENSGGOP00000003031  ..............................RLKT......MFTFFLTM..DPKNTGHICLNLEQWLQMT--m......
ENSGGOP00000005101  ..............................----......--------..---------------------kgkspde
ENSGGOP00000024511  ..............................----......--TVFSKI..DVNGDGEL--SLEEFIEG---vqkdqml
ENSGGOP00000018250  ..............................----......--EMYREA..PIDKKGNF--NYVEFTRIL--kh.....
ENSGGOP00000003074  ..............................----......--EVVREA..DVNGDGTV--DFEEFVKMM--s......
ENSGGOP00000012477  ..............................----......--TVFSKI..DVNGDGEL--SLEEFIEG---vqkdqml
ENSGGOP00000010001  ..............................----......--------..---------------------rspagdi
ENSGGOP00000020622  ..............................----......--------..---------------------rspagdi
ENSGGOP00000010490  ..............................----......--QMMKEA..DKDGDGTI--DYEEFVAMM--tg.....
ENSGGOP00000015637  ..............................SPDC......--------..---------------------yifdpeh
ENSGGOP00000011144  ..............................----......--ELYREA..PIDKKGNF--NYIEFTRIL--kh.....
ENSGGOP00000026982  ..............................----......--ELYREA..PIDKKGNF--NYIEFTRIL--kh.....
ENSGGOP00000003975  ..............................----......--ELYREA..PIDKKGNF--NYIEFTRIL--kh.....
ENSGGOP00000004885  ..............................SR--......--------..---------------------ecllfkn
ENSGGOP00000014678  ..............................KLRA......LTDFFRKR..DHLQQGSANFIYDDFLQG---tm.....
ENSGGOP00000013437  ..............................----......--------..---------------------ddftahl
ENSGGOP00000011390  ..............................----......--------..---------------------lgevasf
ENSGGOP00000010036  ..............................----......--KTIINA..DKDGDGRI--SFEEFC-----a......
ENSGGOP00000027819  ..............................----......--EILQDV..DLNGDGLV--DFEEFVRMM--.......
ENSGGOP00000012841  ..............................----......--EIIRDV..DLNGDGRV--DFEEFVRMM--.......
ENSGGOP00000009918  ..............................----......--EILQDV..DLNGDGLV--DFEEFVRMM--.......
ENSGGOP00000012485  ..............................----......--RIFLLV..DENGDGQL--SLNEFVE----garrdkw
ENSGGOP00000009782  ..............................----......--EMLREV..DLNGDGTV--DFDEFVMML--sr.....
ENSGGOP00000009375  ..............................----......--AMIEEF..DKDGDGEI--NQEEFIAIM--tg.....
ENSGGOP00000023560  ..............................----......--------..---------------------lfqpwpt
ENSGGOP00000014947  ..............................----......--------..---------------------mvwlpvl
ENSGGOP00000012603  ..............................----......--------..---------------------aylevdl
ENSGGOP00000017349  ..............................----......--------..---------------------lfqpwss
ENSGGOP00000003738  ..............................----......--------..---------------------lfqpwss
ENSGGOP00000007513  ..............................N---......--FMIAAY..DSEGRGKL-------------tvfsvka
ENSGGOP00000022235  ..............................----......--------..---------------------mvwlpvl
ENSGGOP00000001928  ..............................SS--......--------..---------------------ecdifdp
ENSGGOP00000013652  ..............................RLET......LFKIFKQL..DPENTGTIELDLISW------lc.....
ENSGGOP00000006109  ..............................----......--LVFHKI..DINNDGEL--TLEEFINGM--akdqdll
ENSGGOP00000003219  ..............................----......--------..---------------------l......
ENSGGOP00000022428  ..............................----......--------..---------------------lcgg...
ENSGGOP00000017119  ..............................----......--------..---------------------lcgg...
ENSGGOP00000003545  ..............................----......--------..---------------------lcgg...
ENSGGOP00000023406  ..............................----......--------..---------------------.......
ENSGGOP00000007856  ..............................RLET......LFKIFKQL..DPENTGTIELDLI--------swl....
ENSGGOP00000011697  ..............................----......--------..---------------------.......
ENSGGOP00000018636  ..............................----......--------..---------------------rlfqpwg
ENSGGOP00000017641  ..............................----......--------..---------------------l......
ENSGGOP00000013074  ..............................----......--LILQSI..DVDGTMTV--DWNEWRDYF--lfnpvtd
ENSGGOP00000007661  ..............................----......--DLFKEG..DIEPNGKV--KYDEFIH----ki.....
ENSGGOP00000020763  ..............................GVSA......--------..---------------------sidtdvy
ENSGGOP00000005624  ..............................----......--QMFQFA..SIDAAGNL--DYKAL------syvithg
ENSGGOP00000025395  ..............................----......--------..---------------------rekppcl
ENSGGOP00000019250  ..............................----......--------..---------------------rekppcl
ENSGGOP00000020096  ..............................----......--QMFAAF..PPDVCGNL--DYRNLCYVI--thg....
ENSGGOP00000000796  ..............................----......--------..---------------------pgglpcq
ENSGGOP00000004196  ..............................----......--------..---------------------vrscfrf
ENSGGOP00000002530  ..............................----......--------..---------------------.......
ENSGGOP00000015006  ..............................----......--ITLKKM..DHDHDGKL--SFADYEL----avreetl
ENSGGOP00000016611  ..............................----......--------..---------------------ithg...
ENSGGOP00000004209  ..............................----......--RTVQEA..DEDGDGAV--SFVEFTK----slekmdv
ENSGGOP00000011570  ..............................----......--------..---------------------skdgdif
ENSGGOP00000006906  ..............................----......--KILHSM..DRDGTMTI--DWQEWRDHF--llhslen
ENSGGOP00000024832  ..............................----......--KILHSM..DRDGTMTI--DWQEWRDHF--llhslen
ENSGGOP00000019567  ..............................----......--------..---------------------.......
ENSGGOP00000009496  ..............................----......--------..---------------------.......
ENSGGOP00000012555  ..............................----......--------..---------------------vakedgk
ENSGGOP00000006153  ..............................GVSA......SMN-----..----------TDEEFVAMM--ts.....
ENSGGOP00000008018  ..............................----......--------..---------------------gvskegg
ENSGGOP00000007513  ..............................----......--------..---------------------vfegpsf
ENSGGOP00000024452  ..............................----......--------..---------------------gvsk...
ENSGGOP00000005045  ..............................KHPE......YAKIFT--..---------------------tyldlqt
ENSGGOP00000017287  ..............................----......--QMFAAF..PPDVCGNL--DYRNLCYVI--thg....
ENSGGOP00000004706  ..............................----......--NILEES..DIDRDGTI--NLSEFQHVI--srspdfa
ENSGGOP00000022428  ..............................----......--------..---------------------tlmsdpp
ENSGGOP00000017119  ..............................----......--------..---------------------tlmsdpp
ENSGGOP00000003545  ..............................----......--------..---------------------tlmsdpp
ENSGGOP00000004257  ..............................----......--KVLDEA..DGDHDGRL--SLEDFQNMI--lrapdfl
ENSGGOP00000024127  ..............................----......--------..---------------------livarkn
ENSGGOP00000012291  ..............................----......--------..---------------------lidvams
ENSGGOP00000004812  ..............................----......--QMFALT..PMDLAGNI--DYKSLCYII--thg....
ENSGGOP00000012046  ..............................----......--SMFRES..GFQDKEEL--TWEDFHFML--rdhnsel
ENSGGOP00000015625  ..............................----......--------..---------------------livarkn
ENSGGOP00000008889  ..............................----......--------..---------------------lvvarkn
ENSGGOP00000008482  ..............................----......--------..---------------------glamach
ENSGGOP00000013349  ..............................----......--GPVTYM..DKNGTMTI--DWNEWRDY---hllhpve
ENSGGOP00000011422  ..............................----......--SMFRES..GFQDKEEL--TWEDFHFML--rdhdsel
ENSGGOP00000018846  ..............................----......--KILKSM..DKNGTMTI--DWNEWRDY---hllhpve
ENSGGOP00000003216  ..............................----......--------..---------------------a......
ENSGGOP00000021719  ..............................RVEN......MEDVFQNL..TQDGKGI--------------y......
ENSGGOP00000005693  ..............................----......--HLVYES..DQNKDGKL--TKEEIV-----dkydlfv
ENSGGOP00000010676  ..............................----......--KVIEEA..DLDGDGKL--GFADFEDMI--akapdfl
ENSGGOP00000007432  ..............................----......--------..---------------------ltdmaka
ENSGGOP00000018435  ..............................----......--ETLEDI..DKNGDGFV--DQDEYIADM--fs.....
ENSGGOP00000006035  ..............................----......--------..---------------------lvycale
ENSGGOP00000025507  ..............................----......--------..---------------------lvycale
ENSGGOP00000006035  ..............................----......--------..---------------------lisqkli
ENSGGOP00000025507  ..............................----......--------..---------------------lisqkli
ENSGGOP00000003343  ..............................----......--KLANIM..DLNKDGSI--DFNEFLKAF--yvvhrye
ENSGGOP00000020870  ..............................RVEN......MEDVFQNL..TQDGKGI--------------yl.....
ENSGGOP00000002976  ..............................RVEN......MEDVFQNL..TQDGKGI--------------yl.....
ENSGGOP00000024041  ..............................----......--ALFESA..DADGNGAI--TFEELRD----elqrfpg
ENSGGOP00000009817  ..............................----......--ALFESA..DADGNGAI--TFEELRD----elqrfpg
ENSGGOP00000011240  ..............................----......--GILSAH..DTTKMGHL--TLEDYQI----wsvknvl
ENSGGOP00000008587  ..............................----......--HLLHES..DTDKDGRL--SKAE-------ilgnwnm
ENSGGOP00000007432  ..............................----......--------..---------------------liklklq
ENSGGOP00000013302  ..............................----......--------..---------------------qqkvskg
ENSGGOP00000024313  ..............................----......--------..---------------------qqkvskg
ENSGGOP00000000552  ..............................SEEDkrnptsIEYWFRCM..DVDGDGVL--SMYELE-----yfyeeqc
ENSGGOP00000002697  ..............................GIDI......ETKM----..---------------------hvrfl..
ENSGGOP00000016489  ..............................----......--------..---------------------altvacn
ENSGGOP00000028006  ..............................----......--HLIDEM..DLNGDKKL--SEEEIL-----enpdlfl
ENSGGOP00000023206  ..............................----......--HLIDEM..DLNGDKKL--SEEEIL-----enpdlfl
ENSGGOP00000006503  ..............................----......--------..---------------------diatdyh
ENSGGOP00000006509  ..............................----......--------..---------------------diatdyh
ENSGGOP00000021892  ..............................----......--------..---------------------mvttach
ENSGGOP00000004839  ..............................----......--LMLKLF..DSNNDGKL--ELTEMA-----rrllp..
ENSGGOP00000019168  ..............................----......--------..---------------------v......
ENSGGOP00000003722  ..............................----......--------..---------------------niim...
ENSGGOP00000007472  ..............................----......--------..---------------------adycvsh
ENSGGOP00000027338  ..............................----......--------..---------------------aitsach
ENSGGOP00000007156  ..............................----......--RTIQEA..DQDGDSAI--SFTEFVKV---lekvdve
ENSGGOP00000024526  ..............................----......--------..---------------------gltiacn
ENSGGOP00000028098  ..............................----......--------..---------------------altvacn
ENSGGOP00000007082  ..............................----......--------..---------------------cneffeg
ENSGGOP00000023859  ..............................----......--------..---------------------rvlrkll
ENSGGOP00000019080  ..............................----......--------..---------------------rvlrkll
ENSGGOP00000010449  ..............................----......--HVLSES..DLDNDNML--SFSEFEHAM--akspdfm
ENSGGOP00000000844  ..............................----......--------..---------------------rltwash
ENSGGOP00000023819  ..............................----......--------..---------------------diatdyh
ENSGGOP00000006595  ..............................----......--------..---------------------ialkaah
ENSGGOP00000006390  ..............................----......--QMIAVA..DENQNHHL--EPEEVL-----kysefft
ENSGGOP00000015096  ..............................----......--HILEYY..DKTLSSKI--SYNDFLRA---f......
ENSGGOP00000019080  ..............................----......--------..---------------------hprapel
ENSGGOP00000002308  ..............................----......--------..---------------------lieakle
ENSGGOP00000023711  ..............................----......--------..---------------------lieakle
ENSGGOP00000000733  ..............................----......--ILLRHC..DVNKDGKI--QKSEL------alcl...
ENSGGOP00000023859  ..............................----......--------..---------------------hprapel
ENSGGOP00000028529  ..............................----......--------..---------------------diatdyh
ENSGGOP00000015096  ..............................----......--------..---------------------si.....
ENSGGOP00000002979  ..............................----......--------..---------------------likvkle
ENSGGOP00000000348  ..............................----......--------..---------------------likvkle
ENSGGOP00000012168  ..............................----......--AIINLA..DVNADGKF--DYIKFCKL---ymtt...
ENSGGOP00000021101  ..............................----......--------..---------------------dyhlqyh
ENSGGOP00000024236  ..............................----......--------..---------------------dyhlqyh
ENSGGOP00000005783  ..............................----......--------..---------------------ppdqaey
ENSGGOP00000011525  ..............................----......--------..---------------------likikld
ENSGGOP00000011629  ..............................----......--------..---------------------lppdqaq
ENSGGOP00000009256  ..............................----......--------..---------------------.......
ENSGGOP00000022443  ..............................SEEDkktptsIEYWFRCM..DLDGDGAL--SMFELE-----yfyeeqc
ENSGGOP00000013081  ..............................SEEDkktptsIEYWFRCM..DLDGDGAL--SMFELE-----yfyeeqc
ENSGGOP00000006507  ..............................----......--------..---------------------rd.....
ENSGGOP00000026277  ..............................----......--------..---------------------tl.....
ENSGGOP00000026775  ..............................----......--------..---------------------glamach
ENSGGOP00000015605  ..............................----......--------..---------------------pakqaey
ENSGGOP00000013437  ..............................----......--EMMEEI..DYDHDGTV--SLEEWIQ----g......
ENSGGOP00000015096  ..............................----......--RLWNEM..PVNAKGRL--KYPDFL-----srfss..
ENSGGOP00000015264  ..............................----......--DLFRAI..DQEQKGKI--TFADFHRF---aemypdf
ENSGGOP00000019492  ..............................RLEA......MAKTFRNL..SKDGKGLY-LTEMEWMSLV--m......
ENSGGOP00000015242  ..............................RLEA......MAKTFRNL..SKDGKGLY-LTEMEWMSLV--m......
ENSGGOP00000015096  ..............................----......-----RRY..DTEGKGHI--TYQEFLQ----kl.....
ENSGGOP00000011088  ..............................----......--DLFHDF..DITGDNRL--NYQEFKL----y......
ENSGGOP00000020157  ..............................----......--------..---------------------clclych
ENSGGOP00000025587  ..............................----......--------..---------------------klaqayy
ENSGGOP00000002805  ..............................----......--------..---------------------.......
ENSGGOP00000013256  ..............................----......--------..---------------------nvwnlas
ENSGGOP00000023524  ..............................----......--------..---------------------nvwnlas
ENSGGOP00000013295  ..............................----......--------..---------------------cy.....
ENSGGOP00000018258  ..............................----......--------..---------------------cy.....
ENSGGOP00000005688  ..............................----......--------..---------------------e......
ENSGGOP00000007088  ..............................----......--------..---------------------alaliyn
ENSGGOP00000004418  ..............................----......--------..---------------------qlvqacy
ENSGGOP00000004827  ..............................----......--------..---------------------ev.....
ENSGGOP00000023450  ..............................----......--RIMSIV..DPNRLGVV--TFQAFIDFM--sr.....
ENSGGOP00000007087  ..............................----......--------..---------------------lcmaynd
ENSGGOP00000020253  ..............................----......--------..---------------------kmgvaah
ENSGGOP00000027573  ..............................----......--------..---------------------kmgvaah
ENSGGOP00000021162  ..............................----......--KLANIM..DLNKDGSI--DFNEFLKAF--yvvhrye
ENSGGOP00000016495  ..............................----......--------..---------------------elakeir
ENSGGOP00000005787  ..............................RLRM......REHVMNEV..DTNKDRLV--TLEEFLK----at.....
ENSGGOP00000020487  ..............................----......--------..---------------------kvaqacy
ENSGGOP00000016148  ..............................----......--------..---------------------agdklqe
ENSGGOP00000015096  ..............................----......--ELMQML..DPGDTGVV--NTSMFI-----dlieenc
ENSGGOP00000012603  ..............................----......--EMLQGM..DYDRDGFV--SLQEWVH----ggmttip
ENSGGOP00000015201  ..............................----......--------..---------------------ka.....
ENSGGOP00000024915  ..............................----......--------..---------------------glaaach
ENSGGOP00000023450  ..............................----......--------..---------------------qaeycia
ENSGGOP00000001678  ..............................----......--------..---------------------.......
ENSGGOP00000024627  ..............................----......--------..---------------------gitgpia
ENSGGOP00000018908  ..............................----......--------..---------------------kvaqacf
ENSGGOP00000025434  ..............................----......--------..---------------------npksdel
ENSGGOP00000006199  ..............................----......--HVMKNV..DTNQDRLV--TLEEFL-----astq...
ENSGGOP00000019261  ..............................----......--HVMKNV..DTNQDRLV--TLEEFL-----astq...
ENSGGOP00000005693  ..............................----......--------..---------------------ygy....
ENSGGOP00000001807  ..............................----......--------..---------------------klvqarn
ENSGGOP00000024313  ..............................----......--------..---------------------lvyrale
ENSGGOP00000019354  ..............................----......--------..---------------------aiqk...
ENSGGOP00000018853  ..............................----......--------..---------------------d......
ENSGGOP00000008614  ..............................----......--------..---------------------inrkegi
ENSGGOP00000024313  ..............................----......--------..---------------------lvacaqs
ENSGGOP00000000552  ..............................----......--------..---------------------k......
ENSGGOP00000004747  talsfyhmagasldkvtmqqvartvakvelSDHV......CDVVFALF..DCDGNGEL--SNKEFVSIM--kq.....
ENSGGOP00000013302  ..............................----......--------..---------------------lvacaqs
ENSGGOP00000020941  ..............................----......--------..---------------------litvmcn
ENSGGOP00000000504  ..............................----......--------..---------------------dprgrsh
ENSGGOP00000024502  ..............................----......--------..---------------------dprgrsh
ENSGGOP00000011848  ..............................----......--ETLEDN..DKNGDGFV--DQDEYIVVM--fsh....
ENSGGOP00000024360  ..............................----......--------..---------------------vv.....
ENSGGOP00000000733  ..............................----......--------..---------------------.......
ENSGGOP00000024360  ..............................----......--EPLNCC..NVSDNMEV--DLKDFLMKM--kesphf.
ENSGGOP00000021249  ..............................----......--------..---------------------pnkd...
ENSGGOP00000019415  ..............................----......--------..---------------------pnkd...
ENSGGOP00000013501  ..............................----......--------..---------------------paapwgp
ENSGGOP00000021515  ..............................----......--------..---------------------lfk....
ENSGGOP00000005854  ..............................----......--------..---------------------lfk....
ENSGGOP00000016618  ..............................----......--------..---------------------l......
ENSGGOP00000024091  ..............................----......--------..---------------------dknlflk
ENSGGOP00000013700  ..............................----......--EMMKEI..DYDGSGSV--SQAEWVR----a......
ENSGGOP00000008485  ..............................----......--------..---------------------aglttvd
ENSGGOP00000011966  ..............................----......--GVLRDD..DKNNDGYI--DYAEFA-----ks.....
ENSGGOP00000023645  ..............................----......--------..---------------------fs.....
ENSGGOP00000028176  ..............................----......--------..---------------------l......
ENSGGOP00000004508  ..............................----......--TVFKIF..DVDKDDQL--SYKEFIGIM--k......
ENSGGOP00000018206  ..............................----......--TVFKIF..DVDKDDQL--SYKEFIGIM--k......
ENSGGOP00000006739  ..............................----......--------..---------------------hvlpeps
ENSGGOP00000023979  ..............................----......--------..---------------------hvlpeps
ENSGGOP00000012342  ..............................----......--------..---------------------l......
ENSGGOP00000023206  ..............................----......--------..---------------------af.....
ENSGGOP00000001608  ..............................----......--------..---------------------mqlvrei
ENSGGOP00000010042  ..............................----......--------..---------------------shfffsq
ENSGGOP00000028006  ..............................----......--KRFEKA..NQDSGPGL--SLEEFI-----af.....
ENSGGOP00000025507  ..............................----......--------..---------------------vifcsfs
ENSGGOP00000020583  talsfyhmagasldkvtmqqvartvakvelSDHV......CDVVFALF..DCDGNGEL--SNKEFVSIM--kq.....
ENSGGOP00000012393  ..............................----......--------..---------------------rsss...
ENSGGOP00000016724  ..............................----......--EMYAAIkaDPDGDGVL--SLQEFSNM---dlrdfhk
ENSGGOP00000023938  ..............................----......--------..---------------------k......
ENSGGOP00000022364  talsfyhmagasldkvtmqqvartvakvelSDHV......CDVVFALF..DCDGNGEL--SNKEFVSIM--kq.....
ENSGGOP00000005326  ..............................----......--------..---------------------l......
ENSGGOP00000008587  ..............................----......--------..---------------------ghyapge
ENSGGOP00000002982  ..............................----......--------..---------------------hlppgta
ENSGGOP00000006523  ..............................----......--------..---------------------k......
ENSGGOP00000014183  ..............................----......--------..---------------------t......
ENSGGOP00000018435  ..............................----......--HLVYES..DKNKDEKL--TKEEI------l......
ENSGGOP00000021184  ..............................----......--------..---------------------sfteklk
ENSGGOP00000015096  ..............................----......--------..---------------------igfekeg
ENSGGOP00000024360  ..............................----......--------..---------------------tln....
ENSGGOP00000027849  ..............................----......--------..---------------------lhlppal
ENSGGOP00000022443  ..............................----......--------..---------------------.......
ENSGGOP00000013081  ..............................----......--------..---------------------.......
ENSGGOP00000022610  ..............................----......--------..---------------------ke.....
ENSGGOP00000010606  ..............................----......--------..---------------------nk.....
ENSGGOP00000026802  ..............................----......--------..---------------------gl.....
ENSGGOP00000011774  ..............................----......--------..---------------------nllnlcy
ENSGGOP00000002441  ..............................----......--------..---------------------gl.....
ENSGGOP00000002021  ..............................----......--------..---------------------ra.....
ENSGGOP00000009877  ..............................----......--------..---------------------.......
ENSGGOP00000016754  ..............................----......--------..---------------------.......
ENSGGOP00000007308  ..............................----......--------..---------------------.......
ENSGGOP00000012932  ..mqmfslahrpvrlaefkravkvatgqelSNNI......LDTVFKIF..DLDGDECL--SHEEFLGV---lk.....
ENSGGOP00000012554  ..............................----......--------..---------------------sitv...
ENSGGOP00000011621  ..............................----......--------..---------------------t......
ENSGGOP00000024380  ..............................----......--------..---------------------dkenfa.
ENSGGOP00000000011  ..............................----......--------..---------------------lgeye..
ENSGGOP00000007649  ..............................----......--------..---------------------dkenfa.
ENSGGOP00000006035  ..............................----......--------..---------------------kq.....
ENSGGOP00000011720  ..............................----......--------..---------------------.......
ENSGGOP00000002269  ..............................----......--------..---------------------l......
ENSGGOP00000018132  ..............................----......--------..---------------------lgmfvgv
ENSGGOP00000017534  ..............................----......--------..---------------------l......
ENSGGOP00000004508  ..............................LVTD......TTLLVHFF..GKKGKAEL--NFEDFYRFM--dn.....
ENSGGOP00000018206  ..............................LVTD......TTLLVHFF..GKKGKAEL--NFEDFYRFM--d......
ENSGGOP00000016496  ..............................----......--------..---------------------ge.....
ENSGGOP00000012932  ..............................KEPEin....TTLQMRFF..GKRGQRKL--HYKEFRRFM--enlq...
ENSGGOP00000004839  ..............................----......--------..---------------------nkq....
ENSGGOP00000008738  ..............................----......--------..---------------------saaggsi
ENSGGOP00000028586  ..............................----......--------..---------------------n......
ENSGGOP00000011240  ..............................LNKD......AF------..---------------------tfsrwll
ENSGGOP00000007686  ..............................----......--------..---------------------tair...
ENSGGOP00000000151  ..............................----......--------..---------------------fqgkedm
ENSGGOP00000006499  ..............................----......--DLARSI..DFNKDGHI--DINEFLEAF--rlv....
ENSGGOP00000023045  ..............................----......--------..---------------------yngsfte
ENSGGOP00000020565  ..............................----......--DLARSI..DFNKDGHI--DINEFLEAF--rlv....
ENSGGOP00000012340  ..............................----......--------..---------------------rf.....
ENSGGOP00000023745  ..............................----......--------..---------------------rf.....
ENSGGOP00000008325  ..............................----......--------..---------------------viql...
ENSGGOP00000022444  ..............................----......--------..---------------------hqqm...
ENSGGOP00000024026  ..............................----......--------..---------------------aaggsis
ENSGGOP00000003268  ..............................----......--------..---------------------hqqm...
ENSGGOP00000012291  ..............................----......--------..---------------------laqicrf
ENSGGOP00000020860  ..............................----......--------..---------------------.......
ENSGGOP00000004747  ..............................----......--VVFALF..DCDGNGEL--SNKEFVSIM--k......
ENSGGOP00000016725  ..............................----......--------..---------------------hwaqdln
ENSGGOP00000027884  ..............................----......--------..---------------------hwaqdln
ENSGGOP00000008864  ..............................----......--------..---------------------emv....
ENSGGOP00000024021  ..............................----......--------..---------------------v......
ENSGGOP00000002559  ..............................----......--------..---------------------nf.....
ENSGGOP00000008975  ..............................----......--------..---------------------rf.....
ENSGGOP00000015810  ..............................----......--------..---------------------cwtltak
ENSGGOP00000022677  ..............................----......--------..---------------------cwtltak
ENSGGOP00000001056  ..............................----......--------..---------------------f......
ENSGGOP00000024407  ..............................----......--------..---------------------rw.....
ENSGGOP00000008333  ..............................----......--------..---------------------cfaslfg
ENSGGOP00000005688  ..............................----......--------..---------------------dilfqla
ENSGGOP00000027880  ..............................----......--------..---------------------cfaslfg
ENSGGOP00000015096  ..............................----......--------..---------------------ra.....
ENSGGOP00000022419  ..............................----......--------..---------------------klcdyfs
ENSGGOP00000003523  ..............................----......--------..---------------------klcdyfs
ENSGGOP00000007901  ..............................----......--------..---------------------tr.....
ENSGGOP00000008530  ..............................----......--------..---------------------kvphdpv
ENSGGOP00000007957  ..............................----......--------..---------------------dssvnhs
ENSGGOP00000010635  ..............................----......--LMKNKL..DPEGLGII-------------llgpflq
ENSGGOP00000004392  ..............................----......--------..---------------------evvdasv
ENSGGOP00000010370  ..............................----......--------..---------------------ke.....
ENSGGOP00000022364  ..............................----......--------..---------------------.......
ENSGGOP00000015625  ..............................----......--------..---------------------liaaaqs
ENSGGOP00000007654  ..............................----......--------..---------------------aqktmdl
ENSGGOP00000020583  ..............................----......--------..---------------------.......
ENSGGOP00000013302  ..............................----......--------..---------------------sklpldv
ENSGGOP00000010930  ..............................----......--DLLRFD..DYNSDSSL--TLREFYMA---fqvvels
ENSGGOP00000005349  ..............................----......--------..---------------------yngemne
ENSGGOP00000008253  ..............................----......--------..---------------------enfpq..
ENSGGOP00000001993  ..............................----......--------..---------------------iirql..
ENSGGOP00000024222  ..............................----......--------..---------------------elv....
ENSGGOP00000002875  ..............................----......--------..---------------------elv....
ENSGGOP00000012369  ..............................----......--------..---------------------.......
ENSGGOP00000011933  ..............................----......--------..---------------------rvfqec.
ENSGGOP00000011848  ..............................----......--------..---------------------aqgearh
ENSGGOP00000018329  ..............................----......--------..---------------------heslll.
ENSGGOP00000000391  ..............................----......--------..---------------------heslll.
ENSGGOP00000013508  ..............................----......--------..---------------------s......
ENSGGOP00000022560  ..............................----......--------..---------------------s......
ENSGGOP00000019614  ..............................----......------EL..DTDGDGAL--S----------eaeaqal
ENSGGOP00000015110  ..............................----......--------..---------------------rf.....
ENSGGOP00000008437  ..............................----......------EL..DTDGDGAL--S----------eaeaqal
ENSGGOP00000016998  ..............................----......--------..---------------------rf.....
ENSGGOP00000024026  ..............................----......--------..---------------------q......
ENSGGOP00000017722  ..............................----......--------..---------------------mdilant
ENSGGOP00000017757  ..............................----......--------..---------------------nkv....
ENSGGOP00000002740  ..............................----......--------..---------------------nkv....
ENSGGOP00000012168  ..............................----......--------..---------------------ln.....
ENSGGOP00000001815  ..............................----......--------..---------------------qekmrqd
ENSGGOP00000020483  ..............................----......--------..---------------------qekmrqd
ENSGGOP00000020927  ..............................----......--------..---------------------qekmrqd
ENSGGOP00000002387  ..............................----......--------..---------------------rv.....
ENSGGOP00000006515  ..............................----......--------..---------------------lgal...
ENSGGOP00000008725  ..............................----......--------..---------------------f......
ENSGGOP00000018073  ..............................----......--------..---------------------f......
ENSGGOP00000015740  ..............................----......--------..---------------------dwiaacq


                                                                                                    
                                                                                                    
d1kful1               ..............................................................................
ENSGGOP00000000209  ..............................................................................
ENSGGOP00000022972  ..............................................................................
ENSGGOP00000021376  ..............................................................................
ENSGGOP00000009800  ..............................................................................
ENSGGOP00000011095  ..............................................................................
ENSGGOP00000003638  ..............................................................................
ENSGGOP00000025293  ..............................................................................
ENSGGOP00000002483  ..............................................................................
ENSGGOP00000028220  ivrllqc.......................................................................
ENSGGOP00000017724  ..............................................................................
ENSGGOP00000006566  ..............................................................................
ENSGGOP00000019618  ..............................................................................
ENSGGOP00000008245  fldrlely......................................................................
ENSGGOP00000025102  ivlllq........................................................................
ENSGGOP00000010426  kldl..........................................................................
ENSGGOP00000015754  kdl...........................................................................
ENSGGOP00000012299  ..............................................................................
ENSGGOP00000021175  fldrlely......................................................................
ENSGGOP00000019593  ..............................................................................
ENSGGOP00000006396  imrsmqlfdn....................................................................
ENSGGOP00000022632  nevlypplrpsqarlliekyepnqqflerdqmsmegfsrylggeengilpleald.......................
ENSGGOP00000011943  nevlypplrpsqarlliekyepnqqflerdqmsmegfsrylggeengilpleald.......................
ENSGGOP00000008286  eeafdaicqlvagkepanvgvtkaktggavdrltdtsrytgshker................................
ENSGGOP00000015051  enll..........................................................................
ENSGGOP00000024872  enll..........................................................................
ENSGGOP00000011390  k.............................................................................
ENSGGOP00000008090  ivlllqill.....................................................................
ENSGGOP00000006979  ..............................................................................
ENSGGOP00000014947  ..............................................................................
ENSGGOP00000000749  sllfpparpdqvqglidkyepsginaqrgqlspegmvwflcgpensvlaqdkl.........................
ENSGGOP00000022235  ..............................................................................
ENSGGOP00000004772  ..............................................................................
ENSGGOP00000001305  ..............................................................................
ENSGGOP00000009619  imssmqlf......................................................................
ENSGGOP00000027707  ..............................................................................
ENSGGOP00000013700  fqsfetghclnetnvtkdvvclndvscyfslleggrpedkleft..................................
ENSGGOP00000026634  ..............................................................................
ENSGGOP00000027354  imrslqlfq.....................................................................
ENSGGOP00000007591  ..............................................................................
ENSGGOP00000024754  ..............................................................................
ENSGGOP00000000341  kdksseeavrevhrliegkapiisgvtkaissptvsrltdttkftgshker...........................
ENSGGOP00000006559  ..............................................................................
ENSGGOP00000001194  ivqalslydg....................................................................
ENSGGOP00000020610  fslahrrvy.....................................................................
ENSGGOP00000003736  fslahrrvy.....................................................................
ENSGGOP00000004196  plcvdmslnwllnvfdrpsgrsgkmralsfktgiaclcg.......................................
ENSGGOP00000015532  ..............................................................................
ENSGGOP00000000785  ..............................................................................
ENSGGOP00000014368  htcv..........................................................................
ENSGGOP00000023413  imrslqlfq.....................................................................
ENSGGOP00000007126  imrslqlfq.....................................................................
ENSGGOP00000008349  lrliqfe.......................................................................
ENSGGOP00000011020  htcv..........................................................................
ENSGGOP00000015507  ..............................................................................
ENSGGOP00000012471  ldtlt.........................................................................
ENSGGOP00000012549  ..............................................................................
ENSGGOP00000019099  ..............................................................................
ENSGGOP00000003031  ..............................................................................
ENSGGOP00000005101  vleniyglmegkdpattgatkattvgavdrltdtskytsthker..................................
ENSGGOP00000024511  ldtlt.........................................................................
ENSGGOP00000018250  ..............................................................................
ENSGGOP00000003074  ..............................................................................
ENSGGOP00000012477  ldtlt.........................................................................
ENSGGOP00000010001  fnpehhhvh.....................................................................
ENSGGOP00000020622  fnpehhhvh.....................................................................
ENSGGOP00000010490  ..............................................................................
ENSGGOP00000015637  kkvc..........................................................................
ENSGGOP00000011144  ..............................................................................
ENSGGOP00000026982  ..............................................................................
ENSGGOP00000003975  ..............................................................................
ENSGGOP00000004885  ecrkvy........................................................................
ENSGGOP00000014678  ..............................................................................
ENSGGOP00000013437  fmsfsnkfphsspmvkskpallsgglrmnkgaitpprttspantcspevihlkdivcylsllergrpedklefm....
ENSGGOP00000011390  ggsniepsvrscfqfannkpeieaalfldwmrlepqsmvwlpvlhrvaaaet..........................
ENSGGOP00000010036  ..............................................................................
ENSGGOP00000027819  ..............................................................................
ENSGGOP00000012841  ..............................................................................
ENSGGOP00000009918  ..............................................................................
ENSGGOP00000012485  vmkmlqmdm.....................................................................
ENSGGOP00000009782  ..............................................................................
ENSGGOP00000009375  ..............................................................................
ENSGGOP00000023560  llknwqllav....................................................................
ENSGGOP00000014947  hrvaaaet......................................................................
ENSGGOP00000012603  pqplsthlflafsqkprhetsdhptegasnseansadtniqnadnatkadeacapdtesnmaekqaptedqvaatple
ENSGGOP00000017349  llrnwnslav....................................................................
ENSGGOP00000003738  llrnwnslav....................................................................
ENSGGOP00000007513  mlatmcgg......................................................................
ENSGGOP00000022235  hrvaaaet......................................................................
ENSGGOP00000001928  eqkkv.........................................................................
ENSGGOP00000013652  ..............................................................................
ENSGGOP00000006109  ei............................................................................
ENSGGOP00000003219  ..............................................................................
ENSGGOP00000022428  ..............................................................................
ENSGGOP00000017119  ..............................................................................
ENSGGOP00000003545  ..............................................................................
ENSGGOP00000023406  ..............................................................................
ENSGGOP00000007856  ..............................................................................
ENSGGOP00000011697  ..............................................................................
ENSGGOP00000018636  silrnwnflav...................................................................
ENSGGOP00000017641  ..............................................................................
ENSGGOP00000013074  ieeiirfwkhstgidigdsltipdefte..................................................
ENSGGOP00000007661  ..............................................................................
ENSGGOP00000020763  fivmmrtaw.....................................................................
ENSGGOP00000005624  ..............................................................................
ENSGGOP00000025395  ae............................................................................
ENSGGOP00000019250  ae............................................................................
ENSGGOP00000020096  ..............................................................................
ENSGGOP00000000796  ne............................................................................
ENSGGOP00000004196  stgkpvieasqflewvnlepqsmvwlavlhrvtiae..........................................
ENSGGOP00000002530  ..............................................................................
ENSGGOP00000015006  lleafgpclpdpk.................................................................
ENSGGOP00000016611  ..............................................................................
ENSGGOP00000004209  eqk...........................................................................
ENSGGOP00000011570  npaclpiy......................................................................
ENSGGOP00000006906  vedvlyfwkhs...................................................................
ENSGGOP00000024832  vedvlyfwkhs...................................................................
ENSGGOP00000019567  ..............................................................................
ENSGGOP00000009496  ..............................................................................
ENSGGOP00000012555  ad............................................................................
ENSGGOP00000006153  ..............................................................................
ENSGGOP00000008018  ..............................................................................
ENSGGOP00000007513  gytehsvrtcfpqqrkimlnmfldtmmadpppqclvwlplmhrlahven.............................
ENSGGOP00000024452  ..............................................................................
ENSGGOP00000005045  ..............................................................................
ENSGGOP00000017287  ..............................................................................
ENSGGOP00000004706  ssfki.........................................................................
ENSGGOP00000022428  pqclvwlpllhrlanven............................................................
ENSGGOP00000017119  pqclvwlpllhrlanven............................................................
ENSGGOP00000003545  pqclvwlpllhrlanven............................................................
ENSGGOP00000004257  stfhi.........................................................................
ENSGGOP00000024127  gyplpeglpptlqpey..............................................................
ENSGGOP00000012291  gqslppvlppeyippsf.............................................................
ENSGGOP00000004812  ..............................................................................
ENSGGOP00000012046  rftqlcv.......................................................................
ENSGGOP00000015625  gyplpeglpptlqpey..............................................................
ENSGGOP00000008889  gydlpeklpeslmpkl..............................................................
ENSGGOP00000008482  dsflkavps.....................................................................
ENSGGOP00000013349  nipeiilywkhstifdvgenltvpdeft..................................................
ENSGGOP00000011422  rftqlcvkgg....................................................................
ENSGGOP00000018846  nipeiilywkhs..................................................................
ENSGGOP00000003216  ..............................................................................
ENSGGOP00000021719  ..............................................................................
ENSGGOP00000005693  gsqatdfgeal...................................................................
ENSGGOP00000010676  stfhi.........................................................................
ENSGGOP00000007432  gqplpltlppelvppsfr............................................................
ENSGGOP00000018435  ..............................................................................
ENSGGOP00000006035  kepvpmslppalvppskr............................................................
ENSGGOP00000025507  kepvpmslppalvppskr............................................................
ENSGGOP00000006035  kgidpphvltpemipp..............................................................
ENSGGOP00000025507  kgidpphvltpemipp..............................................................
ENSGGOP00000003343  d.............................................................................
ENSGGOP00000020870  ..............................................................................
ENSGGOP00000002976  ..............................................................................
ENSGGOP00000024041  vmenl.........................................................................
ENSGGOP00000009817  vmenl.........................................................................
ENSGGOP00000011240  aneflnll......................................................................
ENSGGOP00000008587  fvgsqatnygedl.................................................................
ENSGGOP00000007432  gqqlpvvlppimkqpp..............................................................
ENSGGOP00000013302  idppqvlspdmvppser.............................................................
ENSGGOP00000024313  idppqvlspdmvppser.............................................................
ENSGGOP00000000552  ermeamgieplpfhdllcqmldlvkpavdgkitlrdlkrcrmah..................................
ENSGGOP00000002697  ..............................................................................
ENSGGOP00000016489  nffw..........................................................................
ENSGGOP00000028006  tseatdygrqlh..................................................................
ENSGGOP00000023206  tseatdygrqlh..................................................................
ENSGGOP00000006503  kqshgaapcs....................................................................
ENSGGOP00000006509  kqshgaapcs....................................................................
ENSGGOP00000021892  eff...........................................................................
ENSGGOP00000004839  ..............................................................................
ENSGGOP00000019168  ..............................................................................
ENSGGOP00000003722  ..............................................................................
ENSGGOP00000007472  mkpyvdgkgrelptafdyvef.........................................................
ENSGGOP00000027338  khfek.........................................................................
ENSGGOP00000007156  qkmsir........................................................................
ENSGGOP00000024526  dyfvv.........................................................................
ENSGGOP00000028098  dyfve.........................................................................
ENSGGOP00000007082  ..............................................................................
ENSGGOP00000023859  tdlqqiptvvgesralcpvesatcsyfqgvlspavreekflswvqseppillwlptchrlsaae..............
ENSGGOP00000019080  tdlqqiptvvgesralcpvesatcsyfqgvlspavreekflswvqseppillwlptchrlsaae..............
ENSGGOP00000010449  nsfri.........................................................................
ENSGGOP00000000844  ekmhe.........................................................................
ENSGGOP00000023819  rqshgaapcs....................................................................
ENSGGOP00000006595  yhthk.........................................................................
ENSGGOP00000006390  gsklvdyar.....................................................................
ENSGGOP00000015096  ..............................................................................
ENSGGOP00000019080  tlsllttmynstgtgflqlmpaaaalttlsg...............................................
ENSGGOP00000002308  ghglpanlprrlvppskr............................................................
ENSGGOP00000023711  ghglpanlprrlvppskr............................................................
ENSGGOP00000000733  ..............................................................................
ENSGGOP00000023859  tlsllttmynstgtgflqlmpaaaalttlsg...............................................
ENSGGOP00000028529  rqshgaapcs....................................................................
ENSGGOP00000015096  ..............................................................................
ENSGGOP00000002979  ghelpnelpahllppskr............................................................
ENSGGOP00000000348  ghelpadlpphlvppskr............................................................
ENSGGOP00000012168  ..............................................................................
ENSGGOP00000021101  rqlcary.......................................................................
ENSGGOP00000024236  rqlcary.......................................................................
ENSGGOP00000005783  ciarm.........................................................................
ENSGGOP00000011525  gyelpsslpphlvppshr............................................................
ENSGGOP00000011629  ycikrmp.......................................................................
ENSGGOP00000009256  ..............................................................................
ENSGGOP00000022443  rrldsmaiealpfqdclcqmldlvkprtegkitlqdlkrce.....................................
ENSGGOP00000013081  rrldsmaiealpfqdclcqmldlvkprtegkitlqdlkrce.....................................
ENSGGOP00000006507  ..............................................................................
ENSGGOP00000026277  ..............................................................................
ENSGGOP00000026775  dsflkavps.....................................................................
ENSGGOP00000015605  cirrm.........................................................................
ENSGGOP00000013437  ..............................................................................
ENSGGOP00000015096  ..............................................................................
ENSGGOP00000015264  aeeylypdq.....................................................................
ENSGGOP00000019492  ..............................................................................
ENSGGOP00000015242  ..............................................................................
ENSGGOP00000015096  ..............................................................................
ENSGGOP00000011088  ..............................................................................
ENSGGOP00000020157  eyfkd.........................................................................
ENSGGOP00000025587  es............................................................................
ENSGGOP00000002805  ..............................................................................
ENSGGOP00000013256  kkh...........................................................................
ENSGGOP00000023524  kkh...........................................................................
ENSGGOP00000013295  ..............................................................................
ENSGGOP00000018258  ..............................................................................
ENSGGOP00000005688  ..............................................................................
ENSGGOP00000007088  eal...........................................................................
ENSGGOP00000004418  rk............................................................................
ENSGGOP00000004827  ..............................................................................
ENSGGOP00000023450  ..............................................................................
ENSGGOP00000007087  ffle..........................................................................
ENSGGOP00000020253  kkshees.......................................................................
ENSGGOP00000027573  kkshees.......................................................................
ENSGGOP00000021162  d.............................................................................
ENSGGOP00000016495  kkkd..........................................................................
ENSGGOP00000005787  ..............................................................................
ENSGGOP00000020487  ..............................................................................
ENSGGOP00000016148  ggkmqtahaaftppgfaavsgraalrlldfaaflttlssqnyitmdelrrelppdqaeyciarmapytgpdsvpgald
ENSGGOP00000015096  rmrktspy......................................................................
ENSGGOP00000012603  llvllgmddsg...................................................................
ENSGGOP00000015201  ..............................................................................
ENSGGOP00000024915  dsflkavp......................................................................
ENSGGOP00000023450  rmapytgpdsvpgaldymsfstalygesd.................................................
ENSGGOP00000001678  ..............................................................................
ENSGGOP00000024627  k.............................................................................
ENSGGOP00000018908  k.............................................................................
ENSGGOP00000025434  ksrr..........................................................................
ENSGGOP00000006199  ..............................................................................
ENSGGOP00000019261  ..............................................................................
ENSGGOP00000005693  ..............................................................................
ENSGGOP00000001807  kiigkdycq.....................................................................
ENSGGOP00000024313  kepvpsalppslippskr............................................................
ENSGGOP00000019354  ..............................................................................
ENSGGOP00000018853  ..............................................................................
ENSGGOP00000008614  calggtselssegtqhsyseeekyafvnwinkalendpd.......................................
ENSGGOP00000024313  ghevtlsnlnlsmpppkfhd..........................................................
ENSGGOP00000000552  ..............................................................................
ENSGGOP00000004747  ..............................................................................
ENSGGOP00000013302  ghevtlsnlnlsmpppkfhd..........................................................
ENSGGOP00000020941  dffqgcp.......................................................................
ENSGGOP00000000504  lsgydyvgftnsy.................................................................
ENSGGOP00000024502  lsgydyvgftnsy.................................................................
ENSGGOP00000011848  ..............................................................................
ENSGGOP00000024360  ..............................................................................
ENSGGOP00000000733  ..............................................................................
ENSGGOP00000024360  ..............................................................................
ENSGGOP00000021249  ..............................................................................
ENSGGOP00000019415  ..............................................................................
ENSGGOP00000013501  elprtvrteagrlplhgylcqw........................................................
ENSGGOP00000021515  ..............................................................................
ENSGGOP00000005854  ..............................................................................
ENSGGOP00000016618  ..............................................................................
ENSGGOP00000024091  av............................................................................
ENSGGOP00000013700  ..............................................................................
ENSGGOP00000008485  nnyfv.........................................................................
ENSGGOP00000011966  ..............................................................................
ENSGGOP00000023645  ..............................................................................
ENSGGOP00000028176  ..............................................................................
ENSGGOP00000004508  ..............................................................................
ENSGGOP00000018206  ..............................................................................
ENSGGOP00000006739  sdqdepdsafeatqyffeditpecthvvgldsrskqgaddgfvtvslkpdkgkransqenrnylrlwtpenkskskna
ENSGGOP00000023979  sdqdepdsafeatqyffeditpecthvvgldsrskqgaddgfvtvslkpdkgkransqenrnylrlwtpenkskskna
ENSGGOP00000012342  ..............................................................................
ENSGGOP00000023206  ..............................................................................
ENSGGOP00000001608  ..............................................................................
ENSGGOP00000010042  nn............................................................................
ENSGGOP00000028006  ..............................................................................
ENSGGOP00000025507  g.............................................................................
ENSGGOP00000020583  ..............................................................................
ENSGGOP00000012393  ..............................................................................
ENSGGOP00000016724  ymrnhkaesselvrnshhtwly........................................................
ENSGGOP00000023938  ..............................................................................
ENSGGOP00000022364  ..............................................................................
ENSGGOP00000005326  ..............................................................................
ENSGGOP00000008587  efhdve........................................................................
ENSGGOP00000002982  lspeeaesalea..................................................................
ENSGGOP00000006523  ..............................................................................
ENSGGOP00000014183  ..............................................................................
ENSGGOP00000018435  ..............................................................................
ENSGGOP00000021184  llfklhippaytevkskdaskgdelskeellyfsqlhvskpanekeaesakhspekgkgkidiqaylsqwq.......
ENSGGOP00000015096  m.............................................................................
ENSGGOP00000024360  ..............................................................................
ENSGGOP00000027849  speea.........................................................................
ENSGGOP00000022443  ..............................................................................
ENSGGOP00000013081  ..............................................................................
ENSGGOP00000022610  ..............................................................................
ENSGGOP00000010606  ..............................................................................
ENSGGOP00000026802  ..............................................................................
ENSGGOP00000011774  ldi...........................................................................
ENSGGOP00000002441  ..............................................................................
ENSGGOP00000002021  ..............................................................................
ENSGGOP00000009877  ..............................................................................
ENSGGOP00000016754  ..............................................................................
ENSGGOP00000007308  ..............................................................................
ENSGGOP00000012932  ..............................................................................
ENSGGOP00000012554  ..............................................................................
ENSGGOP00000011621  ..............................................................................
ENSGGOP00000024380  ..............................................................................
ENSGGOP00000000011  ..............................................................................
ENSGGOP00000007649  ..............................................................................
ENSGGOP00000006035  ..............................................................................
ENSGGOP00000011720  ..............................................................................
ENSGGOP00000002269  ..............................................................................
ENSGGOP00000018132  a.............................................................................
ENSGGOP00000017534  ..............................................................................
ENSGGOP00000004508  ..............................................................................
ENSGGOP00000018206  ..............................................................................
ENSGGOP00000016496  ..............................................................................
ENSGGOP00000012932  ..............................................................................
ENSGGOP00000004839  ..............................................................................
ENSGGOP00000008738  shqvsfsyfnaf..................................................................
ENSGGOP00000028586  ..............................................................................
ENSGGOP00000011240  ..............................................................................
ENSGGOP00000007686  ..............................................................................
ENSGGOP00000000151  r.............................................................................
ENSGGOP00000006499  ..............................................................................
ENSGGOP00000023045  klkllfklh.....................................................................
ENSGGOP00000020565  ..............................................................................
ENSGGOP00000012340  ..............................................................................
ENSGGOP00000023745  ..............................................................................
ENSGGOP00000008325  ..............................................................................
ENSGGOP00000022444  ..............................................................................
ENSGGOP00000024026  hqvsfsyfnaf...................................................................
ENSGGOP00000003268  ..............................................................................
ENSGGOP00000012291  qdyfqelrltqeemtiinkl..........................................................
ENSGGOP00000020860  ..............................................................................
ENSGGOP00000004747  ..............................................................................
ENSGGOP00000016725  kvrermtkfiddtmretaepflfvdefltylfsrensiwdekydav................................
ENSGGOP00000027884  kvrermtkfiddtmretaepflfvdefltylfsrensiwdekydav................................
ENSGGOP00000008864  ..............................................................................
ENSGGOP00000024021  ..............................................................................
ENSGGOP00000002559  ..............................................................................
ENSGGOP00000008975  ..............................................................................
ENSGGOP00000015810  knyradsngnsmlsnqdafrlwclfnflsedkyplimvpdeveyllkkvlssmslevsl...................
ENSGGOP00000022677  knyradsngnsmlsnqdafrlwclfnflsedkyplimvpdeveyllkkvlssmslevsl...................
ENSGGOP00000001056  ..............................................................................
ENSGGOP00000024407  ..............................................................................
ENSGGOP00000008333  lnp...........................................................................
ENSGGOP00000005688  dl............................................................................
ENSGGOP00000027880  lnp...........................................................................
ENSGGOP00000015096  ..............................................................................
ENSGGOP00000022419  ehlg..........................................................................
ENSGGOP00000003523  ehlg..........................................................................
ENSGGOP00000007901  ..............................................................................
ENSGGOP00000008530  aleehfrdddegpvsnqgympyl.......................................................
ENSGGOP00000007957  ..............................................................................
ENSGGOP00000010635  e.............................................................................
ENSGGOP00000004392  nhssgss.......................................................................
ENSGGOP00000010370  ..............................................................................
ENSGGOP00000022364  ..............................................................................
ENSGGOP00000015625  g.............................................................................
ENSGGOP00000007654  pfleastlragerpelcrvslpefqqflldyqgelwavdrlqvqefmlsflrdplreieepyffldefvtflfskens
ENSGGOP00000020583  ..............................................................................
ENSGGOP00000013302  lgrvsgprawffctqchcclhlqamhlvyralekepvpsalppslippskr...........................
ENSGGOP00000010930  la............................................................................
ENSGGOP00000005349  kikllyrlh.....................................................................
ENSGGOP00000008253  ..............................................................................
ENSGGOP00000001993  ..............................................................................
ENSGGOP00000024222  ..............................................................................
ENSGGOP00000002875  ..............................................................................
ENSGGOP00000012369  ..............................................................................
ENSGGOP00000011933  ..............................................................................
ENSGGOP00000011848  lv............................................................................
ENSGGOP00000018329  ..............................................................................
ENSGGOP00000000391  ..............................................................................
ENSGGOP00000013508  ..............................................................................
ENSGGOP00000022560  ..............................................................................
ENSGGOP00000019614  l.............................................................................
ENSGGOP00000015110  ..............................................................................
ENSGGOP00000008437  l.............................................................................
ENSGGOP00000016998  ..............................................................................
ENSGGOP00000024026  ..............................................................................
ENSGGOP00000017722  ykq...........................................................................
ENSGGOP00000017757  ..............................................................................
ENSGGOP00000002740  ..............................................................................
ENSGGOP00000012168  ..............................................................................
ENSGGOP00000001815  l.............................................................................
ENSGGOP00000020483  l.............................................................................
ENSGGOP00000020927  l.............................................................................
ENSGGOP00000002387  ..............................................................................
ENSGGOP00000006515  ..............................................................................
ENSGGOP00000008725  ..............................................................................
ENSGGOP00000018073  ..............................................................................
ENSGGOP00000015740  lh............................................................................


                                                                                                    
                                                                                                    
d1kful1               ..............................................................................
ENSGGOP00000000209  ..............................................................................
ENSGGOP00000022972  ..............................................................................
ENSGGOP00000021376  ..............................................................................
ENSGGOP00000009800  ..............................................................................
ENSGGOP00000011095  ..............................................................................
ENSGGOP00000003638  ..............................................................................
ENSGGOP00000025293  ..............................................................................
ENSGGOP00000002483  ..............................................................................
ENSGGOP00000028220  ..............................................................................
ENSGGOP00000017724  ..............................................................................
ENSGGOP00000006566  ..............................................................................
ENSGGOP00000019618  ..............................................................................
ENSGGOP00000008245  ..............................................................................
ENSGGOP00000025102  ..............................................................................
ENSGGOP00000010426  ..............................................................................
ENSGGOP00000015754  ..............................................................................
ENSGGOP00000012299  ..............................................................................
ENSGGOP00000021175  ..............................................................................
ENSGGOP00000019593  ..............................................................................
ENSGGOP00000006396  ..............................................................................
ENSGGOP00000022632  ..............................................................................
ENSGGOP00000011943  ..............................................................................
ENSGGOP00000008286  ..............................................................................
ENSGGOP00000015051  ..............................................................................
ENSGGOP00000024872  ..............................................................................
ENSGGOP00000011390  ..............................................................................
ENSGGOP00000008090  ..............................................................................
ENSGGOP00000006979  ..............................................................................
ENSGGOP00000014947  ..............................................................................
ENSGGOP00000000749  ..............................................................................
ENSGGOP00000022235  ..............................................................................
ENSGGOP00000004772  ..............................................................................
ENSGGOP00000001305  ..............................................................................
ENSGGOP00000009619  ..............................................................................
ENSGGOP00000027707  ..............................................................................
ENSGGOP00000013700  ..............................................................................
ENSGGOP00000026634  ..............................................................................
ENSGGOP00000027354  ..............................................................................
ENSGGOP00000007591  ..............................................................................
ENSGGOP00000024754  ..............................................................................
ENSGGOP00000000341  ..............................................................................
ENSGGOP00000006559  ..............................................................................
ENSGGOP00000001194  ..............................................................................
ENSGGOP00000020610  ..............................................................................
ENSGGOP00000003736  ..............................................................................
ENSGGOP00000004196  ..............................................................................
ENSGGOP00000015532  ..............................................................................
ENSGGOP00000000785  ..............................................................................
ENSGGOP00000014368  ..............................................................................
ENSGGOP00000023413  ..............................................................................
ENSGGOP00000007126  ..............................................................................
ENSGGOP00000008349  ..............................................................................
ENSGGOP00000011020  ..............................................................................
ENSGGOP00000015507  ..............................................................................
ENSGGOP00000012471  ..............................................................................
ENSGGOP00000012549  ..............................................................................
ENSGGOP00000019099  ..............................................................................
ENSGGOP00000003031  ..............................................................................
ENSGGOP00000005101  ..............................................................................
ENSGGOP00000024511  ..............................................................................
ENSGGOP00000018250  ..............................................................................
ENSGGOP00000003074  ..............................................................................
ENSGGOP00000012477  ..............................................................................
ENSGGOP00000010001  ..............................................................................
ENSGGOP00000020622  ..............................................................................
ENSGGOP00000010490  ..............................................................................
ENSGGOP00000015637  ..............................................................................
ENSGGOP00000011144  ..............................................................................
ENSGGOP00000026982  ..............................................................................
ENSGGOP00000003975  ..............................................................................
ENSGGOP00000004885  ..............................................................................
ENSGGOP00000014678  ..............................................................................
ENSGGOP00000013437  ..............................................................................
ENSGGOP00000011390  ..............................................................................
ENSGGOP00000010036  ..............................................................................
ENSGGOP00000027819  ..............................................................................
ENSGGOP00000012841  ..............................................................................
ENSGGOP00000009918  ..............................................................................
ENSGGOP00000012485  ..............................................................................
ENSGGOP00000009782  ..............................................................................
ENSGGOP00000009375  ..............................................................................
ENSGGOP00000023560  ..............................................................................
ENSGGOP00000014947  ..............................................................................
ENSGGOP00000012603  ppvprssssespvvylkdvvcylslletgrpqdklefm........................................
ENSGGOP00000017349  ..............................................................................
ENSGGOP00000003738  ..............................................................................
ENSGGOP00000007513  ..............................................................................
ENSGGOP00000022235  ..............................................................................
ENSGGOP00000001928  ..............................................................................
ENSGGOP00000013652  ..............................................................................
ENSGGOP00000006109  ..............................................................................
ENSGGOP00000003219  ..............................................................................
ENSGGOP00000022428  ..............................................................................
ENSGGOP00000017119  ..............................................................................
ENSGGOP00000003545  ..............................................................................
ENSGGOP00000023406  ..............................................................................
ENSGGOP00000007856  ..............................................................................
ENSGGOP00000011697  ..............................................................................
ENSGGOP00000018636  ..............................................................................
ENSGGOP00000017641  ..............................................................................
ENSGGOP00000013074  ..............................................................................
ENSGGOP00000007661  ..............................................................................
ENSGGOP00000020763  ..............................................................................
ENSGGOP00000005624  ..............................................................................
ENSGGOP00000025395  ..............................................................................
ENSGGOP00000019250  ..............................................................................
ENSGGOP00000020096  ..............................................................................
ENSGGOP00000000796  ..............................................................................
ENSGGOP00000004196  ..............................................................................
ENSGGOP00000002530  ..............................................................................
ENSGGOP00000015006  ..............................................................................
ENSGGOP00000016611  ..............................................................................
ENSGGOP00000004209  ..............................................................................
ENSGGOP00000011570  ..............................................................................
ENSGGOP00000006906  ..............................................................................
ENSGGOP00000024832  ..............................................................................
ENSGGOP00000019567  ..............................................................................
ENSGGOP00000009496  ..............................................................................
ENSGGOP00000012555  ..............................................................................
ENSGGOP00000006153  ..............................................................................
ENSGGOP00000008018  ..............................................................................
ENSGGOP00000007513  ..............................................................................
ENSGGOP00000024452  ..............................................................................
ENSGGOP00000005045  ..............................................................................
ENSGGOP00000017287  ..............................................................................
ENSGGOP00000004706  ..............................................................................
ENSGGOP00000022428  ..............................................................................
ENSGGOP00000017119  ..............................................................................
ENSGGOP00000003545  ..............................................................................
ENSGGOP00000004257  ..............................................................................
ENSGGOP00000024127  ..............................................................................
ENSGGOP00000012291  ..............................................................................
ENSGGOP00000004812  ..............................................................................
ENSGGOP00000012046  ..............................................................................
ENSGGOP00000015625  ..............................................................................
ENSGGOP00000008889  ..............................................................................
ENSGGOP00000008482  ..............................................................................
ENSGGOP00000013349  ..............................................................................
ENSGGOP00000011422  ..............................................................................
ENSGGOP00000018846  ..............................................................................
ENSGGOP00000003216  ..............................................................................
ENSGGOP00000021719  ..............................................................................
ENSGGOP00000005693  ..............................................................................
ENSGGOP00000010676  ..............................................................................
ENSGGOP00000007432  ..............................................................................
ENSGGOP00000018435  ..............................................................................
ENSGGOP00000006035  ..............................................................................
ENSGGOP00000025507  ..............................................................................
ENSGGOP00000006035  ..............................................................................
ENSGGOP00000025507  ..............................................................................
ENSGGOP00000003343  ..............................................................................
ENSGGOP00000020870  ..............................................................................
ENSGGOP00000002976  ..............................................................................
ENSGGOP00000024041  ..............................................................................
ENSGGOP00000009817  ..............................................................................
ENSGGOP00000011240  ..............................................................................
ENSGGOP00000008587  ..............................................................................
ENSGGOP00000007432  ..............................................................................
ENSGGOP00000013302  ..............................................................................
ENSGGOP00000024313  ..............................................................................
ENSGGOP00000000552  ..............................................................................
ENSGGOP00000002697  ..............................................................................
ENSGGOP00000016489  ..............................................................................
ENSGGOP00000028006  ..............................................................................
ENSGGOP00000023206  ..............................................................................
ENSGGOP00000006503  ..............................................................................
ENSGGOP00000006509  ..............................................................................
ENSGGOP00000021892  ..............................................................................
ENSGGOP00000004839  ..............................................................................
ENSGGOP00000019168  ..............................................................................
ENSGGOP00000003722  ..............................................................................
ENSGGOP00000007472  ..............................................................................
ENSGGOP00000027338  ..............................................................................
ENSGGOP00000007156  ..............................................................................
ENSGGOP00000024526  ..............................................................................
ENSGGOP00000028098  ..............................................................................
ENSGGOP00000007082  ..............................................................................
ENSGGOP00000023859  ..............................................................................
ENSGGOP00000019080  ..............................................................................
ENSGGOP00000010449  ..............................................................................
ENSGGOP00000000844  ..............................................................................
ENSGGOP00000023819  ..............................................................................
ENSGGOP00000006595  ..............................................................................
ENSGGOP00000006390  ..............................................................................
ENSGGOP00000015096  ..............................................................................
ENSGGOP00000019080  ..............................................................................
ENSGGOP00000002308  ..............................................................................
ENSGGOP00000023711  ..............................................................................
ENSGGOP00000000733  ..............................................................................
ENSGGOP00000023859  ..............................................................................
ENSGGOP00000028529  ..............................................................................
ENSGGOP00000015096  ..............................................................................
ENSGGOP00000002979  ..............................................................................
ENSGGOP00000000348  ..............................................................................
ENSGGOP00000012168  ..............................................................................
ENSGGOP00000021101  ..............................................................................
ENSGGOP00000024236  ..............................................................................
ENSGGOP00000005783  ..............................................................................
ENSGGOP00000011525  ..............................................................................
ENSGGOP00000011629  ..............................................................................
ENSGGOP00000009256  ..............................................................................
ENSGGOP00000022443  ..............................................................................
ENSGGOP00000013081  ..............................................................................
ENSGGOP00000006507  ..............................................................................
ENSGGOP00000026277  ..............................................................................
ENSGGOP00000026775  ..............................................................................
ENSGGOP00000015605  ..............................................................................
ENSGGOP00000013437  ..............................................................................
ENSGGOP00000015096  ..............................................................................
ENSGGOP00000015264  ..............................................................................
ENSGGOP00000019492  ..............................................................................
ENSGGOP00000015242  ..............................................................................
ENSGGOP00000015096  ..............................................................................
ENSGGOP00000011088  ..............................................................................
ENSGGOP00000020157  ..............................................................................
ENSGGOP00000025587  ..............................................................................
ENSGGOP00000002805  ..............................................................................
ENSGGOP00000013256  ..............................................................................
ENSGGOP00000023524  ..............................................................................
ENSGGOP00000013295  ..............................................................................
ENSGGOP00000018258  ..............................................................................
ENSGGOP00000005688  ..............................................................................
ENSGGOP00000007088  ..............................................................................
ENSGGOP00000004418  ..............................................................................
ENSGGOP00000004827  ..............................................................................
ENSGGOP00000023450  ..............................................................................
ENSGGOP00000007087  ..............................................................................
ENSGGOP00000020253  ..............................................................................
ENSGGOP00000027573  ..............................................................................
ENSGGOP00000021162  ..............................................................................
ENSGGOP00000016495  ..............................................................................
ENSGGOP00000005787  ..............................................................................
ENSGGOP00000020487  ..............................................................................
ENSGGOP00000016148  ymsfstalyg....................................................................
ENSGGOP00000015096  ..............................................................................
ENSGGOP00000012603  ..............................................................................
ENSGGOP00000015201  ..............................................................................
ENSGGOP00000024915  ..............................................................................
ENSGGOP00000023450  ..............................................................................
ENSGGOP00000001678  ..............................................................................
ENSGGOP00000024627  ..............................................................................
ENSGGOP00000018908  ..............................................................................
ENSGGOP00000025434  ..............................................................................
ENSGGOP00000006199  ..............................................................................
ENSGGOP00000019261  ..............................................................................
ENSGGOP00000005693  ..............................................................................
ENSGGOP00000001807  ..............................................................................
ENSGGOP00000024313  ..............................................................................
ENSGGOP00000019354  ..............................................................................
ENSGGOP00000018853  ..............................................................................
ENSGGOP00000008614  ..............................................................................
ENSGGOP00000024313  ..............................................................................
ENSGGOP00000000552  ..............................................................................
ENSGGOP00000004747  ..............................................................................
ENSGGOP00000013302  ..............................................................................
ENSGGOP00000020941  ..............................................................................
ENSGGOP00000000504  ..............................................................................
ENSGGOP00000024502  ..............................................................................
ENSGGOP00000011848  ..............................................................................
ENSGGOP00000024360  ..............................................................................
ENSGGOP00000000733  ..............................................................................
ENSGGOP00000024360  ..............................................................................
ENSGGOP00000021249  ..............................................................................
ENSGGOP00000019415  ..............................................................................
ENSGGOP00000013501  ..............................................................................
ENSGGOP00000021515  ..............................................................................
ENSGGOP00000005854  ..............................................................................
ENSGGOP00000016618  ..............................................................................
ENSGGOP00000024091  ..............................................................................
ENSGGOP00000013700  ..............................................................................
ENSGGOP00000008485  ..............................................................................
ENSGGOP00000011966  ..............................................................................
ENSGGOP00000023645  ..............................................................................
ENSGGOP00000028176  ..............................................................................
ENSGGOP00000004508  ..............................................................................
ENSGGOP00000018206  ..............................................................................
ENSGGOP00000006739  kdlpklnqgqfielcktmynmfsedpneqelyhataavtsllleigevgklfvaqpakeggsggsgpschqgipgvlf
ENSGGOP00000023979  kdlpklnqgqfielcktmynmfsedpneqelyhataavtsllleigevgklfvaqpakeggsggsgpschqgipgvlf
ENSGGOP00000012342  ..............................................................................
ENSGGOP00000023206  ..............................................................................
ENSGGOP00000001608  ..............................................................................
ENSGGOP00000010042  ..............................................................................
ENSGGOP00000028006  ..............................................................................
ENSGGOP00000025507  ..............................................................................
ENSGGOP00000020583  ..............................................................................
ENSGGOP00000012393  ..............................................................................
ENSGGOP00000016724  ..............................................................................
ENSGGOP00000023938  ..............................................................................
ENSGGOP00000022364  ..............................................................................
ENSGGOP00000005326  ..............................................................................
ENSGGOP00000008587  ..............................................................................
ENSGGOP00000002982  ..............................................................................
ENSGGOP00000006523  ..............................................................................
ENSGGOP00000014183  ..............................................................................
ENSGGOP00000018435  ..............................................................................
ENSGGOP00000021184  ..............................................................................
ENSGGOP00000015096  ..............................................................................
ENSGGOP00000024360  ..............................................................................
ENSGGOP00000027849  ..............................................................................
ENSGGOP00000022443  ..............................................................................
ENSGGOP00000013081  ..............................................................................
ENSGGOP00000022610  ..............................................................................
ENSGGOP00000010606  ..............................................................................
ENSGGOP00000026802  ..............................................................................
ENSGGOP00000011774  ..............................................................................
ENSGGOP00000002441  ..............................................................................
ENSGGOP00000002021  ..............................................................................
ENSGGOP00000009877  ..............................................................................
ENSGGOP00000016754  ..............................................................................
ENSGGOP00000007308  ..............................................................................
ENSGGOP00000012932  ..............................................................................
ENSGGOP00000012554  ..............................................................................
ENSGGOP00000011621  ..............................................................................
ENSGGOP00000024380  ..............................................................................
ENSGGOP00000000011  ..............................................................................
ENSGGOP00000007649  ..............................................................................
ENSGGOP00000006035  ..............................................................................
ENSGGOP00000011720  ..............................................................................
ENSGGOP00000002269  ..............................................................................
ENSGGOP00000018132  ..............................................................................
ENSGGOP00000017534  ..............................................................................
ENSGGOP00000004508  ..............................................................................
ENSGGOP00000018206  ..............................................................................
ENSGGOP00000016496  ..............................................................................
ENSGGOP00000012932  ..............................................................................
ENSGGOP00000004839  ..............................................................................
ENSGGOP00000008738  ..............................................................................
ENSGGOP00000028586  ..............................................................................
ENSGGOP00000011240  ..............................................................................
ENSGGOP00000007686  ..............................................................................
ENSGGOP00000000151  ..............................................................................
ENSGGOP00000006499  ..............................................................................
ENSGGOP00000023045  ..............................................................................
ENSGGOP00000020565  ..............................................................................
ENSGGOP00000012340  ..............................................................................
ENSGGOP00000023745  ..............................................................................
ENSGGOP00000008325  ..............................................................................
ENSGGOP00000022444  ..............................................................................
ENSGGOP00000024026  ..............................................................................
ENSGGOP00000003268  ..............................................................................
ENSGGOP00000012291  ..............................................................................
ENSGGOP00000020860  ..............................................................................
ENSGGOP00000004747  ..............................................................................
ENSGGOP00000016725  ..............................................................................
ENSGGOP00000027884  ..............................................................................
ENSGGOP00000008864  ..............................................................................
ENSGGOP00000024021  ..............................................................................
ENSGGOP00000002559  ..............................................................................
ENSGGOP00000008975  ..............................................................................
ENSGGOP00000015810  ..............................................................................
ENSGGOP00000022677  ..............................................................................
ENSGGOP00000001056  ..............................................................................
ENSGGOP00000024407  ..............................................................................
ENSGGOP00000008333  ..............................................................................
ENSGGOP00000005688  ..............................................................................
ENSGGOP00000027880  ..............................................................................
ENSGGOP00000015096  ..............................................................................
ENSGGOP00000022419  ..............................................................................
ENSGGOP00000003523  ..............................................................................
ENSGGOP00000007901  ..............................................................................
ENSGGOP00000008530  ..............................................................................
ENSGGOP00000007957  ..............................................................................
ENSGGOP00000010635  ..............................................................................
ENSGGOP00000004392  ..............................................................................
ENSGGOP00000010370  ..............................................................................
ENSGGOP00000022364  ..............................................................................
ENSGGOP00000015625  ..............................................................................
ENSGGOP00000007654  vwnsql........................................................................
ENSGGOP00000020583  ..............................................................................
ENSGGOP00000013302  ..............................................................................
ENSGGOP00000010930  ..............................................................................
ENSGGOP00000005349  ..............................................................................
ENSGGOP00000008253  ..............................................................................
ENSGGOP00000001993  ..............................................................................
ENSGGOP00000024222  ..............................................................................
ENSGGOP00000002875  ..............................................................................
ENSGGOP00000012369  ..............................................................................
ENSGGOP00000011933  ..............................................................................
ENSGGOP00000011848  ..............................................................................
ENSGGOP00000018329  ..............................................................................
ENSGGOP00000000391  ..............................................................................
ENSGGOP00000013508  ..............................................................................
ENSGGOP00000022560  ..............................................................................
ENSGGOP00000019614  ..............................................................................
ENSGGOP00000015110  ..............................................................................
ENSGGOP00000008437  ..............................................................................
ENSGGOP00000016998  ..............................................................................
ENSGGOP00000024026  ..............................................................................
ENSGGOP00000017722  ..............................................................................
ENSGGOP00000017757  ..............................................................................
ENSGGOP00000002740  ..............................................................................
ENSGGOP00000012168  ..............................................................................
ENSGGOP00000001815  ..............................................................................
ENSGGOP00000020483  ..............................................................................
ENSGGOP00000020927  ..............................................................................
ENSGGOP00000002387  ..............................................................................
ENSGGOP00000006515  ..............................................................................
ENSGGOP00000008725  ..............................................................................
ENSGGOP00000018073  ..............................................................................
ENSGGOP00000015740  ..............................................................................


                                                                                                    
                                                                                                    
d1kful1               ..............................................................................
ENSGGOP00000000209  ..............................................................................
ENSGGOP00000022972  ..............................................................................
ENSGGOP00000021376  ..............................................................................
ENSGGOP00000009800  ..............................................................................
ENSGGOP00000011095  ..............................................................................
ENSGGOP00000003638  ..............................................................................
ENSGGOP00000025293  ..............................................................................
ENSGGOP00000002483  ..............................................................................
ENSGGOP00000028220  ..............................................................................
ENSGGOP00000017724  ..............................................................................
ENSGGOP00000006566  ..............................................................................
ENSGGOP00000019618  ..............................................................................
ENSGGOP00000008245  ..............................................................................
ENSGGOP00000025102  ..............................................................................
ENSGGOP00000010426  ..............................................................................
ENSGGOP00000015754  ..............................................................................
ENSGGOP00000012299  ..............................................................................
ENSGGOP00000021175  ..............................................................................
ENSGGOP00000019593  ..............................................................................
ENSGGOP00000006396  ..............................................................................
ENSGGOP00000022632  ..............................................................................
ENSGGOP00000011943  ..............................................................................
ENSGGOP00000008286  ..............................................................................
ENSGGOP00000015051  ..............................................................................
ENSGGOP00000024872  ..............................................................................
ENSGGOP00000011390  ..............................................................................
ENSGGOP00000008090  ..............................................................................
ENSGGOP00000006979  ..............................................................................
ENSGGOP00000014947  ..............................................................................
ENSGGOP00000000749  ..............................................................................
ENSGGOP00000022235  ..............................................................................
ENSGGOP00000004772  ..............................................................................
ENSGGOP00000001305  ..............................................................................
ENSGGOP00000009619  ..............................................................................
ENSGGOP00000027707  ..............................................................................
ENSGGOP00000013700  ..............................................................................
ENSGGOP00000026634  ..............................................................................
ENSGGOP00000027354  ..............................................................................
ENSGGOP00000007591  ..............................................................................
ENSGGOP00000024754  ..............................................................................
ENSGGOP00000000341  ..............................................................................
ENSGGOP00000006559  ..............................................................................
ENSGGOP00000001194  ..............................................................................
ENSGGOP00000020610  ..............................................................................
ENSGGOP00000003736  ..............................................................................
ENSGGOP00000004196  ..............................................................................
ENSGGOP00000015532  ..............................................................................
ENSGGOP00000000785  ..............................................................................
ENSGGOP00000014368  ..............................................................................
ENSGGOP00000023413  ..............................................................................
ENSGGOP00000007126  ..............................................................................
ENSGGOP00000008349  ..............................................................................
ENSGGOP00000011020  ..............................................................................
ENSGGOP00000015507  ..............................................................................
ENSGGOP00000012471  ..............................................................................
ENSGGOP00000012549  ..............................................................................
ENSGGOP00000019099  ..............................................................................
ENSGGOP00000003031  ..............................................................................
ENSGGOP00000005101  ..............................................................................
ENSGGOP00000024511  ..............................................................................
ENSGGOP00000018250  ..............................................................................
ENSGGOP00000003074  ..............................................................................
ENSGGOP00000012477  ..............................................................................
ENSGGOP00000010001  ..............................................................................
ENSGGOP00000020622  ..............................................................................
ENSGGOP00000010490  ..............................................................................
ENSGGOP00000015637  ..............................................................................
ENSGGOP00000011144  ..............................................................................
ENSGGOP00000026982  ..............................................................................
ENSGGOP00000003975  ..............................................................................
ENSGGOP00000004885  ..............................................................................
ENSGGOP00000014678  ..............................................................................
ENSGGOP00000013437  ..............................................................................
ENSGGOP00000011390  ..............................................................................
ENSGGOP00000010036  ..............................................................................
ENSGGOP00000027819  ..............................................................................
ENSGGOP00000012841  ..............................................................................
ENSGGOP00000009918  ..............................................................................
ENSGGOP00000012485  ..............................................................................
ENSGGOP00000009782  ..............................................................................
ENSGGOP00000009375  ..............................................................................
ENSGGOP00000023560  ..............................................................................
ENSGGOP00000014947  ..............................................................................
ENSGGOP00000012603  ..............................................................................
ENSGGOP00000017349  ..............................................................................
ENSGGOP00000003738  ..............................................................................
ENSGGOP00000007513  ..............................................................................
ENSGGOP00000022235  ..............................................................................
ENSGGOP00000001928  ..............................................................................
ENSGGOP00000013652  ..............................................................................
ENSGGOP00000006109  ..............................................................................
ENSGGOP00000003219  ..............................................................................
ENSGGOP00000022428  ..............................................................................
ENSGGOP00000017119  ..............................................................................
ENSGGOP00000003545  ..............................................................................
ENSGGOP00000023406  ..............................................................................
ENSGGOP00000007856  ..............................................................................
ENSGGOP00000011697  ..............................................................................
ENSGGOP00000018636  ..............................................................................
ENSGGOP00000017641  ..............................................................................
ENSGGOP00000013074  ..............................................................................
ENSGGOP00000007661  ..............................................................................
ENSGGOP00000020763  ..............................................................................
ENSGGOP00000005624  ..............................................................................
ENSGGOP00000025395  ..............................................................................
ENSGGOP00000019250  ..............................................................................
ENSGGOP00000020096  ..............................................................................
ENSGGOP00000000796  ..............................................................................
ENSGGOP00000004196  ..............................................................................
ENSGGOP00000002530  ..............................................................................
ENSGGOP00000015006  ..............................................................................
ENSGGOP00000016611  ..............................................................................
ENSGGOP00000004209  ..............................................................................
ENSGGOP00000011570  ..............................................................................
ENSGGOP00000006906  ..............................................................................
ENSGGOP00000024832  ..............................................................................
ENSGGOP00000019567  ..............................................................................
ENSGGOP00000009496  ..............................................................................
ENSGGOP00000012555  ..............................................................................
ENSGGOP00000006153  ..............................................................................
ENSGGOP00000008018  ..............................................................................
ENSGGOP00000007513  ..............................................................................
ENSGGOP00000024452  ..............................................................................
ENSGGOP00000005045  ..............................................................................
ENSGGOP00000017287  ..............................................................................
ENSGGOP00000004706  ..............................................................................
ENSGGOP00000022428  ..............................................................................
ENSGGOP00000017119  ..............................................................................
ENSGGOP00000003545  ..............................................................................
ENSGGOP00000004257  ..............................................................................
ENSGGOP00000024127  ..............................................................................
ENSGGOP00000012291  ..............................................................................
ENSGGOP00000004812  ..............................................................................
ENSGGOP00000012046  ..............................................................................
ENSGGOP00000015625  ..............................................................................
ENSGGOP00000008889  ..............................................................................
ENSGGOP00000008482  ..............................................................................
ENSGGOP00000013349  ..............................................................................
ENSGGOP00000011422  ..............................................................................
ENSGGOP00000018846  ..............................................................................
ENSGGOP00000003216  ..............................................................................
ENSGGOP00000021719  ..............................................................................
ENSGGOP00000005693  ..............................................................................
ENSGGOP00000010676  ..............................................................................
ENSGGOP00000007432  ..............................................................................
ENSGGOP00000018435  ..............................................................................
ENSGGOP00000006035  ..............................................................................
ENSGGOP00000025507  ..............................................................................
ENSGGOP00000006035  ..............................................................................
ENSGGOP00000025507  ..............................................................................
ENSGGOP00000003343  ..............................................................................
ENSGGOP00000020870  ..............................................................................
ENSGGOP00000002976  ..............................................................................
ENSGGOP00000024041  ..............................................................................
ENSGGOP00000009817  ..............................................................................
ENSGGOP00000011240  ..............................................................................
ENSGGOP00000008587  ..............................................................................
ENSGGOP00000007432  ..............................................................................
ENSGGOP00000013302  ..............................................................................
ENSGGOP00000024313  ..............................................................................
ENSGGOP00000000552  ..............................................................................
ENSGGOP00000002697  ..............................................................................
ENSGGOP00000016489  ..............................................................................
ENSGGOP00000028006  ..............................................................................
ENSGGOP00000023206  ..............................................................................
ENSGGOP00000006503  ..............................................................................
ENSGGOP00000006509  ..............................................................................
ENSGGOP00000021892  ..............................................................................
ENSGGOP00000004839  ..............................................................................
ENSGGOP00000019168  ..............................................................................
ENSGGOP00000003722  ..............................................................................
ENSGGOP00000007472  ..............................................................................
ENSGGOP00000027338  ..............................................................................
ENSGGOP00000007156  ..............................................................................
ENSGGOP00000024526  ..............................................................................
ENSGGOP00000028098  ..............................................................................
ENSGGOP00000007082  ..............................................................................
ENSGGOP00000023859  ..............................................................................
ENSGGOP00000019080  ..............................................................................
ENSGGOP00000010449  ..............................................................................
ENSGGOP00000000844  ..............................................................................
ENSGGOP00000023819  ..............................................................................
ENSGGOP00000006595  ..............................................................................
ENSGGOP00000006390  ..............................................................................
ENSGGOP00000015096  ..............................................................................
ENSGGOP00000019080  ..............................................................................
ENSGGOP00000002308  ..............................................................................
ENSGGOP00000023711  ..............................................................................
ENSGGOP00000000733  ..............................................................................
ENSGGOP00000023859  ..............................................................................
ENSGGOP00000028529  ..............................................................................
ENSGGOP00000015096  ..............................................................................
ENSGGOP00000002979  ..............................................................................
ENSGGOP00000000348  ..............................................................................
ENSGGOP00000012168  ..............................................................................
ENSGGOP00000021101  ..............................................................................
ENSGGOP00000024236  ..............................................................................
ENSGGOP00000005783  ..............................................................................
ENSGGOP00000011525  ..............................................................................
ENSGGOP00000011629  ..............................................................................
ENSGGOP00000009256  ..............................................................................
ENSGGOP00000022443  ..............................................................................
ENSGGOP00000013081  ..............................................................................
ENSGGOP00000006507  ..............................................................................
ENSGGOP00000026277  ..............................................................................
ENSGGOP00000026775  ..............................................................................
ENSGGOP00000015605  ..............................................................................
ENSGGOP00000013437  ..............................................................................
ENSGGOP00000015096  ..............................................................................
ENSGGOP00000015264  ..............................................................................
ENSGGOP00000019492  ..............................................................................
ENSGGOP00000015242  ..............................................................................
ENSGGOP00000015096  ..............................................................................
ENSGGOP00000011088  ..............................................................................
ENSGGOP00000020157  ..............................................................................
ENSGGOP00000025587  ..............................................................................
ENSGGOP00000002805  ..............................................................................
ENSGGOP00000013256  ..............................................................................
ENSGGOP00000023524  ..............................................................................
ENSGGOP00000013295  ..............................................................................
ENSGGOP00000018258  ..............................................................................
ENSGGOP00000005688  ..............................................................................
ENSGGOP00000007088  ..............................................................................
ENSGGOP00000004418  ..............................................................................
ENSGGOP00000004827  ..............................................................................
ENSGGOP00000023450  ..............................................................................
ENSGGOP00000007087  ..............................................................................
ENSGGOP00000020253  ..............................................................................
ENSGGOP00000027573  ..............................................................................
ENSGGOP00000021162  ..............................................................................
ENSGGOP00000016495  ..............................................................................
ENSGGOP00000005787  ..............................................................................
ENSGGOP00000020487  ..............................................................................
ENSGGOP00000016148  ..............................................................................
ENSGGOP00000015096  ..............................................................................
ENSGGOP00000012603  ..............................................................................
ENSGGOP00000015201  ..............................................................................
ENSGGOP00000024915  ..............................................................................
ENSGGOP00000023450  ..............................................................................
ENSGGOP00000001678  ..............................................................................
ENSGGOP00000024627  ..............................................................................
ENSGGOP00000018908  ..............................................................................
ENSGGOP00000025434  ..............................................................................
ENSGGOP00000006199  ..............................................................................
ENSGGOP00000019261  ..............................................................................
ENSGGOP00000005693  ..............................................................................
ENSGGOP00000001807  ..............................................................................
ENSGGOP00000024313  ..............................................................................
ENSGGOP00000019354  ..............................................................................
ENSGGOP00000018853  ..............................................................................
ENSGGOP00000008614  ..............................................................................
ENSGGOP00000024313  ..............................................................................
ENSGGOP00000000552  ..............................................................................
ENSGGOP00000004747  ..............................................................................
ENSGGOP00000013302  ..............................................................................
ENSGGOP00000020941  ..............................................................................
ENSGGOP00000000504  ..............................................................................
ENSGGOP00000024502  ..............................................................................
ENSGGOP00000011848  ..............................................................................
ENSGGOP00000024360  ..............................................................................
ENSGGOP00000000733  ..............................................................................
ENSGGOP00000024360  ..............................................................................
ENSGGOP00000021249  ..............................................................................
ENSGGOP00000019415  ..............................................................................
ENSGGOP00000013501  ..............................................................................
ENSGGOP00000021515  ..............................................................................
ENSGGOP00000005854  ..............................................................................
ENSGGOP00000016618  ..............................................................................
ENSGGOP00000024091  ..............................................................................
ENSGGOP00000013700  ..............................................................................
ENSGGOP00000008485  ..............................................................................
ENSGGOP00000011966  ..............................................................................
ENSGGOP00000023645  ..............................................................................
ENSGGOP00000028176  ..............................................................................
ENSGGOP00000004508  ..............................................................................
ENSGGOP00000018206  ..............................................................................
ENSGGOP00000006739  pkkgpgqpyvvesveplpaslapdseehslggqmedikledssprdngacssmlisdddtkddssmssysvlsagshe
ENSGGOP00000023979  pkkgpgqpyvvesveplpaslapdseehslggqmedikledssprdngacssmlisdddtkddssmssysvlsagshe
ENSGGOP00000012342  ..............................................................................
ENSGGOP00000023206  ..............................................................................
ENSGGOP00000001608  ..............................................................................
ENSGGOP00000010042  ..............................................................................
ENSGGOP00000028006  ..............................................................................
ENSGGOP00000025507  ..............................................................................
ENSGGOP00000020583  ..............................................................................
ENSGGOP00000012393  ..............................................................................
ENSGGOP00000016724  ..............................................................................
ENSGGOP00000023938  ..............................................................................
ENSGGOP00000022364  ..............................................................................
ENSGGOP00000005326  ..............................................................................
ENSGGOP00000008587  ..............................................................................
ENSGGOP00000002982  ..............................................................................
ENSGGOP00000006523  ..............................................................................
ENSGGOP00000014183  ..............................................................................
ENSGGOP00000018435  ..............................................................................
ENSGGOP00000021184  ..............................................................................
ENSGGOP00000015096  ..............................................................................
ENSGGOP00000024360  ..............................................................................
ENSGGOP00000027849  ..............................................................................
ENSGGOP00000022443  ..............................................................................
ENSGGOP00000013081  ..............................................................................
ENSGGOP00000022610  ..............................................................................
ENSGGOP00000010606  ..............................................................................
ENSGGOP00000026802  ..............................................................................
ENSGGOP00000011774  ..............................................................................
ENSGGOP00000002441  ..............................................................................
ENSGGOP00000002021  ..............................................................................
ENSGGOP00000009877  ..............................................................................
ENSGGOP00000016754  ..............................................................................
ENSGGOP00000007308  ..............................................................................
ENSGGOP00000012932  ..............................................................................
ENSGGOP00000012554  ..............................................................................
ENSGGOP00000011621  ..............................................................................
ENSGGOP00000024380  ..............................................................................
ENSGGOP00000000011  ..............................................................................
ENSGGOP00000007649  ..............................................................................
ENSGGOP00000006035  ..............................................................................
ENSGGOP00000011720  ..............................................................................
ENSGGOP00000002269  ..............................................................................
ENSGGOP00000018132  ..............................................................................
ENSGGOP00000017534  ..............................................................................
ENSGGOP00000004508  ..............................................................................
ENSGGOP00000018206  ..............................................................................
ENSGGOP00000016496  ..............................................................................
ENSGGOP00000012932  ..............................................................................
ENSGGOP00000004839  ..............................................................................
ENSGGOP00000008738  ..............................................................................
ENSGGOP00000028586  ..............................................................................
ENSGGOP00000011240  ..............................................................................