SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

EF-hand alignments

These alignments are sequences aligned to the 0043728 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1sraa_                .............................................................................
hFl_ENSPANP00000005664 lrpevmqdllestdfteheiqewykgflrdcpsghlsmeefkkiygnffpyg.........................
hFl_ENSPANP00000015843 lrpemlqdlrentefselelqewykgflkdcptgilnvdefkkiyanffpy..........................
hFl_ENSPANP00000018838 lkpevveeltrktyftekevqqwykgfikdcpsgqldaagfqkiykqffpfgdp.......................
hFl_ENSPANP00000000687 ggggggggtamrilggvisaiseaaaqynpepppprthysnieaneseevrqfrrlfaqlagddmevsatelmniln
hFl_ENSPANP00000011132 lemcshfdadeikrlgkrfkkldldnsgslsveefmslpelq...................................
hFl_ENSPANP00000011888 pfllfqadqlteeqiaefkeafslfdkdgdgtittkelgtv....................................
hFl_ENSPANP00000012946 mgkqnsklrpevlqdlrenteftdhelqewykgflkdcptghltvdefkkiyanffp....................
hFl_ENSPANP00000015640 rshhefkeafslfdkdgdgtittkelgtvm...............................................
hFl_ENSPANP00000008517 adqlteeqitefkeafslfdkdgdgcittrelgtvmrslgqnpteae..............................
hFl_ENSPANP00000017051 vspmtclkkhwmklafmtntngkipvrsitrtfasgktekvifqalkelglpsgkndeieptaftyekfyeltqki.
hFl_ENSPANP00000008208 mgkqnsklapevmedlvkstefnehelkqwykgflkdcpsgrlnleefqqlyvkffpy...................
hFl_ENSPANP00000000685 hpkmtelyqsladlnnvrfsayrtamklrrlqkalcldllslsaacdaldqhnlkqndqpmdilqiinclttiydr.
hFl_ENSPANP00000001217 .............................................................................
hFl_ENSPANP00000009011 mgktnsklapevledlvqntefseqelkqwykgflkdcpsgilnleefqqlyikffpyg..................
hFl_ENSPANP00000016439 gssdqeseeqqqfrnifkqiagddmeicadelkkvlntvvnkhkdl...............................
hFl_ENSPANP00000020904 rpegleqlqeqtkftrkelqvlyrgfknecpsgivneenfkqiysqffpqgdss.......................
hFl_ENSPANP00000011992 .............................................................................
hFl_ENSPANP00000011142 astdiagleesfrkfaihgdpkasgqemngknwaklckdckvadgkavtgtdvdivfskvkgksarv..........
hFl_ENSPANP00000008176 srntflrkaytklklqvnqdgripvknilkmfsadkkrvetalescglnfnrsesirpdefsle.............
hFl_ENSPANP00000016326 srstfldkilvklkmqlnsegkipvknffqmfpadrkrveaalsachlpkgkndainpedfpepvyksflmsl....
hFl_ENSPANP00000005573 psaaptsqkrkvapkpel...........................................................
hFl_ENSPANP00000018511 rpealelleaqskftkkelqilyrgfknecpsgvvneetfkeiysqffpqgds........................
hFl_ENSPANP00000007984 er...........................................................................
hFl_ENSPANP00000009334 geltpeeeaeyksafsavdtngsgtinaqelgaalkamgknls..................................
hFl_ENSPANP00000011977 makerglispsdfaqlqkymeystkkvsdvlklfedgemakyvqgdaigyegfqqflriylev..............
hFl_ENSPANP00000006880 makerglispsdfaqlqkymeystkkvsdvlklfedgemakyvqgdaigyegfqqflriylev..............
hFl_ENSPANP00000016389 fshsqitrlysrftsldkgengtlsredfqripelainplgdriinaffpegedqvnfrgfmrtlahfrpiedneks
hFl_ENSPANP00000017625 aearsylseemiaefkaafdmfdadgggdisvkelgtvmrmlgqtpt..............................
hFl_ENSPANP00000020753 kpelteeqkqeireafdlfdadgtgtidvkelkvamralgfepkkeeikk...........................
hFl_ENSPANP00000011482 qpegldqlqaqtkftkkelqslyrgfknecptglvde........................................
hFl_ENSPANP00000008596 hpkmtelyqtladlnnikfsayrtamklrrvqkalrldlvtlttaleifnehdlqasehvmdvv.............
hFl_ENSPANP00000014722 leqleaqtnftkrelqvlyrgfknecpsgvvned...........................................
hFl_ENSPANP00000010579 lpdeqvlseeeidenfkalfrqlagedmeisvkelrtilnriiskhkdlrtkgfsl.....................
hFl_ENSPANP00000018638 dplygyfaavagqdgqidadelqrcltqsgiaggykpfnlet...................................
hFl_ENSPANP00000007213 lsaleeafrrfavhgdtratgremhgknwsklckdcqvidgrnvtvtdvdivfskikgks.................
hFl_ENSPANP00000001594 srntflrkaytklklqvnqdgripvknilkmfsadkkrvetalescglnfnsesirpdefsleiferflnkl.....
hFl_ENSPANP00000002108 klrhw........................................................................
hFl_ENSPANP00000007118 rthd.........................................................................
hFl_ENSPANP00000006887 iseddiddgfrrlfaqlagedaeisafelqtilrrvlakrqdiksdgfsiet.........................
hFl_ENSPANP00000020829 thtwi........................................................................
hFl_ENSPANP00000004533 aveqlteeqknefkaafdifvlgaedgcistkelgkvmrmlgqnptpeelqemidevdedgsgtvdf..........
hFl_ENSPANP00000005357 ppnvdpeayswfqsvdsdhsgyismkelkqalvncnwssf.....................................
hFl_ENSPANP00000014595 ektfnrfaafgessssgtemnnknfsklckdcgimdgktvtstdvdivfskvkaknart..................
hFl_ENSPANP00000019694 nsksgalskeileelqlntkfseeelsswyqsflrdcpsgritqqqfqsiyakffpd....................
hFl_ENSPANP00000012647 elsstechqwykkfmtecpsgqltlyefrqffglknlsps.....................................
hFl_ENSPANP00000011841 ptppdqeteeelrfralfeqvagedmevtaeeleyvlnavlrk..................................
hFl_ENSPANP00000007138 lseeqkqeikdafelfdtdkdeaidyhelkvamralgfdvkka..................................
hFl_ENSPANP00000005603 qterlsaeqikeykgvfemfdeegngevktgelerlmsllginptkselasmakdvdrdnkgffncdgflalmgvyh
hFl_ENSPANP00000003537 nmrt.........................................................................
hFl_ENSPANP00000016730 fdqsqiqefke..................................................................
hFl_ENSPANP00000004388 twflskiqddfrggkinlektqrllekldircsyih.........................................
hFl_ENSPANP00000004958 fdqsqiqefke..................................................................
hFl_ENSPANP00000017808 ytyfstvagqdgeldaeelqrcltqsgisgtyspfslet......................................
hFl_ENSPANP00000006158 ekwahlspsefsqlqkyaeystkklkdvleefhgngvlakynpegkqdil...........................
hFl_ENSPANP00000000685 hledkyrylfkqvssstgfcdqrrlglllhdsiqiprqlgevasfggsniepsvrs.....................
hFl_ENSPANP00000001746 lrpeeieelreafrefdkdkdgyincrdlgncmrtmgymptemelielsqqinmnlgghvdfddfvelmgpkllaet
hFl_ENSPANP00000005266 relrpeeieelqvafqefdrdrdgyigcrelgacmrtlgymptemelieisqqisggkvdfedfvelmgpkllaeta
hFl_ENSPANP00000011699 relgpeeldelqaafeefdtdhdgyishrelgdcmrtlgymptemellevsqhikmrmggrvdfeefveligpklre
hFl_ENSPANP00000001618 ptaacqeaepptryetlfqaldrngdgvvdigelqeglrnlgiplgqdae...........................
hFl_ENSPANP00000010432 erwvsltpeefdqlqkyseysskkikdvltefnesgslkqydphepisydvfklfmrayle................
hFl_ENSPANP00000019362 dpdhrlrlwrlfqtldvnrdgglcvndlavglrrlglhrt.....................................
hFl_ENSPANP00000005159 lgqdeieelreaflefdkdrdgfisckdlgnlmrtmgymptemelielgqqirmnlggrvdfddfvelmtpkllaet
hFl_ENSPANP00000011834 fnkdqleefkeafelfdrvgdgkilysqcgdvmralgqnptnaevlkvlgnpksdelksrrvdfetflpmlqavakn
hFl_ENSPANP00000004357 emraqnfdvirlstyrtacklrfvqkrcnlhlvdiwnmieafrdnglntldhtteisvs..................
hFl_ENSPANP00000010858 tprfmwlktvfeaadvdgngimledtsvelikqlnptlkeakirlkfkeiqkskekl....................
hFl_ENSPANP00000010399 yqltkapahifwrercgarcvlpwaefesllgtchpvepgctalalrtt............................
hFl_ENSPANP00000004118 tfritkadaaefwrkafgektivpwksfrqalhevhpissgleamalk.............................
hFl_ENSPANP00000010678 ftedqtaefkeafqlfdrtgdgkilysqcgdvmralgqnptnaevlkvlgnpksdemnvkvldfehflpml......
hFl_ENSPANP00000008201 qnfdvirlstyrtacklrfvqkrcnlhlvdiwnmieafrdnglntldhtteisvsr.....................
hFl_ENSPANP00000000555 ftedqtaefkeafqlfdrtgdgkilysqcgdvmralgqn......................................
hFl_ENSPANP00000014173 glrmakflsqdqineykecfslydkqqrgkikatdlmvamrclgasptpgevqrhlqthgidgngeldfstfltimh
hFl_ENSPANP00000002207 ftedqtaefkeafqlfdrtgdgkilysqcgdvmralgqn......................................
hFl_ENSPANP00000001879 qlfaemraqdldrirlstyrtacklrfvqkkcnlhlvdiwnviealrenalnnldpnielnv...............
hFl_ENSPANP00000005388 a............................................................................
hFl_ENSPANP00000002662 fritkadaaefwrkffgdktivpwkvfrqclhevhqissgleamalk..............................
hFl_ENSPANP00000009999 ikglgr.......................................................................
hFl_ENSPANP00000004626 feqtqiqefk...................................................................
hFl_ENSPANP00000006233 feqtqiqefk...................................................................
hFl_ENSPANP00000002660 qgthvwyrtfmteypsglqtlhefktllglq..............................................
hFl_ENSPANP00000011209 a............................................................................
hFl_ENSPANP00000020345 .............................................................................
hFl_ENSPANP00000020343 .............................................................................
hFl_ENSPANP00000008924 knckhfnkfevncliklfyslvgaverqglvigldrnafrnilhvtfgmtddmimdr....................
hFl_ENSPANP00000015530 fdqsqiqefke..................................................................
hFl_ENSPANP00000008596 vkeklqylfsqvansgsqcdqrhlgvllheaiqvprqlgevaafggs..............................
hFl_ENSPANP00000002265 ftpeqieefkeafmlfdrtpkcemkitygqcgdvlralgqnptqaevlrvlgkp.......................
hFl_ENSPANP00000014191 fdqtqiqefk...................................................................
hFl_ENSPANP00000012413 irretgfsqasllrlhhrfraldrnkkgylsrmdlqqigalavnplgdriiesffpdgsqqvdfpgfvrvlahfrpv
hFl_ENSPANP00000007079 feqaqiqefkeafscidqnrdgiickadlretysqlgkvsvpeeeldamlqegkgpinftvfltlfgeklng.....
hFl_ENSPANP00000012088 daerrqrwgrlfeeldsnkdgrvdvhelrqglarlgggnpdpgaqqgis............................
hFl_ENSPANP00000020865 ftadqieefkeafslfdrtptgemkitygqcgdvlralgqnptnaevlrvlgkpkpeemnvkmldfetflpilqhis
hFl_ENSPANP00000003943 mfdrenkagvnfs................................................................
hFl_ENSPANP00000005422 .............................................................................
hFl_ENSPANP00000015281 iqglarffrqldrdgsrsldadefgrglaklglvldqaeae....................................
hFl_ENSPANP00000017172 .............................................................................
hFl_ENSPANP00000014458 kellaeyqdltfltkqeillahrrfcellpqeqrsveqsllaqvpfeqilslpelkanpfkericrvfstsptrdsl
hFl_ENSPANP00000008201 mldklryvfsqmsdsnglmifskfdqflk................................................
hFl_ENSPANP00000004357 mldklryvfsqmsdsnglmifskfdqflk................................................
hFl_ENSPANP00000004505 plpphthcsnteankseevhqfwrvfaqlagdgikvsgaelmnvlnkavisrtelktrgfgidtcqs..........
hFl_ENSPANP00000012751 eftkisrklkldwdgvrkqldeyasia..................................................
hFl_ENSPANP00000001879 kimdklryifsmisdssgvmvygrydqflrevlklptavfegpsfgyte............................
hFl_ENSPANP00000001065 mgnkqtvftheqleayqdctfftrkeimrlfyryqdlapqlvpldyttcpdvkvpyeligsmpelkdnpfrqriaqv
hFl_ENSPANP00000009095 daerrqrwgrlfeeldsnkdgrvdvhelrqglarlgggnpdpgaqqgis............................
hFl_ENSPANP00000013050 ppvaewavpqssrlkyrqlfnshdktmsghltgpqartilmq...................................
hFl_ENSPANP00000013054 ppvaewavpqssrlkyrqlfnshdktmsghltgpqartilmq...................................
hFl_ENSPANP00000014002 lsraefaeslglkpqdm............................................................
hFl_ENSPANP00000008287 nssypdepwriteeqreyyvnqfrslqpdpssfisgsvaknfftksklsipelsyi.....................
hFl_ENSPANP00000016675 ddpwkitdeqrqyyvnqfktiqpdlngfipgsaakefftksklpilelshi..........................
hFl_ENSPANP00000013999 lsraefaeslglkpqdm............................................................
hFl_ENSPANP00000003565 pteterciesliavfqkyagkdgynytlskteflsfmn.......................................
hFl_ENSPANP00000018211 mgqclryqmhwedleeyqaltfltrneilcihdtflklcppgkyykeatltmdqvsslpalrvnpfrdricrvfshk
hFl_ENSPANP00000010407 afltgknptdayldammneapgpinftmfltmfgeklngtdpedvirnafacfdeeatgtiqedy............
hFl_ENSPANP00000016650 vrderr.......................................................................
hFl_ENSPANP00000001581 pteterciesliavfqkyagkd.......................................................
hFl_ENSPANP00000016006 qqppylhlaeltasq..............................................................
hFl_ENSPANP00000015459 .............................................................................
hFl_ENSPANP00000014312 mgnkqtifteeqldnyqqdctffnkkdilklhsrfyelapnlvpmdyrkspivhvpmsliiqmpelrenpfke....
hFl_ENSPANP00000010990 spktgtsewavpqpsrlkyrqkfnsldksmsgyls..........................................
hFl_ENSPANP00000002202 ltpdeskerl...................................................................
hFl_ENSPANP00000007279 ltpdeskerl...................................................................
hFl_ENSPANP00000011150 rsrtweaspsehrmwvevfkacdedhkgylsredfkiavvmlfgykpskievdsvmssvnpntsgillegflnivrk
hFl_ENSPANP00000008402 ksdltrafqlqdhrksgklslsqwafcmenilglnlpwrslssnlvnidkngnveymssfqnihiekpv........
hFl_ENSPANP00000018674 dqnegqdelftkffekypeinavqlqsilnqmtwshlgsrqpffsleacqgil........................
hFl_ENSPANP00000002971 wvvspaekakyd.................................................................
hFl_ENSPANP00000002116 pltkyralfqlyaensrggydsgprmtrrvlrkl...........................................
hFl_ENSPANP00000014197 wlrwvtqqfktiage..............................................................
hFl_ENSPANP00000012648 qdntidfleyvaalnlvlrg.........................................................
hFl_ENSPANP00000020427 tptfyqtlagvthleesdiidlekrywllkaqsrtgrfdletfgplvsppirpslseg...................
hFl_ENSPANP00000013098 seqrpvdiped..................................................................
hFl_ENSPANP00000010107 arderr.......................................................................
hFl_ENSPANP00000010990 amnggpnmwaitseertkhdrqfdnlkpsggyitgdqarnfflqs................................
hFl_ENSPANP00000001415 aeahwavrveekakfdgifesllpingllsgdkvkpvlmnsk...................................
hFl_ENSPANP00000013054 pfggsldiwaitveerakhdqqfhslkpisgfitgdqarnfffqs................................
hFl_ENSPANP00000009206 eeedinqitdyfsyehfyviyckfweldtdhdlyisqadlsryndqassnriierifsgavtrgktiqkegrmsyad
hFl_ENSPANP00000001415 qptvnwvvpvadkmrfd............................................................
hFl_ENSPANP00000004159 eevrelegktgfssdqieqlhrrfkqlsgdqptirkenfnnvpdlelnpirskivraffdnrnlrkgssgladeinf
hFl_ENSPANP00000013482 riqgcwrqllkeckekdvarqgdisaseflalvekfnldiskeecqqliikydlknngkfaycdfiqscvlllkake
hFl_ENSPANP00000018262 seletametlinvfhahsgkegdky....................................................
hFl_ENSPANP00000005398 dleqlfkelageeeelnasqlqallsialeparvhthtpreiglrtceqllqcfghgqslalhhfqqlwghllewq.
hFl_ENSPANP00000014303 kkrfekanqdsgpglsleefiafehpeevdymtefviqealeehdkngdgfvsleeflgdyrwdptanedpewilve
hFl_ENSPANP00000012662 mselekamvalidvfhqysgregdk....................................................
hFl_ENSPANP00000005019 dllsefkkhdadkvglitlsdwaaavesvlhlglpwrmlrsqlvnssadnmley.......................
hFl_ENSPANP00000014970 sqffeiwlhfdadgsgylegkelqnliqelqqarkkaglelspemktfvdqygqrddgkigivelahilpteenfll
hFl_ENSPANP00000006250 sqffeiwlhfdadgsgylegkelqnliqelqqarkkaglelspemktfvdqygqrddgkigivelahilpteenfll
hFl_ENSPANP00000011359 splekaldvmvst................................................................
hFl_ENSPANP00000013050 pfggsldiwaitveerakhdqqfhslkpisgfitgnqsqhffiqsg...............................
hFl_ENSPANP00000013482 delqkafqlldtgqnltvskselrriitdflmpltreqfqdvlaqiplstsgtvpylaflsrfggidlyingikreg
hFl_ENSPANP00000018878 leqqiqa......................................................................
hFl_ENSPANP00000002756 mpsqmehametmmftfhkfagdk......................................................
hFl_ENSPANP00000018444 mteletamgmiidvfsrysgsegstqtl.................................................
hFl_ENSPANP00000004247 nisveeld.....................................................................
hFl_ENSPANP00000006245 msqlernietiintfhhysvklghp....................................................
hFl_ENSPANP00000016200 teffsyehfyviyckfweldtdhdllidahdlarhndhaistkmidrifsgavtrgrkaqkegkisyadfvwf....
hFl_ENSPANP00000013482 prrlkesfrdpysaffkidtdrdgiinmhdlhkllmhllfnlrddeferflgllglrlsvtlnfrefrnlcekrslk
hFl_ENSPANP00000003778 mtdllnaedikkavgafsaidsfdhkkffqmvglkkk........................................
hFl_ENSPANP00000017843 tqevlenlkdrwyqadsppadlllteeeflsflhpeh........................................
hFl_ENSPANP00000013803 acfwqvwqrfdadekgyieekeldafflhmlmklgtddtvmkanlhkvkqqfmttrdaskdghiqmkelagmflsed
hFl_ENSPANP00000008015 tkdkskydeifynlapadgklsgskaktwmvgtk...........................................
hFl_ENSPANP00000001644 lg...........................................................................
hFl_ENSPANP00000007019 ssleqalavlvttfhkyscqegdkf....................................................
hFl_ENSPANP00000001901 rdkpmydeifytlspvdgkitganakkemvrsk............................................
hFl_ENSPANP00000000771 enqilt.......................................................................
hFl_ENSPANP00000019402 ppekvmldivamfhqysgddgtidmpglvnlmkenfpnflrgceks...............................
hFl_ENSPANP00000006208 kdkptydeifytlspvngkitganakkemvks.............................................
hFl_ENSPANP00000003981 tqaetsiigmidmfhkytrrddkidkpslltmmkenfpnflsacdkkg.............................
hFl_ENSPANP00000018508 rgdphelrniflqyastevdgehymtpedfvqrylglyndpnsnpkivqlla.........................
hFl_ENSPANP00000009319 etq..........................................................................
hFl_ENSPANP00000002116 alnsiensiyrtafklrsvqtlcqldlidssliqqvllrpsfweahkrslsvq........................
hFl_ENSPANP00000012089 enqvltrdakglsqeqlnefrasfnhfdrkrngmmepddfraclismgydlgeve......................
hFl_ENSPANP00000016429 akdkpvydelfytlspingkisgvnakkemvts............................................
hFl_ENSPANP00000006158 evihlkdivcylsllerg...........................................................
hFl_ENSPANP00000001648 mtdllrsvvtvidvfykyt..........................................................
hFl_ENSPANP00000016703 alqecqdpdtfepqkffqtsg........................................................
hFl_ENSPANP00000013482 vrkiqevvessqlalsmafsaldkedtgfvkstefgqvlkdfchkltdnqyhyflrklrihltpyinwkyflqnfsc
hFl_ENSPANP00000001714 fhkkikeafevfdhesnntvdvreigtiirslgccptegelhdliaeveeeeptgyirfekflpvmteille.....
hFl_ENSPANP00000001561 farlvrglglkpeklekdldkysesarkkggekmgiaefaaslevpvsdl...........................
hFl_ENSPANP00000011759 megspsehgsqqsifnryaqqrldidatqlhsllnqelltgppgdmfsldecrslvalmel................
hFl_ENSPANP00000016734 eelskesqetnwfsapsa...........................................................
hFl_ENSPANP00000009674 lsvrnvkalaeyfhildvhgkntlndvlfyhflhhvtdlkkaqinivfdmldwnavgeigfeqfymlvcmllahenh
hFl_ENSPANP00000007884 rpleqavaaivctfqeyagrcgdkyklc.................................................
hFl_ENSPANP00000002971 npvyek.......................................................................
hFl_ENSPANP00000015462 mtdllnaedikkavgafsaidsfdhkkffqmvglkkk........................................
hFl_ENSPANP00000005656 mtkleeylegivnifhnsvwtghfd....................................................
hFl_ENSPANP00000009541 tttisreele...................................................................
hFl_ENSPANP00000008758 dleqlfkelageeeelnasqlqallsialepdphgpqsggqnagkccgeidlnqmpppptqhgqslalhhfqqlwgh
hFl_ENSPANP00000003523 kkspeelkrifekyaakegdp........................................................
hFl_ENSPANP00000018367 radpaelrtiflkyasiekngeffmspndfvtrylnifgesqpnpktvellsgv.......................
hFl_ENSPANP00000007665 adpaelrtiflkyasiekngeffmspndfvtrylnifgesqpnpktvellsgv........................
hFl_ENSPANP00000011360 llssilsvievfhkyakqngdcal.....................................................
hFl_ENSPANP00000005386 hlkkvnyqkfd..................................................................
hFl_ENSPANP00000009203 macpldqaigllvaifhkysgre......................................................
hFl_ENSPANP00000003466 etplekalttmvttfhkysgregskl...................................................
hFl_ENSPANP00000017137 rdakgisqeqmn.................................................................
hFl_ENSPANP00000013482 ksyekiekalsagdpckggyvsfnylkivldtfiyqiprrifiqlmkrfglkattkinwkkfltsfheprgleitsk
hFl_ENSPANP00000002234 rkekptskae...................................................................
hFl_ENSPANP00000003564 aeplteleesietvvttfftfarqegr..................................................
hFl_ENSPANP00000010846 qspsrrvfnp...................................................................
hFl_ENSPANP00000017187 vsqlrevysscdttgtgfldrqeltqlclklhleqqlpvllqtllgndhfarvnfeefkegfvavlssnagvrpsde
hFl_ENSPANP00000008343 kevweetdgldpndfdpk...........................................................
hFl_ENSPANP00000002482 mspllrsicditeifnqyvshdcdgaaltkkdlknller......................................
hFl_ENSPANP00000010432 pvvylkdvvcylslletgr..........................................................
hFl_ENSPANP00000017137 adtdta.......................................................................
hFl_ENSPANP00000005713 py...........................................................................
hFl_ENSPANP00000002260 gsvsdeemm....................................................................
hFl_ENSPANP00000007108 ytelekavivlvenfykyvskyslvknkiskssfremlq......................................
hFl_ENSPANP00000010072 kevweeldgldpnrfnpk...........................................................
hFl_ENSPANP00000002141 mpqllrningiieafrryartegsctaltrgelkrlleq......................................
hFl_ENSPANP00000010969 sllpsdidrykkrfhkfdadkkgfitivdvqrvlesi........................................
hFl_ENSPANP00000016650 kdrvhhepqlsdkvhnda...........................................................
hFl_ENSPANP00000017922 sllpsdidrykkrfhkfdadkkgfitivdvqrvlesi........................................
hFl_ENSPANP00000011099 kllqgiitvidvfyqyatqhgeydmlnkaem..............................................
hFl_ENSPANP00000005052 fskqqqdefkeafllfdrt..........................................................
hFl_ENSPANP00000001415 nslyesyykqvdpaytgrvgaseaalflkksglsdii........................................
hFl_ENSPANP00000011769 attqiskdeld..................................................................
hFl_ENSPANP00000009206 heqtlsrietafmdiedqkadiyemgkiakvcgcplywkapmfraaggektgfvtsqsfiamwrkllnnhhddaskf
hFl_ENSPANP00000001646 ghfdtlskgelkqll..............................................................
hFl_ENSPANP00000020875 aietldnlrketmsvsdlwnilsslnsnlk...............................................
hFl_ENSPANP00000000260 attqiskdeldelkeafakve........................................................
hFl_ENSPANP00000020875 ntlenfceaisklqenyisaeglqsilpsvgitlldkefqkivtdtsrnetengmvelddfistlaneqsfpecnal
hFl_ENSPANP00000005819 wrkk.........................................................................
hFl_ENSPANP00000013481 hptaplydpeakqlrpa............................................................
hFl_ENSPANP00000016713 wrkk.........................................................................
hFl_ENSPANP00000003270 eqqiqakdmigvseetlke..........................................................
hFl_ENSPANP00000020875 kvneikevanilshvdngkigvpdlehalkclnvnlteedfdgalnccnvsdnmevdlkdflikmkesphfqkskat
hFl_ENSPANP00000019992 ptgp.........................................................................
hFl_ENSPANP00000020877 fngngkinvksimeglkkfkpegmatlhklktandikdrvtghmavseikpkfklnpltkvpishskrdrdlpgslq
hFl_ENSPANP00000017252 eaemspqelqlh.................................................................
hFl_ENSPANP00000012991 pgvqelealidtiqkqlkd..........................................................
hFl_ENSPANP00000016852 dqh..........................................................................
hFl_ENSPANP00000000400 ksrelkqvf....................................................................
hFl_ENSPANP00000000366 gkaelnfedfyrfmdnlqtevleieflsysngmntiseedfahillrytnventsvflenvrysipeekgitfdefr
hFl_ENSPANP00000014303 eeqqkrlq.....................................................................
hFl_ENSPANP00000005825 tkrnvvrtivtetsftideleelyalfkaehltscywggssnaldrhdpslpyleqyridfeqfkgmfallfpwacg
hFl_ENSPANP00000007500 eewtsaakpkldqal..............................................................
hFl_ENSPANP00000000752 eewtsaakpkldqal..............................................................
hFl_ENSPANP00000008665 mlrk.........................................................................
hFl_ENSPANP00000019328 dgeqlar......................................................................
hFl_ENSPANP00000020336 rnfeiafkmfdlngdgevdmeefeqvqsiirsqtsmgmrhrdrpttgntlksglcsalttyffgadlkgkltiknfl
hFl_ENSPANP00000002971 kv...........................................................................
hFl_ENSPANP00000020875 sqelsalhkackifskirsgkiyvndlpvilgilrisisdlemrqalktididafwdal..................
hFl_ENSPANP00000015375 qlvtdrdhfirtlslkpllfeipgfltddecrliihlaqmkglqr................................
hFl_ENSPANP00000013482 fynmlraydlgdtgligrnnfkkilhvfcpfltnahfiklcskiqdigsgrilykkllahmgidgpptvspvhvpkd
hFl_ENSPANP00000001076 tkqnvlrvvsqdvklslheldelyvifkkelflscywclgcpvlkhhdpslpyleqyqidcqqfralyhllspwahs
hFl_ENSPANP00000017843 prrs.........................................................................
hFl_ENSPANP00000006270 sdlekaiattalifrnssdsdgklekatakdllqtqfgnftegqe................................
hFl_ENSPANP00000002752 gkegkgkippestlifnidlleirngprs................................................
hFl_ENSPANP00000010107 ydheaflgrevakefdqltpeesqarlgrivdrmdrag.......................................
hFl_ENSPANP00000007279 keivvletle...................................................................
hFl_ENSPANP00000018263 mprllrdvlcvietfhkyasedsngatltgrelkqllqgefgdffqpcvlhavek......................
hFl_ENSPANP00000013803 ytgtmmkifdrnkdgrldlndlarila..................................................
hFl_ENSPANP00000011977 vscyfslleggrp................................................................
hFl_ENSPANP00000006880 vscyfslleggrp................................................................
hFl_ENSPANP00000008114 akrsvvraipvdigfsieeledlymvfkakhlasqywgsshtvagrrdpslpyleqyridasqfrelfasltpwacg
hFl_ENSPANP00000009030 avi..........................................................................
hFl_ENSPANP00000016306 dyledgkvnvhkllalynhiselvqlqevappleankdlvhlltlsldlyytedeiyelsyareprnhrappltpsk
hFl_ENSPANP00000019993 eaeeqlpaapedhwk..............................................................
hFl_ENSPANP00000000366 lskqelnqmlaetppvwkgssklfrnlkergvisyteylfllciltkphagfria......................
hFl_ENSPANP00000018199 nkh..........................................................................
hFl_ENSPANP00000020672 fvwhedpp.....................................................................
hFl_ENSPANP00000008729 nkh..........................................................................
hFl_ENSPANP00000006250 ytdl.........................................................................
hFl_ENSPANP00000011328 dlgdkglisyteylflltiltkphsgf..................................................
hFl_ENSPANP00000012268 tlkqeeafrsyfeifngpgevdaqslknilllmgfsvtpaqve..................................
hFl_ENSPANP00000018718 gymfiwngevspn................................................................
hFl_ENSPANP00000010889 kepyy........................................................................
hFl_ENSPANP00000020671 sdsnmsfvefvelfksfsvrsrkdlkdlfdvyavpcsrsgsesaplytnlm..........................
hFl_ENSPANP00000011848 acqddedylryg.................................................................
hFl_ENSPANP00000020673 sdsnmsfvefvelfksfsvrsrkdlkdlfdvyavpcsrsgsesaplytnlm..........................
hFl_ENSPANP00000006193 ifldilr......................................................................
hFl_ENSPANP00000015860 yssdedllsklegfke.............................................................
hFl_ENSPANP00000003135 kgsnyseild...................................................................
hFl_ENSPANP00000008557 eqa..........................................................................
hFl_ENSPANP00000014970 eytdl........................................................................
hFl_ENSPANP00000009124 sdver........................................................................
hFl_ENSPANP00000003056 ie...........................................................................
hFl_ENSPANP00000013460 agsqedgpr....................................................................
hFl_ENSPANP00000016675 ltlsdaeqkyy..................................................................
hFl_ENSPANP00000016846 lqpgsqlfteihlakiekmfee.......................................................
hFl_ENSPANP00000011328 mqfsslehegeyymtprdflfsvmfeqmerktsvrkltkkdiedtlsgiqtagcgstffrdlgdkglisyteylfll
hFl_ENSPANP00000004053 plrsnlleklqkelkildpissrfllqsqlsrlflkhevplqlptvkilcqrfskrgspemvnyekllwflnsaasd
hFl_ENSPANP00000017871 gdinfaeieeanrvlgpiyfttfvffmffillnmflaiindtysevksdlaqqkaemelsdlirkgyhralv.....
hFl_ENSPANP00000004677 gdinfaeieeanrvlgpiyfttfvffmffillnmflaiindtysevksdlaqqkaemelsdlirkgyhralv.....
hFl_ENSPANP00000018325 pehls........................................................................
hFl_ENSPANP00000016823 qpprhpqlapdpgpaghalfq........................................................
hFl_ENSPANP00000016006 nfllkfqgmkl..................................................................
hFl_ENSPANP00000018508 lqelqleharqafalkdksksgmisgldfsdimvtirshmltpfveenlvsaaggsishqvsf..............
hFl_ENSPANP00000018829 eflcdqkysdeenlpekltafkeky....................................................
hFl_ENSPANP00000016824 paghalfq.....................................................................
hFl_ENSPANP00000010241 sislrelktvlplinfkvssakflkdkfveigahrdelsfeqfhlfykklmfeqqksildefkkdssvfilgntdrp
hFl_ENSPANP00000002202 etle.........................................................................
hFl_ENSPANP00000020427 gdgvppkvaeviycsfggtskglhfnnlivglvlltrgkd.....................................
hFl_ENSPANP00000020450 idtaklypilmssglpre...........................................................
hFl_ENSPANP00000019970 vrr..........................................................................
hFl_ENSPANP00000017056 walrlhdwsvere................................................................
hFl_ENSPANP00000012483 ellks........................................................................
hFl_ENSPANP00000017055 walrlhdwsvere................................................................
hFl_ENSPANP00000009566 seyiclselpfvmraigfypseekiddifneikfgeyvdtgklidkinlpdflkvylnhkpp...............
hFl_ENSPANP00000013482 vaardklvdcyqdisk.............................................................
hFl_ENSPANP00000007665 qlehakqafvqrdnartgrvtaidfrdimvtirphvltpfveeclvaaaggttshqvsfsyfngfnsllnnmel...
hFl_ENSPANP00000018367 qlehakqafvqrdnartgrvtaidfrdimvtirphvltpfveeclvaaaggttshqvsfsyfngfnsllnnmel...
hFl_ENSPANP00000012679 kqlkfeelqcdvsveedsrq.........................................................
hFl_ENSPANP00000012680 kqlkfeelqcdvsveedsrq.........................................................
hFl_ENSPANP00000008763 lkdellk......................................................................
hFl_ENSPANP00000019937 malvapeapse..................................................................
hFl_ENSPANP00000012527 epeswssqaaaelqaffqdcgakergfvtredlavakfsflgskee...............................
hFl_ENSPANP00000008287 llsegeq......................................................................
hFl_ENSPANP00000004139 vsvedddrq....................................................................
hFl_ENSPANP00000004290 vsvedddrq....................................................................
hFl_ENSPANP00000020336 mqrqlkkhfkegkgltfqevenfftflknindvdtalsfyhmagasldkvtmqqvartv..................
hFl_ENSPANP00000003145 ve...........................................................................
hFl_ENSPANP00000017380 kqnvlrvvipevsilpedlee........................................................
hFl_ENSPANP00000019527 esvtleqfrell.................................................................
hFl_ENSPANP00000016200 hfpheratmddmglvakacgcplywkgplfcgaggertgsvsvhkfvamw...........................
hFl_ENSPANP00000013484 lqqldpentgfigadtfaglvhshelpldpakldml.........................................
hFl_ENSPANP00000019122 lteeemysltetfqrckvipdcslt....................................................
hFl_ENSPANP00000011328 emeflqfskglsfmrkedfaewllfftntenkdiywknvreklsagerrkcndmrilcnflktlenfhleyqyillf
hFl_ENSPANP00000005617 nvemilkffdmflklkdivgseafqdyvtdprgliskkdfqkamdsqkqfsgpeiq.....................
hFl_ENSPANP00000011677 ge...........................................................................
hFl_ENSPANP00000002004 lhsrki.......................................................................
hFl_ENSPANP00000005046 nqlsvcdfvkiqkafespeprkiicmsredftqkmteivgwgtkee...............................
hFl_ENSPANP00000020438 rdl..........................................................................
hFl_ENSPANP00000020442 rdl..........................................................................
hFl_ENSPANP00000016734 eelqnlwflldkhqtppmigeeaminyenflkvgekagakckqf.................................
hFl_ENSPANP00000008645 ssfltdlq.....................................................................
hFl_ENSPANP00000003048 fsslqdmpkeldpsavlpldc........................................................
hFl_ENSPANP00000001629 eeqilnstfeacdpqrtgtvavtqvlayleavtgqgpqdarlqtlans.............................
hFl_ENSPANP00000007857 eqalaad......................................................................
hFl_ENSPANP00000012179 lvsyltsallffrpekpreylisllerlriakvtgvafpffmdnsn...............................
hFl_ENSPANP00000020858 lqggeq.......................................................................


                                                                                                    
                                                                                                    
d1sraa_                .............................................................................
hFl_ENSPANP00000005664 .............................................................................
hFl_ENSPANP00000015843 .............................................................................
hFl_ENSPANP00000018838 .............................................................................
hFl_ENSPANP00000000687 kvvtrhpdlktdgfgi.............................................................
hFl_ENSPANP00000011132 .............................................................................
hFl_ENSPANP00000011888 .............................................................................
hFl_ENSPANP00000012946 .............................................................................
hFl_ENSPANP00000015640 .............................................................................
hFl_ENSPANP00000008517 .............................................................................
hFl_ENSPANP00000017051 .............................................................................
hFl_ENSPANP00000008208 .............................................................................
hFl_ENSPANP00000000685 .............................................................................
hFl_ENSPANP00000001217 .............................................................................
hFl_ENSPANP00000009011 .............................................................................
hFl_ENSPANP00000016439 .............................................................................
hFl_ENSPANP00000020904 .............................................................................
hFl_ENSPANP00000011992 .............................................................................
hFl_ENSPANP00000011142 .............................................................................
hFl_ENSPANP00000008176 .............................................................................
hFl_ENSPANP00000016326 .............................................................................
hFl_ENSPANP00000005573 .............................................................................
hFl_ENSPANP00000018511 .............................................................................
hFl_ENSPANP00000007984 .............................................................................
hFl_ENSPANP00000009334 .............................................................................
hFl_ENSPANP00000011977 .............................................................................
hFl_ENSPANP00000006880 .............................................................................
hFl_ENSPANP00000016389 kdvngpepl....................................................................
hFl_ENSPANP00000017625 .............................................................................
hFl_ENSPANP00000020753 .............................................................................
hFl_ENSPANP00000011482 .............................................................................
hFl_ENSPANP00000008596 .............................................................................
hFl_ENSPANP00000014722 .............................................................................
hFl_ENSPANP00000010579 .............................................................................
hFl_ENSPANP00000018638 .............................................................................
hFl_ENSPANP00000007213 .............................................................................
hFl_ENSPANP00000001594 .............................................................................
hFl_ENSPANP00000002108 .............................................................................
hFl_ENSPANP00000007118 .............................................................................
hFl_ENSPANP00000006887 .............................................................................
hFl_ENSPANP00000020829 .............................................................................
hFl_ENSPANP00000004533 .............................................................................
hFl_ENSPANP00000005357 .............................................................................
hFl_ENSPANP00000014595 .............................................................................
hFl_ENSPANP00000019694 .............................................................................
hFl_ENSPANP00000012647 .............................................................................
hFl_ENSPANP00000011841 .............................................................................
hFl_ENSPANP00000007138 .............................................................................
hFl_ENSPANP00000005603 .............................................................................
hFl_ENSPANP00000003537 .............................................................................
hFl_ENSPANP00000016730 .............................................................................
hFl_ENSPANP00000004388 .............................................................................
hFl_ENSPANP00000004958 .............................................................................
hFl_ENSPANP00000017808 .............................................................................
hFl_ENSPANP00000006158 .............................................................................
hFl_ENSPANP00000000685 .............................................................................
hFl_ENSPANP00000001746 admigvk......................................................................
hFl_ENSPANP00000005266 dmi..........................................................................
hFl_ENSPANP00000011699 .............................................................................
hFl_ENSPANP00000001618 .............................................................................
hFl_ENSPANP00000010432 .............................................................................
hFl_ENSPANP00000019362 .............................................................................
hFl_ENSPANP00000005159 agmigvqe.....................................................................
hFl_ENSPANP00000011834 rdqgtyedyleglrv..............................................................
hFl_ENSPANP00000004357 .............................................................................
hFl_ENSPANP00000010858 .............................................................................
hFl_ENSPANP00000010399 .............................................................................
hFl_ENSPANP00000004118 .............................................................................
hFl_ENSPANP00000010678 .............................................................................
hFl_ENSPANP00000008201 .............................................................................
hFl_ENSPANP00000000555 .............................................................................
hFl_ENSPANP00000014173 mqikqedpkkeillamlmadkekkgyimasdlrsk..........................................
hFl_ENSPANP00000002207 .............................................................................
hFl_ENSPANP00000001879 .............................................................................
hFl_ENSPANP00000005388 .............................................................................
hFl_ENSPANP00000002662 .............................................................................
hFl_ENSPANP00000009999 .............................................................................
hFl_ENSPANP00000004626 .............................................................................
hFl_ENSPANP00000006233 .............................................................................
hFl_ENSPANP00000002660 .............................................................................
hFl_ENSPANP00000011209 .............................................................................
hFl_ENSPANP00000020345 .............................................................................
hFl_ENSPANP00000020343 .............................................................................
hFl_ENSPANP00000008924 .............................................................................
hFl_ENSPANP00000015530 .............................................................................
hFl_ENSPANP00000008596 .............................................................................
hFl_ENSPANP00000002265 .............................................................................
hFl_ENSPANP00000014191 .............................................................................
hFl_ENSPANP00000012413 ededtetqdpkkp................................................................
hFl_ENSPANP00000007079 .............................................................................
hFl_ENSPANP00000012088 .............................................................................
hFl_ENSPANP00000020865 rnkeqgtyedfvegl..............................................................
hFl_ENSPANP00000003943 .............................................................................
hFl_ENSPANP00000005422 .............................................................................
hFl_ENSPANP00000015281 .............................................................................
hFl_ENSPANP00000017172 .............................................................................
hFl_ENSPANP00000014458 sfedfldllsvfsdtatpdiks.......................................................
hFl_ENSPANP00000008201 .............................................................................
hFl_ENSPANP00000004357 .............................................................................
hFl_ENSPANP00000004505 .............................................................................
hFl_ENSPANP00000012751 .............................................................................
hFl_ENSPANP00000001879 .............................................................................
hFl_ENSPANP00000001065 fse..........................................................................
hFl_ENSPANP00000009095 .............................................................................
hFl_ENSPANP00000013050 .............................................................................
hFl_ENSPANP00000013054 .............................................................................
hFl_ENSPANP00000014002 .............................................................................
hFl_ENSPANP00000008287 .............................................................................
hFl_ENSPANP00000016675 .............................................................................
hFl_ENSPANP00000013999 .............................................................................
hFl_ENSPANP00000003565 .............................................................................
hFl_ENSPANP00000018211 gvfsfedvlgmasvfseqacps.......................................................
hFl_ENSPANP00000010407 .............................................................................
hFl_ENSPANP00000016650 .............................................................................
hFl_ENSPANP00000001581 .............................................................................
hFl_ENSPANP00000016006 .............................................................................
hFl_ENSPANP00000015459 .............................................................................
hFl_ENSPANP00000014312 .............................................................................
hFl_ENSPANP00000010990 .............................................................................
hFl_ENSPANP00000002202 .............................................................................
hFl_ENSPANP00000007279 .............................................................................
hFl_ENSPANP00000011150 .............................................................................
hFl_ENSPANP00000008402 .............................................................................
hFl_ENSPANP00000018674 .............................................................................
hFl_ENSPANP00000002971 .............................................................................
hFl_ENSPANP00000002116 .............................................................................
hFl_ENSPANP00000014197 .............................................................................
hFl_ENSPANP00000012648 .............................................................................
hFl_ENSPANP00000020427 .............................................................................
hFl_ENSPANP00000013098 .............................................................................
hFl_ENSPANP00000010107 .............................................................................
hFl_ENSPANP00000010990 .............................................................................
hFl_ENSPANP00000001415 .............................................................................
hFl_ENSPANP00000013054 .............................................................................
hFl_ENSPANP00000009206 fvwflise.....................................................................
hFl_ENSPANP00000001415 .............................................................................
hFl_ENSPANP00000004159 edfltimsyfrpidttmdeeq........................................................
hFl_ENSPANP00000013482 sslmqrmkiqnahkmkdagae........................................................
hFl_ENSPANP00000018262 .............................................................................
hFl_ENSPANP00000005398 .............................................................................
hFl_ENSPANP00000014303 kdrf.........................................................................
hFl_ENSPANP00000012662 .............................................................................
hFl_ENSPANP00000005019 .............................................................................
hFl_ENSPANP00000014970 lfrcqqlksceef................................................................
hFl_ENSPANP00000006250 lfrcqqlksceef................................................................
hFl_ENSPANP00000011359 .............................................................................
hFl_ENSPANP00000013050 .............................................................................
hFl_ENSPANP00000013482 gnemnccrtlkeleiqvgekv........................................................
hFl_ENSPANP00000018878 .............................................................................
hFl_ENSPANP00000002756 .............................................................................
hFl_ENSPANP00000018444 .............................................................................
hFl_ENSPANP00000004247 .............................................................................
hFl_ENSPANP00000006245 .............................................................................
hFl_ENSPANP00000016200 .............................................................................
hFl_ENSPANP00000013482 tdeapqrlirrpkqkvadselaceqahqylvtkaknrwsd.....................................
hFl_ENSPANP00000003778 .............................................................................
hFl_ENSPANP00000017843 .............................................................................
hFl_ENSPANP00000013803 enfllvfrrenpldss.............................................................
hFl_ENSPANP00000008015 .............................................................................
hFl_ENSPANP00000001644 .............................................................................
hFl_ENSPANP00000007019 .............................................................................
hFl_ENSPANP00000001901 .............................................................................
hFl_ENSPANP00000000771 .............................................................................
hFl_ENSPANP00000019402 .............................................................................
hFl_ENSPANP00000006208 .............................................................................
hFl_ENSPANP00000003981 .............................................................................
hFl_ENSPANP00000018508 .............................................................................
hFl_ENSPANP00000009319 .............................................................................
hFl_ENSPANP00000002116 .............................................................................
hFl_ENSPANP00000012089 .............................................................................
hFl_ENSPANP00000016429 .............................................................................
hFl_ENSPANP00000006158 .............................................................................
hFl_ENSPANP00000001648 .............................................................................
hFl_ENSPANP00000016703 .............................................................................
hFl_ENSPANP00000013482 fleetaeewaekmpkgppptspkavasrdilarlhk.........................................
hFl_ENSPANP00000001714 .............................................................................
hFl_ENSPANP00000001561 .............................................................................
hFl_ENSPANP00000011759 .............................................................................
hFl_ENSPANP00000016734 .............................................................................
hFl_ENSPANP00000009674 legqfmyrh....................................................................
hFl_ENSPANP00000007884 .............................................................................
hFl_ENSPANP00000002971 .............................................................................
hFl_ENSPANP00000015462 .............................................................................
hFl_ENSPANP00000005656 .............................................................................
hFl_ENSPANP00000009541 .............................................................................
hFl_ENSPANP00000008758 llew.........................................................................
hFl_ENSPANP00000003523 .............................................................................
hFl_ENSPANP00000018367 .............................................................................
hFl_ENSPANP00000007665 .............................................................................
hFl_ENSPANP00000011360 .............................................................................
hFl_ENSPANP00000005386 .............................................................................
hFl_ENSPANP00000009203 .............................................................................
hFl_ENSPANP00000003466 .............................................................................
hFl_ENSPANP00000017137 .............................................................................
hFl_ENSPANP00000013482 gpltkrnsinsrn................................................................
hFl_ENSPANP00000002234 .............................................................................
hFl_ENSPANP00000003564 .............................................................................
hFl_ENSPANP00000010846 .............................................................................
hFl_ENSPANP00000017187 dssslesaassaippkyvngskwygrrsrpelcdtatearhvpeqqtqaslksqlwrsaslesveslksdeeaestk
hFl_ENSPANP00000008343 .............................................................................
hFl_ENSPANP00000002482 .............................................................................
hFl_ENSPANP00000010432 .............................................................................
hFl_ENSPANP00000017137 .............................................................................
hFl_ENSPANP00000005713 .............................................................................
hFl_ENSPANP00000002260 .............................................................................
hFl_ENSPANP00000007108 .............................................................................
hFl_ENSPANP00000010072 .............................................................................
hFl_ENSPANP00000002141 .............................................................................
hFl_ENSPANP00000010969 .............................................................................
hFl_ENSPANP00000016650 .............................................................................
hFl_ENSPANP00000017922 .............................................................................
hFl_ENSPANP00000011099 .............................................................................
hFl_ENSPANP00000005052 .............................................................................
hFl_ENSPANP00000001415 .............................................................................
hFl_ENSPANP00000011769 .............................................................................
hFl_ENSPANP00000009206 icllakpncssl.................................................................
hFl_ENSPANP00000001646 .............................................................................
hFl_ENSPANP00000020875 .............................................................................
hFl_ENSPANP00000000260 .............................................................................
hFl_ENSPANP00000020875 pg...........................................................................
hFl_ENSPANP00000005819 .............................................................................
hFl_ENSPANP00000013481 .............................................................................
hFl_ENSPANP00000016713 .............................................................................
hFl_ENSPANP00000003270 .............................................................................
hFl_ENSPANP00000020875 qillaatqilqndlidvsdlkt.......................................................
hFl_ENSPANP00000019992 .............................................................................
hFl_ENSPANP00000020877 cqlqhkekklsasqmaafqdaynffnkdktgcidfhglmctvaklgmnltkhdvynel...................
hFl_ENSPANP00000017252 .............................................................................
hFl_ENSPANP00000012991 .............................................................................
hFl_ENSPANP00000016852 .............................................................................
hFl_ENSPANP00000000400 .............................................................................
hFl_ENSPANP00000000366 sffqflnnledfaialnmynfasrsigqdefkravyvatglklsp................................
hFl_ENSPANP00000014303 .............................................................................
hFl_ENSPANP00000005825 thsdvla......................................................................
hFl_ENSPANP00000007500 .............................................................................
hFl_ENSPANP00000000752 .............................................................................
hFl_ENSPANP00000008665 .............................................................................
hFl_ENSPANP00000019328 .............................................................................
hFl_ENSPANP00000020336 efqrklqhdvlkleferhdpvdgriterqfggmllaysgvqskkltamqrqlkkhfkegkgltfqevenfftflkni
hFl_ENSPANP00000002971 .............................................................................
hFl_ENSPANP00000020875 .............................................................................
hFl_ENSPANP00000015375 .............................................................................
hFl_ENSPANP00000013482 qllsehlrkdeqqqpdlsertkptenkttqikkmtteeviek...................................
hFl_ENSPANP00000001076 an...........................................................................
hFl_ENSPANP00000017843 .............................................................................
hFl_ENSPANP00000006270 .............................................................................
hFl_ENSPANP00000002752 .............................................................................
hFl_ENSPANP00000010107 .............................................................................
hFl_ENSPANP00000007279 .............................................................................
hFl_ENSPANP00000018263 .............................................................................
hFl_ENSPANP00000013803 .............................................................................
hFl_ENSPANP00000011977 .............................................................................
hFl_ENSPANP00000006880 .............................................................................
hFl_ENSPANP00000008114 shtpvl.......................................................................
hFl_ENSPANP00000009030 .............................................................................
hFl_ENSPANP00000016306 ppvvvdwasgvspkp..............................................................
hFl_ENSPANP00000019993 .............................................................................
hFl_ENSPANP00000000366 .............................................................................
hFl_ENSPANP00000018199 .............................................................................
hFl_ENSPANP00000020672 .............................................................................
hFl_ENSPANP00000008729 .............................................................................
hFl_ENSPANP00000006250 .............................................................................
hFl_ENSPANP00000011328 .............................................................................
hFl_ENSPANP00000012268 .............................................................................
hFl_ENSPANP00000018718 .............................................................................
hFl_ENSPANP00000010889 .............................................................................
hFl_ENSPANP00000020671 .............................................................................
hFl_ENSPANP00000011848 .............................................................................
hFl_ENSPANP00000020673 .............................................................................
hFl_ENSPANP00000006193 .............................................................................
hFl_ENSPANP00000015860 .............................................................................
hFl_ENSPANP00000003135 .............................................................................
hFl_ENSPANP00000008557 .............................................................................
hFl_ENSPANP00000014970 .............................................................................
hFl_ENSPANP00000009124 .............................................................................
hFl_ENSPANP00000003056 .............................................................................
hFl_ENSPANP00000013460 .............................................................................
hFl_ENSPANP00000016675 .............................................................................
hFl_ENSPANP00000016846 .............................................................................
hFl_ENSPANP00000011328 tiltkphsg....................................................................
hFl_ENSPANP00000004053 ypqqnkaaadlrkteshgthsqrrkspshdlsgrd..........................................
hFl_ENSPANP00000017871 .............................................................................
hFl_ENSPANP00000004677 .............................................................................
hFl_ENSPANP00000018325 .............................................................................
hFl_ENSPANP00000016823 .............................................................................
hFl_ENSPANP00000016006 .............................................................................
hFl_ENSPANP00000018508 .............................................................................
hFl_ENSPANP00000018829 .............................................................................
hFl_ENSPANP00000016824 .............................................................................
hFl_ENSPANP00000010241 dasavylhdfqrfllheq...........................................................
hFl_ENSPANP00000002202 .............................................................................
hFl_ENSPANP00000020427 .............................................................................
hFl_ENSPANP00000020450 .............................................................................
hFl_ENSPANP00000019970 .............................................................................
hFl_ENSPANP00000017056 .............................................................................
hFl_ENSPANP00000012483 .............................................................................
hFl_ENSPANP00000017055 .............................................................................
hFl_ENSPANP00000009566 .............................................................................
hFl_ENSPANP00000013482 .............................................................................
hFl_ENSPANP00000007665 .............................................................................
hFl_ENSPANP00000018367 .............................................................................
hFl_ENSPANP00000012679 .............................................................................
hFl_ENSPANP00000012680 .............................................................................
hFl_ENSPANP00000008763 .............................................................................
hFl_ENSPANP00000019937 .............................................................................
hFl_ENSPANP00000012527 .............................................................................
hFl_ENSPANP00000008287 .............................................................................
hFl_ENSPANP00000004139 .............................................................................
hFl_ENSPANP00000004290 .............................................................................
hFl_ENSPANP00000020336 .............................................................................
hFl_ENSPANP00000003145 .............................................................................
hFl_ENSPANP00000017380 .............................................................................
hFl_ENSPANP00000019527 .............................................................................
hFl_ENSPANP00000016200 .............................................................................
hFl_ENSPANP00000013484 .............................................................................
hFl_ENSPANP00000019122 .............................................................................
hFl_ENSPANP00000011328 shspkkktefkravkvatgq.........................................................
hFl_ENSPANP00000005617 .............................................................................
hFl_ENSPANP00000011677 .............................................................................
hFl_ENSPANP00000002004 .............................................................................
hFl_ENSPANP00000005046 .............................................................................
hFl_ENSPANP00000020438 .............................................................................
hFl_ENSPANP00000020442 .............................................................................
hFl_ENSPANP00000016734 .............................................................................
hFl_ENSPANP00000008645 .............................................................................
hFl_ENSPANP00000003048 .............................................................................
hFl_ENSPANP00000001629 .............................................................................
hFl_ENSPANP00000007857 .............................................................................
hFl_ENSPANP00000012179 .............................................................................
hFl_ENSPANP00000020858 .............................................................................


                                                             10        20         30         40     
                                                              |         |          |          |     
d1sraa_                ..............................PPCLDSELTEFPLRMRDWLK.NVLVTLYERDEDNNL.LTEKQKLRVK
hFl_ENSPANP00000005664 ..............................--------------------.---------------.-------DAS
hFl_ENSPANP00000015843 ..............................--------------------.---------------.------GDAS
hFl_ENSPANP00000018838 ..............................--------------------.---------------.---------T
hFl_ENSPANP00000000687 ..............................--------------------.---------------.----------
hFl_ENSPANP00000011132 ..............................--------------------.---------------.--------QN
hFl_ENSPANP00000011888 ..............................--------------------.--MRSLGQNP-----.--------TE
hFl_ENSPANP00000012946 ..............................--------------------.---------------.-----YGDAS
hFl_ENSPANP00000015640 ..............................--------------------.---RSLGQNP-----.--------TE
hFl_ENSPANP00000008517 ..............................--------------------.---------------.----------
hFl_ENSPANP00000017051 ..............................--------------------.---------------.----------
hFl_ENSPANP00000008208 ..............................--------------------.---------------.------GDAS
hFl_ENSPANP00000000685 ..............................--------------------.---------------.----------
hFl_ENSPANP00000001217 ..............................PPCLDSELTEFPLRMRDWLK.NVLVTLYERDEDNNL.LTEKQKLRVK
hFl_ENSPANP00000009011 ..............................--------------------.---------------.-------DAS
hFl_ENSPANP00000016439 ..............................--------------------.---------------.----------
hFl_ENSPANP00000020904 ..............................--------------------.---------------.----------
hFl_ENSPANP00000011992 ..............................PTCTDFEVTQFPLRMRDWLK.NILMQLYEANSEHAGyLNEKQRNKVK
hFl_ENSPANP00000011142 ..............................--------------------.---------------.----------
hFl_ENSPANP00000008176 ..............................--------------------.---------------.----------
hFl_ENSPANP00000016326 ..............................--CPRPEIDEIFT-------.---------------.----------
hFl_ENSPANP00000005573 ..............................--------------------.---------------.----------
hFl_ENSPANP00000018511 ..............................--------------------.---------------.---------T
hFl_ENSPANP00000007984 ..............................--------------------.---------------.--------LD
hFl_ENSPANP00000009334 ..............................--------------------.---------------.---------E
hFl_ENSPANP00000011977 ..............................--------------------.---------------.----------
hFl_ENSPANP00000006880 ..............................--------------------.---------------.----------
hFl_ENSPANP00000016389 ..............................--------------------.---------------.----------
hFl_ENSPANP00000017625 ..............................--------------------.---------------.---------K
hFl_ENSPANP00000020753 ..............................--------------------.---------------.----------
hFl_ENSPANP00000011482 ..............................----------------DTFK.LIYAQFFPQGDAT--.----------
hFl_ENSPANP00000008596 ..............................--------------------.---------------.----------
hFl_ENSPANP00000014722 ..............................-----------------TFK.QIYAQFFPHGDAS--.----------
hFl_ENSPANP00000010579 ..............................--------------------.---------------.----------
hFl_ENSPANP00000018638 ..............................--------------------.---------------.----------
hFl_ENSPANP00000007213 ..............................--CRTITFEQFQEALE----.---------------.----------
hFl_ENSPANP00000001594 ..............................--------------------.---------------.----------
hFl_ENSPANP00000002108 ..............................--------------------.---------------.----------
hFl_ENSPANP00000007118 ..............................--------------------.---------------.----------
hFl_ENSPANP00000006887 ..............................--------------------.---------------.----------
hFl_ENSPANP00000020829 ..............................--------------------.---------------.----------
hFl_ENSPANP00000004533 ..............................----------------DEFL.VMMVRCMKDDSKGK-.----------
hFl_ENSPANP00000005357 ..............................--------------------.---------------.----------
hFl_ENSPANP00000014595 ..............................--------------------.---------------.----------
hFl_ENSPANP00000019694 ..............................--------------------.---------------.------TDPK
hFl_ENSPANP00000012647 ..............................--------------------.---------------.--------AS
hFl_ENSPANP00000011841 ..............................--------------------.---------------.---KKDIKFK
hFl_ENSPANP00000007138 ..............................--------------------.---------------.----------
hFl_ENSPANP00000005603 ..............................--------------------.---------------.----------
hFl_ENSPANP00000003537 ..............................--------------------.---------------.----------
hFl_ENSPANP00000016730 ..............................--------------------.---------------.----------
hFl_ENSPANP00000004388 ..............................--------------------.---------------.----------
hFl_ENSPANP00000004958 ..............................--------------------.---------------.----------
hFl_ENSPANP00000017808 ..............................--------------------.---------------.----------
hFl_ENSPANP00000006158 ..............................--------------------.---------------.---N------
hFl_ENSPANP00000000685 ..............................--------------------.---------------.----------
hFl_ENSPANP00000001746 ..............................--------------------.---------------.----------
hFl_ENSPANP00000005266 ..............................--------------------.---------------.----------
hFl_ENSPANP00000011699 ..............................--------------------.---------------.----------
hFl_ENSPANP00000001618 ..............................--------------------.---------------.----------
hFl_ENSPANP00000010432 ..............................--------------------.--------V------.----------
hFl_ENSPANP00000019362 ..............................--------------------.---------------.---------E
hFl_ENSPANP00000005159 ..............................--------------------.---------------.----------
hFl_ENSPANP00000011834 ..............................--------------------.---------------.----------
hFl_ENSPANP00000004357 ..............................-------------R------.---------------.----------
hFl_ENSPANP00000010858 ..............................--------------------.---------------.---T------
hFl_ENSPANP00000010399 ..............................--------------------.---------------.----------
hFl_ENSPANP00000004118 ..............................--------------------.---------------.----------
hFl_ENSPANP00000010678 ..............................--------------------.---------------.----------
hFl_ENSPANP00000008201 ..............................--------------L-----.---------------.----------
hFl_ENSPANP00000000555 ..............................--------------------.---------P-----.----------
hFl_ENSPANP00000014173 ..............................--------------------.---------------.----------
hFl_ENSPANP00000002207 ..............................--------------------.---------P-----.----------
hFl_ENSPANP00000001879 ..............................--------------------.---------------.----------
hFl_ENSPANP00000005388 ..............................--CSDLEFREVANRLRDWFK.ALHES-GSQNKKTKT.LLRTERSRFD
hFl_ENSPANP00000002662 ..............................--------------------.---------------.----------
hFl_ENSPANP00000009999 ..............................--------------------.---------------.----------
hFl_ENSPANP00000004626 ..............................--------------------.---------------.----------
hFl_ENSPANP00000006233 ..............................--------------------.---------------.----------
hFl_ENSPANP00000002660 ..............................--------------------.---------------.---GLNQKAN
hFl_ENSPANP00000011209 ..............................--CTDKELRNLASRLKDWFG.ALHED--ANRVIKPT.SSNTAQGRFD
hFl_ENSPANP00000020345 ..............................-TCTGQDLADLGDRLRDWFQ.LLHENSKQNGSASSA.AS--PASGLD
hFl_ENSPANP00000020343 ..............................-TCTGQDLADLGDRLRDWFQ.LLHENSKQNGSASSA.AS--PASGLD
hFl_ENSPANP00000008924 ..............................--------------------.---------------.----------
hFl_ENSPANP00000015530 ..............................--------------------.---------------.----------
hFl_ENSPANP00000008596 ..............................--------------------.---------------.-------N--
hFl_ENSPANP00000002265 ..............................------KQEELNTKMMDFETfLPMLQHISKNKDTGT.YED-------
hFl_ENSPANP00000014191 ..............................--------------------.---------------.----------
hFl_ENSPANP00000012413 ..............................--------------------.---------------.----------
hFl_ENSPANP00000007079 ..............................--------------------.---------------.----------
hFl_ENSPANP00000012088 ..............................--------------------.---------------.----------
hFl_ENSPANP00000020865 ..............................--------------------.---------------.----------
hFl_ENSPANP00000003943 ..............................--------------------.---------------.----------
hFl_ENSPANP00000005422 ..............................QGCPGAKKHEFLTSILDALS.TDMVHAVSDPSSSSG.----------
hFl_ENSPANP00000015281 ..............................--------------------.---------------.----------
hFl_ENSPANP00000017172 ..............................PGCPEGKKMEFITSLLDALT.TDMVQAINSAAPTGG.GR--------
hFl_ENSPANP00000014458 ..............................--------------------.---------------.----------
hFl_ENSPANP00000008201 ..............................--------------------.---------------.----------
hFl_ENSPANP00000004357 ..............................--------------------.---------------.----------
hFl_ENSPANP00000004505 ..............................--------------------.---------------.----------
hFl_ENSPANP00000012751 ..............................--------------------.---------------.----------
hFl_ENSPANP00000001879 ..............................--------------------.---------------.----------
hFl_ENSPANP00000001065 ..............................--------------------.---------------.----------
hFl_ENSPANP00000009095 ..............................--------------------.---------------.----------
hFl_ENSPANP00000013050 ..............................--------------------.---------------.----------
hFl_ENSPANP00000013054 ..............................--------------------.---------------.----------
hFl_ENSPANP00000014002 ..............................--------------------.---------------.----------
hFl_ENSPANP00000008287 ..............................--------------------.---------------.----------
hFl_ENSPANP00000016675 ..............................--------------------.---------------.----------
hFl_ENSPANP00000013999 ..............................--------------------.---------------.----------
hFl_ENSPANP00000003565 ..............................--------------------.---------------.----------
hFl_ENSPANP00000018211 ..............................--------------------.---------------.----------
hFl_ENSPANP00000010407 ..............................-------LRELLTTMGDRFT.DEEVD----------.----------
hFl_ENSPANP00000016650 ..............................--------------------.---------------.----------
hFl_ENSPANP00000001581 ..............................--------------------.---------------.----------
hFl_ENSPANP00000016006 ..............................--------------------.---------------.----------
hFl_ENSPANP00000015459 ..............................--------------------.---------------.----------
hFl_ENSPANP00000014312 ..............................--------------------.---------------.----------
hFl_ENSPANP00000010990 ..............................--------------------.---------------.----------
hFl_ENSPANP00000002202 ..............................--------------------.---------------.----------
hFl_ENSPANP00000007279 ..............................--------------------.---------------.----------
hFl_ENSPANP00000011150 ..............................--------------------.---------------.----------
hFl_ENSPANP00000008402 ..............................--------------------.---------------.----------
hFl_ENSPANP00000018674 ..............................--------------------.---------------.----------
hFl_ENSPANP00000002971 ..............................--------------------.---------------.----------
hFl_ENSPANP00000002116 ..............................---------------LTDLQ.QIPTVVGESR-----.----------
hFl_ENSPANP00000014197 ..............................--------------------.---------------.----------
hFl_ENSPANP00000012648 ..............................--------------------.---------------.----------
hFl_ENSPANP00000020427 ..............................--------------------.---------------.----------
hFl_ENSPANP00000013098 ..............................--------------------.---------------.----------
hFl_ENSPANP00000010107 ..............................--------------------.---------------.----------
hFl_ENSPANP00000010990 ..............................--------------------.---------------.----------
hFl_ENSPANP00000001415 ..............................--------------------.---------------.----------
hFl_ENSPANP00000013054 ..............................--------------------.---------------.----------
hFl_ENSPANP00000009206 ..............................--------------------.---------------.----------
hFl_ENSPANP00000001415 ..............................--------------------.---------------.----------
hFl_ENSPANP00000004159 ..............................--------------------.---------------.----------
hFl_ENSPANP00000013482 ..............................--------------------.-----------T---.----------
hFl_ENSPANP00000018262 ..............................--------------------.---------------.----------
hFl_ENSPANP00000005398 ..............................--------------------.---------------.----------
hFl_ENSPANP00000014303 ..............................--------------------.---------------.----------
hFl_ENSPANP00000012662 ..............................--------------------.---------------.----------
hFl_ENSPANP00000005019 ..............................---------------KSWLK.NLAKEQLSHENIQSS.LLE-------
hFl_ENSPANP00000014970 ..............................--------------------.---------------.----------
hFl_ENSPANP00000006250 ..............................--------------------.---------------.----------
hFl_ENSPANP00000011359 ..............................--------------------.---------------.----------
hFl_ENSPANP00000013050 ..............................--------------------.---------------.----------
hFl_ENSPANP00000013482 ..............................--------------------.---------------.----------
hFl_ENSPANP00000018878 ..............................--------------------.---------------.----------
hFl_ENSPANP00000002756 ..............................--------------------.---------------.----------
hFl_ENSPANP00000018444 ..............................--------------------.---------------.----------
hFl_ENSPANP00000004247 ..............................--------------------.---------------.----------
hFl_ENSPANP00000006245 ..............................--------------------.---------------.----------
hFl_ENSPANP00000016200 ..............................--------------------.---------------.----------
hFl_ENSPANP00000013482 ..............................--------------------.---------------.----------
hFl_ENSPANP00000003778 ..............................--------------------.---------------.----------
hFl_ENSPANP00000017843 ..............................--------------------.---------------.----------
hFl_ENSPANP00000013803 ..............................--------------------.---------------.----------
hFl_ENSPANP00000008015 ..............................--------------------.---------------.----------
hFl_ENSPANP00000001644 ..............................--------------------.---------------.----------
hFl_ENSPANP00000007019 ..............................--------------------.---------------.----------
hFl_ENSPANP00000001901 ..............................--------------------.---------------.----------
hFl_ENSPANP00000000771 ..............................--------------------.---------------.----------
hFl_ENSPANP00000019402 ..............................--------------------.---------------.----------
hFl_ENSPANP00000006208 ..............................--------------------.---------------.----------
hFl_ENSPANP00000003981 ..............................--------------------.---------------.----------
hFl_ENSPANP00000018508 ..............................--------------------.---------------.----------
hFl_ENSPANP00000009319 ..............................--------------------.---------------.----------
hFl_ENSPANP00000002116 ..............................--------------------.---------------.----------
hFl_ENSPANP00000012089 ..............................--------------------.---------------.----------
hFl_ENSPANP00000016429 ..............................--------------------.---------------.----------
hFl_ENSPANP00000006158 ..............................--------------------.---------------.----------
hFl_ENSPANP00000001648 ..............................--------------------.---------------.----------
hFl_ENSPANP00000016703 ..............................--------------------.---------------.----------
hFl_ENSPANP00000013482 ..............................--------------------.---------------.----------
hFl_ENSPANP00000001714 ..............................--------------------.---------------.----------
hFl_ENSPANP00000001561 ..............................--------------------.---------------.----------
hFl_ENSPANP00000011759 ..............................--------------------.---------------.----------
hFl_ENSPANP00000016734 ..............................--------------------.---------------.----------
hFl_ENSPANP00000009674 ..............................--------------------.---------------.----------
hFl_ENSPANP00000007884 ..............................--------------------.---------------.----------
hFl_ENSPANP00000002971 ..............................--------------------.---------------.----------
hFl_ENSPANP00000015462 ..............................--------------------.---------------.----------
hFl_ENSPANP00000005656 ..............................--------------------.---------------.----------
hFl_ENSPANP00000009541 ..............................--------------------.---------------.----------
hFl_ENSPANP00000008758 ..............................--------------------.---------------.----------
hFl_ENSPANP00000003523 ..............................--------------------.---------------.----------
hFl_ENSPANP00000018367 ..............................--------------------.---------------.----------
hFl_ENSPANP00000007665 ..............................--------------------.---------------.----------
hFl_ENSPANP00000011360 ..............................--------------------.---------------.----------
hFl_ENSPANP00000005386 ..............................--------------------.---------------.----------
hFl_ENSPANP00000009203 ..............................--------------------.---------------.----------
hFl_ENSPANP00000003466 ..............................--------------------.---------------.----------
hFl_ENSPANP00000017137 ..............................--------------------.---------------.----------
hFl_ENSPANP00000013482 ..............................--------------------.---------------.----------
hFl_ENSPANP00000002234 ..............................--------------------.---------------.----------
hFl_ENSPANP00000003564 ..............................--------------------.---------------.----------
hFl_ENSPANP00000010846 ..............................--------------------.---------------.----------
hFl_ENSPANP00000017187 .eaqnelfeaqgqlqtwdtedfgspekccs--------------------.---------------.----------
hFl_ENSPANP00000008343 ..............................--------------------.---------------.----------
hFl_ENSPANP00000002482 ..............................--------------------.---------------.----------
hFl_ENSPANP00000010432 ..............................--------------------.---------------.----------
hFl_ENSPANP00000017137 ..............................--------------------.---------------.----------
hFl_ENSPANP00000005713 ..............................--------------------.---------------.----------
hFl_ENSPANP00000002260 ..............................--------------------.---------------.----------
hFl_ENSPANP00000007108 ..............................--------------------.---------------.----------
hFl_ENSPANP00000010072 ..............................--------------------.---------------.----------
hFl_ENSPANP00000002141 ..............................--------------------.---------------.----------
hFl_ENSPANP00000010969 ..............................--------------------.---------------.----------
hFl_ENSPANP00000016650 ..............................--------------------.---------------.----------
hFl_ENSPANP00000017922 ..............................--------------------.---------------.----------
hFl_ENSPANP00000011099 ..............................--------------------.---------------.----------
hFl_ENSPANP00000005052 ..............................--------------------.---------------.----------
hFl_ENSPANP00000001415 ..............................--------------------.---------------.----------
hFl_ENSPANP00000011769 ..............................--------------------.---------------.----------
hFl_ENSPANP00000009206 ..............................--------------------.---------------.-------EQE
hFl_ENSPANP00000001646 ..............................--------------------.---------------.----------
hFl_ENSPANP00000020875 ..............................--------------------.---------------.---------K
hFl_ENSPANP00000000260 ..............................--------------------.---------------.----------
hFl_ENSPANP00000020875 ..............................--------------------.---------------.----------
hFl_ENSPANP00000005819 ..............................--------------------.---------------.----------
hFl_ENSPANP00000013481 ..............................--------------------.---------------.----------
hFl_ENSPANP00000016713 ..............................--------------------.---------------.----------
hFl_ENSPANP00000003270 ..............................--------------------.---------------.----------
hFl_ENSPANP00000020875 ..............................--------------------.--------------L.----------
hFl_ENSPANP00000019992 ..............................--------------------.---------------.----------
hFl_ENSPANP00000020877 ..............................--------------------.---------------.----------
hFl_ENSPANP00000017252 ..............................--------------------.---------------.----------
hFl_ENSPANP00000012991 ..............................--------------------.--------HSC----.----------
hFl_ENSPANP00000016852 ..............................--------------------.---------------.----------
hFl_ENSPANP00000000400 ..............................--------------------.---------------.----------
hFl_ENSPANP00000000366 ..............................--------------------.---------------.----------
hFl_ENSPANP00000014303 ..............................--------------------.---------------.----------
hFl_ENSPANP00000005825 ..............................--------------------.---------------.----------
hFl_ENSPANP00000007500 ..............................--------------------.---------------.----------
hFl_ENSPANP00000000752 ..............................--------------------.---------------.----------
hFl_ENSPANP00000008665 ..............................--------------------.---------------.----------
hFl_ENSPANP00000019328 ..............................--------------------.---------------.----------
hFl_ENSPANP00000020336 ndvdtalsfyhmagasldkvtmqqvartva--------------------.---------------.----------
hFl_ENSPANP00000002971 ..............................--------------------.---------------.----------
hFl_ENSPANP00000020875 ..............................--------------------.-----------K---.----------
hFl_ENSPANP00000015375 ..............................--------------------.---------------.----------
hFl_ENSPANP00000013482 ..............................--------------------.---------------.----------
hFl_ENSPANP00000001076 ..............................--------------------.---------------.----------
hFl_ENSPANP00000017843 ..............................--------------------.---------------.----------
hFl_ENSPANP00000006270 ..............................--------------------.-----------TKPK.----------
hFl_ENSPANP00000002752 ..............................--------------------.---------------.----------
hFl_ENSPANP00000010107 ..............................--------------------.---------------.----------
hFl_ENSPANP00000007279 ..............................--------------------.---------------.----------
hFl_ENSPANP00000018263 ..............................--------------------.---------------.----------
hFl_ENSPANP00000013803 ..............................--------------------.---------------.----------
hFl_ENSPANP00000011977 ..............................--------------------.---------------.----------
hFl_ENSPANP00000006880 ..............................--------------------.---------------.----------
hFl_ENSPANP00000008114 ..............................--------------------.---------------.----------
hFl_ENSPANP00000009030 ..............................--------------------.---------------.----------
hFl_ENSPANP00000016306 ..............................--------------------.---------------.----------
hFl_ENSPANP00000019993 ..............................--------------------.---------------.----------
hFl_ENSPANP00000000366 ..............................--------------------.---------------.----------
hFl_ENSPANP00000018199 ..............................--------------------.---------------.--------IR
hFl_ENSPANP00000020672 ..............................--------------------.---------------.----------
hFl_ENSPANP00000008729 ..............................--------------------.---------------.--------IR
hFl_ENSPANP00000006250 ..............................--------------------.---------------.----------
hFl_ENSPANP00000011328 ..............................--------------------.---------------.----------
hFl_ENSPANP00000012268 ..............................--------------------.---------------.----------
hFl_ENSPANP00000018718 ..............................--------------------.---------------.----------
hFl_ENSPANP00000010889 ..............................--------------------.---------------.----------
hFl_ENSPANP00000020671 ..............................--------------------.---------------.------I---
hFl_ENSPANP00000011848 ..............................--------------------.---------------.----------
hFl_ENSPANP00000020673 ..............................--------------------.---------------.------I---
hFl_ENSPANP00000006193 ..............................--------------------.---------------.----------
hFl_ENSPANP00000015860 ..............................--------------------.---------------.----------
hFl_ENSPANP00000003135 ..............................--------------------.---------------.----------
hFl_ENSPANP00000008557 ..............................--------------------.---------------.----------
hFl_ENSPANP00000014970 ..............................--------------------.---------------.----------
hFl_ENSPANP00000009124 ..............................--------------------.---------------.----------
hFl_ENSPANP00000003056 ..............................--------------------.---------------.----------
hFl_ENSPANP00000013460 ..............................--------------------.---------------.----------
hFl_ENSPANP00000016675 ..............................--------------------.---------------.----------
hFl_ENSPANP00000016846 ..............................--------------------.---------------.----------
hFl_ENSPANP00000011328 ..............................--------------------.---------------.----------
hFl_ENSPANP00000004053 ..............................--------------------.---------------.----------
hFl_ENSPANP00000017871 ..............................--------------------.---------------.-----KLKLK
hFl_ENSPANP00000004677 ..............................--------------------.---------------.-----KLKLK
hFl_ENSPANP00000018325 ..............................--------------------.---------------.----------
hFl_ENSPANP00000016823 ..............................--------------------.---------------.----------
hFl_ENSPANP00000016006 ..............................--------------------.---------------.----------
hFl_ENSPANP00000018508 ..............................--------------------.---------------.----------
hFl_ENSPANP00000018829 ..............................--------------------.---------------.----------
hFl_ENSPANP00000016824 ..............................--------------------.---------------.----------
hFl_ENSPANP00000010241 ..............................--------------------.---------------.----------
hFl_ENSPANP00000002202 ..............................--------------------.---------------.----------
hFl_ENSPANP00000020427 ..............................--------------------.---------------.----------
hFl_ENSPANP00000020450 ..............................--------------------.---------------.----------
hFl_ENSPANP00000019970 ..............................--------------------.---------------.----------
hFl_ENSPANP00000017056 ..............................--------------------.---------------.----------
hFl_ENSPANP00000012483 ..............................--------------------.---------------.----------
hFl_ENSPANP00000017055 ..............................--------------------.---------------.----------
hFl_ENSPANP00000009566 ..............................----------F---------.---------------.----------
hFl_ENSPANP00000013482 ..............................--------------------.---------------.----------
hFl_ENSPANP00000007665 ..............................--------------------.---------------.----------
hFl_ENSPANP00000018367 ..............................--------------------.---------------.----------
hFl_ENSPANP00000012679 ..............................--------------------.---------------.----------
hFl_ENSPANP00000012680 ..............................--------------------.---------------.----------
hFl_ENSPANP00000008763 ..............................--------------------.---------------.----------
hFl_ENSPANP00000019937 ..............................--------------------.---------------.----------
hFl_ENSPANP00000012527 ..............................--------------------.---------------.----------
hFl_ENSPANP00000008287 ..............................--------------------.---------------.----------
hFl_ENSPANP00000004139 ..............................--------------------.---------------.----------
hFl_ENSPANP00000004290 ..............................--------------------.---------------.----------
hFl_ENSPANP00000020336 ..............................--------------------.---------------.----------
hFl_ENSPANP00000003145 ..............................--------------------.---------------.----------
hFl_ENSPANP00000017380 ..............................--------------LYDLFK.REHMMSCYWEQPRPT.ASRHD---PS
hFl_ENSPANP00000019527 ..............................--------------------.---------------.----------
hFl_ENSPANP00000016200 ..............................------------R-------.---------------.----------
hFl_ENSPANP00000013484 ..............................--------------------.---------------.----------
hFl_ENSPANP00000019122 ..............................--------------LEDFLR.YRHQAAKRGDRDRAL.SEE-------
hFl_ENSPANP00000011328 ..............................--------------------.---------------.----------
hFl_ENSPANP00000005617 ..............................--------------------.---------------.----------
hFl_ENSPANP00000011677 ..............................--------------------.---------------.----------
hFl_ENSPANP00000002004 ..............................--------------------.---------------.----------
hFl_ENSPANP00000005046 ..............................--------------------.---------------.----------
hFl_ENSPANP00000020438 ..............................--------------------.---------------.----------
hFl_ENSPANP00000020442 ..............................--------------------.---------------.----------
hFl_ENSPANP00000016734 ..............................--------------------.---------------.----------
hFl_ENSPANP00000008645 ..............................--------------------.---------------.----------
hFl_ENSPANP00000003048 ..............................--------------------.---------------.----------
hFl_ENSPANP00000001629 ..............................--------------------.---------------.----------
hFl_ENSPANP00000007857 ..............................--------------------.---------------.----------
hFl_ENSPANP00000012179 ..............................--------------------.---------------.----------
hFl_ENSPANP00000020858 ..............................--------------------.---------------.----------


                          50            60        70                 80          90                1
                           |             |         |                  |           |                 
d1sraa_                KIHENEK....RLEAGDHPVELLARDFEKNYNM.........YIFPVHWQ..FGQLDQHPIDG.YLSH........T
hFl_ENSPANP00000005664 KFAEHVF....RTFDANGDGTIDFREFIIALSVtsrgk....LEQKLKWA..FSMYDLDG-NG.YISK........A
hFl_ENSPANP00000015843 KFAEHVF....RTFDTNSDGTIDFREFIIALSVtsrgr....LEQKLMWA..FSMYDLDG-NG.YISR........E
hFl_ENSPANP00000018838 KFATFVF....NVFDENKDGRIEFSEFIQALSVtsrgt....LDEKLRWA..FKLYDLDN-DG.YITR........N
hFl_ENSPANP00000000687 ----DTC....R---------------------.........------SM..VAVMDSDT-TG.KLGF........E
hFl_ENSPANP00000011132 PLVQRVI....DIFDTDGNGEVDFKEFIEGVSQfsvkgd...KEQKLRFA..FRIYDMDK-DG.YISN........G
hFl_ENSPANP00000011888 AELQDMI....NEVDADGNGTIDFPEFLTMMARkmkdtd...SEEEIREA..FRVFDKDG-NG.YISA........A
hFl_ENSPANP00000012946 KFAEHVF....RTFDTNGDGTIDFREFIIALSVtsrgk....LEQKLKWA..FSMYDLDG-NG.YISR........S
hFl_ENSPANP00000015640 AELQDMI....NEVDADGNGTIDFPEFLTMMARkmkdtd...SEEEIREA..FRVFDKDG-NG.YISA........A
hFl_ENSPANP00000008517 --LRDML....SEIDRDGNGTVDFPEFLGMMARkmkdtd...NEEEIREA..FRVFDKDG-NG.FVSA........A
hFl_ENSPANP00000017051 ------C....PRTD------------------.........--------..-----------.----........-
hFl_ENSPANP00000008208 KFAQHAF....RTFDKNGDGTIDFREFICALSItsrgs....FEQKLNWA..FNMYDLDG-DG.KITR........V
hFl_ENSPANP00000000685 -------....--------L-------------.........--------..-----------.----........-
hFl_ENSPANP00000001217 KIHENEK....RLEAGDHPVELLARDFEKNYNM.........YIFPVHWQ..FGQLDQHPIDG.YLSH........T
hFl_ENSPANP00000009011 KFAQHAF....RTFDKNGDGTIDFREFICALSVtsrgs....FEQKLNWA..FEMYDLDG-DG.RITR........L
hFl_ENSPANP00000016439 -------....-----------------KTHGF.........TLESCRSM..IALMDTDG-SG.KLNL........Q
hFl_ENSPANP00000020904 TYATFLF....NAFDTNHDGSVSFEDFVAGLSVilrgt....VDDRLNWA..FNLYDLNK-DG.CITK........E
hFl_ENSPANP00000011992 KIYLDEK....RLLAGDHPIDLLLRDFKKNYHM.........YVYPVHWQ..FSELDQHPMDR.VLTH........S
hFl_ENSPANP00000011142 -------....----------------------.........--------..-----------.-I--........-
hFl_ENSPANP00000008176 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000016326 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000005573 -------....-------------------TED.........QKQEVREA..FDLFDADG-SG.TIDV........K
hFl_ENSPANP00000018511 TYAHFLF....NAFDTDHNGAVSFEDFIKGLSIllrgt....VQEKLNWA..FNLYDINK-DG.YITK........E
hFl_ENSPANP00000007984 QWLSDWF....QRGDKNQDGKMSFQEVQRLLHLmnvem....DQEYAFSL..FQAADTSQ-SG.TLEG........E
hFl_ENSPANP00000009334 AQLQNLI....SQVDSDGDGEISFEEFMAAVKKtra......GREDLQVA..FRAFDQDG-DG.HITV........D
hFl_ENSPANP00000011977 -------....----------------D-----.........--------..-----------.----........-
hFl_ENSPANP00000006880 -------....----------------D-----.........--------..-----------.----........-
hFl_ENSPANP00000016389 -------....--------------------NS.........RSNKLHFA..FRLYDLDK-DE.KISR........D
hFl_ENSPANP00000017625 EELDAII....EEVDEDGSGTIDFEEFLVMMVRqmkedakgkSEEELAEC..FRIFDRNA-DG.YIDP........E
hFl_ENSPANP00000020753 -----MI....SEIDKEGTGKMNFGDFLTVMTQkmsekd...TKEEILKA..FKLFDDDE-TG.KISF........K
hFl_ENSPANP00000011482 TYAHFLF....NAFDADGNGAIHFEDFVVGLSIllrgt....VHEKLKWA..FNLYDINK-DG.YITK........E
hFl_ENSPANP00000008596 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000014722 TYAHYLF....NAFDTTQTGSVKFEDFVTALSIllrgt....VHEKLRWT..FNLYDINK-DG.YINK........E
hFl_ENSPANP00000010579 ESCRSMV....NLMDRDGNGKLGLVEFNILWNR.........IRNYLS-I..FRKFDLDK-SG.SMSA........Y
hFl_ENSPANP00000018638 -------....----------------------.........----CRLM..VSMLDRDM-SG.KMGF........N
hFl_ENSPANP00000007213 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000001594 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000002108 -------....----------------------.........----IHSC..LRKADKNK-DN.KMSF........K
hFl_ENSPANP00000007118 -------....----------------------.........--QWVKQT..FEEADKNG-DG.LLNI........E
hFl_ENSPANP00000006887 -------....----------------------.........----CKIM..VDMLDSDG-SG.KLGL........K
hFl_ENSPANP00000020829 ---HSYL....HRADSNQDSKMSFKEIKSLLRMvnvdm....NDMYAYLL..FKECDHSN-ND.RLEG........A
hFl_ENSPANP00000004533 -------....----------------------.........SEEELSDL..FRMFDKNA-DG.YIDL........D
hFl_ENSPANP00000005357 -------....----------------------.........NDETCLMM..INMFDKTK-SG.RIDV........-
hFl_ENSPANP00000014595 -------....----------I-----------.........--------..-----------.----........-
hFl_ENSPANP00000019694 AYAQHVF....RSFDSNLDGTLDFKEYVIALHMttagk....TNQKLEWA..FSLYDVDG-NG.TISK........N
hFl_ENSPANP00000012647 QYVEQMF....ETFDFNKDGYIDFMEYVAALSLvlkgk....VEQKLRWY..FKLYDVDG-NG.CIDR........D
hFl_ENSPANP00000011841 KLSLISCkniiSLMDTSGNGKLEFDEFKVFWDK.........LKQWIN-L..FLRFDADK-SG.TMST........Y
hFl_ENSPANP00000007138 -DVLKIL....KDYDREATGKITFEDFNEVVTDwilerd...PHEEILKA..FKLFDDDD-SG.KISL........R
hFl_ENSPANP00000005603 -------....-----------------EKAQN.........QESELRAA..FRVFDKEG-KG.YIDW........N
hFl_ENSPANP00000003537 -------....----------------------.........--SWVSQM..FSEIDVDN---.----........-
hFl_ENSPANP00000016730 -------....----------------------.........-------A..FNMIDQNR-DG.FIDK........E
hFl_ENSPANP00000004388 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000004958 -------....----------------------.........-------A..FNMIDQNR-DG.FIDK........E
hFl_ENSPANP00000017808 -------....----------------------.........----CRIM..IAMLDRDY-TG.KLGF........S
hFl_ENSPANP00000006158 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000000685 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000001746 -------....----------------------.........---ELRDA..FREFDTNG-DG.EIST........S
hFl_ENSPANP00000005266 -------....----------------------.........GVRELRDA..FREFDTNG-DG.RISV........G
hFl_ENSPANP00000011699 -------....----------------ETAHML.........GVRELRIA..FREFDRDR-DG.RITV........A
hFl_ENSPANP00000001618 ---EKIF....TTGDVNKDGKLDFEEFMKYLKD.........HEKKMKLA..FKSLDKNN-DG.KIEA........S
hFl_ENSPANP00000010432 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000019362 GELRKIV....QAGDKDLDGQLDFEEFVHYLQD.........HEKKLRLV..FKSLDKKN-DG.RIDA........Q
hFl_ENSPANP00000005159 -------....----------------------.........----MRDA..FKEFDTNG-DG.EITL........A
hFl_ENSPANP00000011834 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000004357 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000010858 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000010399 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000004118 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000010678 -------....------------Q---------.........--------..-----------.----........-
hFl_ENSPANP00000008201 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000000555 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000014173 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000002207 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000001879 -------....--------------------SR.........LEAVLSTI..FYQLN------.----........-
hFl_ENSPANP00000005388 TSILPIC....KDS-------------------.........----LGWM..FNRLDTNY-DL.LLDQ........S
hFl_ENSPANP00000002662 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000009999 -------....----------------------.........-------V..FRIMDDDN-NR.TLDF........K
hFl_ENSPANP00000004626 -------....----------------------.........------EA..FTLMDQNR-DG.FIDK........E
hFl_ENSPANP00000006233 -------....----------------------.........------EA..FTIMDQNR-DG.FIDK........N
hFl_ENSPANP00000002660 KHVDQVY....NTFDTNKDGFIDFLEFIAAVNLivqek....MEQKLKWY..FKLYDVDG-NG.SIDK........N
hFl_ENSPANP00000011209 TSILPIC....KDS-------------------.........----LGWM..FNKLDMNY-DL.LLDH........S
hFl_ENSPANP00000020345 KSLGASC....KDS-------------------.........----IGWM..FSKLDTSA-DL.FLDQ........T
hFl_ENSPANP00000020343 KSLGASC....KDS-------------------.........----IGWM..FSKLDTSA-DL.FLDQ........T
hFl_ENSPANP00000008924 -------....----------------------.........-------V..FRGFDKDN-DG.CVNV........L
hFl_ENSPANP00000015530 -------....----------------------.........-------A..FTIMDQNR-DG.FIDK........E
hFl_ENSPANP00000008596 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000002265 -------....----------------------.........----FVEG..LRVFDKEG-NG.TVMG........A
hFl_ENSPANP00000014191 -------....----------------------.........------EA..FTVIDQNR-DG.IIDK........E
hFl_ENSPANP00000012413 -------....-----------------EPLNS.........RRNKLHYA..FQLYDLDR-DG.KISR........H
hFl_ENSPANP00000007079 -------....--------------------TD.........PEEAILSA..FRMFDPSG-KG.VVNK........E
hFl_ENSPANP00000012088 -------....SEGDADPDGGLDLEEFSRYLQE.........REQRLLLM..FHSLDRNQ-DG.HIDV........S
hFl_ENSPANP00000020865 -------....----------------------.........--------..-RVFDKES-NG.TVMG........A
hFl_ENSPANP00000003943 -------....--------------EFT---GV.........WKYITDWQnvFRTYDRDN-SG.MIDK........N
hFl_ENSPANP00000005422 -------....-----------RLSEPDPSHTL.........EERVVHWY..FKLLDKNS-SG.DIGK........K
hFl_ENSPANP00000015281 ----GVC....RRWDRDGSGTLDLEEFLRALRPpmsqa....REAVIAAA..FAKLDRSG-DG.VVTV........D
hFl_ENSPANP00000017172 -------....------------FSEPDPSHTL.........EERVVHWY..FSQLDSNS-SN.DINK........R
hFl_ENSPANP00000014458 -------....----------------------.........-----HYA..FRIFDFDD-DG.TLNR........E
hFl_ENSPANP00000008201 ----E--....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000004357 ----E--....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000004505 -----MV....AMMDSDITGKLDFEEFKYLWNN.........IKR-----..---------SG.TICT........S
hFl_ENSPANP00000012751 -------....---SSSKGGRIGIDEFAKYLKLp........VSDVLRQL..FALFDRNH-DG.SIDF........R
hFl_ENSPANP00000001879 -------....----------------------.........--Q-----..-----------.----........-
hFl_ENSPANP00000001065 -------....-----DGDGHMTLDNFLDMFSVmsemap...RDLKAYYA..FKIYDFNN-DD.YICA........W
hFl_ENSPANP00000009095 -------....SEGDADPDGGLDLEEFSRYLQE.........REQRLLLM..FHSLDRNQDAG.HIDV........S
hFl_ENSPANP00000013050 -------....-------------------SSL.........PQAQLASI..WNLSDIDQ-DG.KLTA........E
hFl_ENSPANP00000013054 -------....-------------------SSL.........PQAQLASI..WNLSDIDQ-DG.KLTA........E
hFl_ENSPANP00000014002 -------....----------------------.........---FVESM..FSLADKDG-NG.YLSF........R
hFl_ENSPANP00000008287 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000016675 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000013999 -------....----------------------.........---FVESM..FSLADKDG-NG.YLSF........R
hFl_ENSPANP00000003565 -------....----------------------.........--------..-----------.----........T
hFl_ENSPANP00000018211 -------....----------------------.........--LKIEYA..FRIYDFNE-NG.FIDE........E
hFl_ENSPANP00000010407 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000016650 -------....----------------------.........--------..FKMADKDG-DL.IATK........E
hFl_ENSPANP00000001581 -------....----------------------.........--------..-------GYNY.TLSKteflsfmnT
hFl_ENSPANP00000016006 -------....----------------------.........----FLEI..WKHFDADG-NG.YIEG........K
hFl_ENSPANP00000015459 -------....----------------------.........-------M..FREADTDDHQG.TLGF........E
hFl_ENSPANP00000014312 ----RIV....AAFSEDGEGNLTFNDFVDMFSVlcesap...RELKANYA..FKIYDFNT-DN.FICK........E
hFl_ENSPANP00000010990 -------....---------GFQARNALLQSNL.........SQTQLATI..WTLADIDG-DG.QLKA........E
hFl_ENSPANP00000002202 -------....----------------------.........-----GKI..VDRIDNDG-DG.FVTT........E
hFl_ENSPANP00000007279 -------....----------------------.........-----GKI..VDRIDNDG-DG.FVTT........E
hFl_ENSPANP00000011150 -------....----------------KKEAQR.........YRNEVRHI..FTAFDTYY-RG.FLTL........E
hFl_ENSPANP00000008402 -------....---------QEAHSTLVETLYR.........YRSDLEII..FNAIDTDH-SG.LISM........E
hFl_ENSPANP00000018674 -------....----------------------.........--------..-ALLDLNA-SG.TMSI........Q
hFl_ENSPANP00000002971 -------....----------------------.........------EI..FLKTDKDM-DG.FVSG........L
hFl_ENSPANP00000002116 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000014197 -------....----------------------.........--------..---------DG.EISL........Q
hFl_ENSPANP00000012648 -------....---------------------T.........LEHKLKWT..FKIYDKDG-NG.CIDR........L
hFl_ENSPANP00000020427 -------....----------------------.........-------L..FNAFDENR-DN.HIDF........K
hFl_ENSPANP00000013098 -------....----------------------.........ELEEIREA..FKVFDRDG-NG.FISK........Q
hFl_ENSPANP00000010107 -------....----------------------.........--------..FRVADQDG-DS.MATR........E
hFl_ENSPANP00000010990 -------....--------------------GL.........PAPVLAEI..WALSDLNK-DG.KMDQ........Q
hFl_ENSPANP00000001415 -------....---------------------L.........PLDVLGRV..WDLSDIDK-DG.HLDR........D
hFl_ENSPANP00000013054 -------....--------------------GL.........PQPVLAQI..WALADMNN-DG.RMDQ........V
hFl_ENSPANP00000009206 -------....--------------EDKRNPTS.........----IEYW..FRCMDVDG-DG.TLSM........Y
hFl_ENSPANP00000001415 -------....----------------------.........------EI..FLKTDLDL-DG.YVSG........Q
hFl_ENSPANP00000004159 -------....------------------VELS.........RKEKLRFL..FHMYDSDS-DG.RITL........E
hFl_ENSPANP00000013482 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000018262 -------....----------------------.........--------..-----------.KLSK........K
hFl_ENSPANP00000005398 -------....----------------------.........------AI..FHKFDEDA-SG.TMNS........Y
hFl_ENSPANP00000014303 -------....----------------------.........--------..VNDYDKDN-DG.RLDP........Q
hFl_ENSPANP00000012662 -------....----------------------.........--------..----------H.KLKK........S
hFl_ENSPANP00000005019 -------....------------------TLYR.........NRSNLETI..FRIIDSDH-SG.FISL........D
hFl_ENSPANP00000014970 -------....----------------------.........-----MKT..WRKYDTDH-SG.FIET........E
hFl_ENSPANP00000006250 -------....----------------------.........-----MKT..WRKYDTDH-SG.FIET........E
hFl_ENSPANP00000011359 -------....----------------------.........--------..FHKYSGKEGDKfKLNK........S
hFl_ENSPANP00000013050 -------....---------------------L.........PQPVLAQI..WALADMNN-DG.RMDQ........V
hFl_ENSPANP00000013482 -------....-------------------FKN.........IKT-VLKA..FKLIDVNK-TG.LIQP........Q
hFl_ENSPANP00000018878 -------....-------------RNTTGVTEE.........ALKEFSMM..FKHFDKDK-SG.RLNH........Q
hFl_ENSPANP00000002756 -------....----------------------.........--------..----------G.YLTK........E
hFl_ENSPANP00000018444 -------....----------------------.........--------..-----------.--TK........G
hFl_ENSPANP00000004247 -------....----------------------.........---EIREA..FRVLDRDG-NG.FISK........Q
hFl_ENSPANP00000006245 -------....----------------------.........--------..----------D.TLNR........R
hFl_ENSPANP00000016200 -------....----------LISEEDKKTP--.........--TSIEYW..FRCMDLDG-DG.ALSM........F
hFl_ENSPANP00000013482 -------....----------------------.........----LSKN..FLETDNEG-NG.ILRR........R
hFl_ENSPANP00000003778 -------....----------------------.........SADDVKKV..FHILDKDK-SG.FIEE........D
hFl_ENSPANP00000017843 -------....------------------SRGM.........LRFMVKEI..VRDLDQDG-DK.QLSL........P
hFl_ENSPANP00000013803 -------....----------------------.........--VEFMQI..WRKYDADS-SG.FISA........A
hFl_ENSPANP00000008015 -------....---------------------L.........PNSVLGRI..WKLSDVDR-DG.MLDD........E
hFl_ENSPANP00000001644 -------....----------------------.........------KY..FQQLDKEG-NG.LLDK........A
hFl_ENSPANP00000007019 -------....----------------------.........--------..-----------.KLSK........G
hFl_ENSPANP00000001901 -------....---------------------L.........PNSVLGKI..WKLADIDK-DG.MLDD........E
hFl_ENSPANP00000000771 -------....-------------RDAKGISQE.........QMQEFRAS..FNHFDKDH-GG.ALGP........E
hFl_ENSPANP00000019402 -------....----------------------.........DTDYLSTA..FEKKDENK-DK.KINY........S
hFl_ENSPANP00000006208 -------....--------------------KL.........PNTVLGKI..WKLADVDK-DG.LLDD........E
hFl_ENSPANP00000003981 -------....----------------------.........-IHYLASV..FERKDKNE-DK.KIDF........S
hFl_ENSPANP00000018508 -------....----------------------.........--------..-GVADQTK-DG.LISY........Q
hFl_ENSPANP00000009319 -------....----------ILTRDAKGITQE.........QMNEFRAS..FNHFDRRK-NG.LMDH........E
hFl_ENSPANP00000002116 -------....Q---------------------.........--------..-----------.----........-
hFl_ENSPANP00000012089 --FARIM....TMVDPNAAGVVTFQAFIDFMTRetaetd...TAEQVVAS..FKILAGDK--N.YITP........E
hFl_ENSPANP00000016429 -------....--------------------KL.........PNSVLGKI..WKLADCDC-DG.MLDE........E
hFl_ENSPANP00000006158 -------....---------------------R.........PEDKLEFM..FRLYDTDG-NG.FLDS........S
hFl_ENSPANP00000001648 -------....----------------------.........--------..----KQDGECG.TLSK........D
hFl_ENSPANP00000016703 -------....------------------LSKM.........SASQVKDI..FRFIDNDQ-SG.YLDE........E
hFl_ENSPANP00000013482 -------....-AV-----------------TS.........HYHAITQE..FENFDTMK-TN.TISR........E
hFl_ENSPANP00000001714 -------....----------------RRYRPI.........PEDVLLRA..FEVLDSAK-RG.FLTK........D
hFl_ENSPANP00000001561 -------....----------------------.........----LEDM..FSLFDESG-SG.QVDL........R
hFl_ENSPANP00000011759 -------....----------------------.........---KV---..---------DG.RLDQ........E
hFl_ENSPANP00000016734 -------....----------------------.........--LRVYGQ..YLNLDKDH-NG.MLSK........E
hFl_ENSPANP00000009674 -------....----------------------.........----SRPV..FDLLDLKG-DL.RIGA........K
hFl_ENSPANP00000007884 -------....----------------------.........--------..-----------.---Q........A
hFl_ENSPANP00000002971 -----YY....RQVDTGNTGRVFASDAAAFLKKsgl......PDLILGKI..WDLADTDG-KG.ILNK........Q
hFl_ENSPANP00000015462 -------....----------------------.........SADDVKKV..FHILDKDK-SG.FIEE........D
hFl_ENSPANP00000005656 -------....-TLSKGELKQLLPKELANTIKNtr.......DKAVINKI..FQGLDANQ-DE.QVDF........Q
hFl_ENSPANP00000009541 -------....----------------------.........---ELQEA..FNKIDIDN-SG.YVSD........Y
hFl_ENSPANP00000008758 -------....----------------------.........-----QAI..FHKFDEDA-SG.TMNS........Y
hFl_ENSPANP00000003523 -------....----------------------.........--------..----------D.QLSK........D
hFl_ENSPANP00000018367 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000007665 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000011360 -------....--LCKEELKQLLLAEFGDILQRpn.......DPETVETI..LNLLDQDR-DG.RVDF........H
hFl_ENSPANP00000005386 -------....----------------------.........---TLLAA..FRHYDKKG-DG.MIDK........A
hFl_ENSPANP00000009203 -------....----------------------.........--------..--------GDKhTLSK........K
hFl_ENSPANP00000003466 -------....----------------------.........--------..-----------.TLSR........K
hFl_ENSPANP00000017137 -------....----------------------.........---EFRAS..FNHFDRDH-SG.TLGP........E
hFl_ENSPANP00000013482 -------....ESHKENIITKLFRHTEDRFTSL.........KKA-----..LLIINTKP-NG.PITR........E
hFl_ENSPANP00000002234 -------....----------------------.........----LLKS..FKQLDVND-DG.CILH........T
hFl_ENSPANP00000003564 -------....----------------------.........--------..---------KD.SLSI........N
hFl_ENSPANP00000010846 -------....------------YTEFKEFSRK.........QIKDMEKM..FKQYDAGR-DG.FIDL........M
hFl_ENSPANP00000017187 -------....-----------------PSFDT.........PESQIRGM..WEELGVGS-HG.HLSE........Q
hFl_ENSPANP00000008343 -------....----------------------.........------TF..FKLHDVNS-DG.FLDE........Q
hFl_ENSPANP00000002482 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000010432 -------....----------------------.........PQDKLEFM..FRLYDSDE-NG.LLDQ........A
hFl_ENSPANP00000017137 -------....----------------------.........--DQVMAS..FKILAGDK--N.YITV........D
hFl_ENSPANP00000005713 -------....-------------TEFPEFSRR.........LIKDLESM..FKLYDAGR-DG.FIDL........M
hFl_ENSPANP00000002260 -------....----------------------.........---ELREA..FAKVDTDG-NG.YISF........N
hFl_ENSPANP00000007108 -------....----------------------.........--------..-----------.----........K
hFl_ENSPANP00000010072 -------....----------------------.........------TF..FILHDINS-DG.VLDE........Q
hFl_ENSPANP00000002141 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000010969 -------....------------------NVQM.........DENTLHEI..LNEVDLNK-NG.QVEL........N
hFl_ENSPANP00000016650 -------....QSFDYDHDAFLGAEEAKTFDQLtpee.....SKERLGKI..VSKIDGDK-DG.FVTV........D
hFl_ENSPANP00000017922 -------....------------------NVQM.........DENTLHEI..LNEVDLNK-NG.QVEL........N
hFl_ENSPANP00000011099 -------....KELLENEFHQILKNPNDPD---.........---TVDII..LQNLDRDH-NK.KVDF........T
hFl_ENSPANP00000005052 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000001415 -------....----------------------.........----LGKI..WDLADPEG-KG.FLD-........-
hFl_ENSPANP00000011769 -------....----------------------.........---ELKEA..FAKVDLNS-NG.FICD........Y
hFl_ENSPANP00000009206 DFIPLLQ....DVVDTHPGLTFLKDAPEFHSRY.........ITTVIQRI..FYTVNRSW-SG.KITS........T
hFl_ENSPANP00000001646 -------....------------PKELANTIKNtr.......DKAV----..-----------.----........-
hFl_ENSPANP00000020875 DEFLAAL....KLVTVDEGDKVQFEEFAQVVRN.........MRDA----..-----------.----........-
hFl_ENSPANP00000000260 -------....----------------------.........--------..----DLNS-NG.FICD........Y
hFl_ENSPANP00000020875 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000005819 -------....---------------YMRWMNH.........KKSRVMDF..FRRIDKDQ-DG.KITR........Q
hFl_ENSPANP00000013481 -------....----------------------.........CAQALTRI..FRLSDQDL-DQ.ALSD........E
hFl_ENSPANP00000016713 -------....---------------YMRWMNH.........KKSRVMDF..FRRIDKDQ-DG.KITR........Q
hFl_ENSPANP00000003270 -------....----------------------.........----FSTI..YKHFDENL-TG.HLTH........K
hFl_ENSPANP00000020875 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000019992 -------....----------LYCPEEKEMKPA.........CIKALTRI..FKISDQDN-DG.TLND........A
hFl_ENSPANP00000020877 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000017252 -------....----------------------.........-------Y..FKMHDYDG-NN.LLDG........L
hFl_ENSPANP00000012991 -------....----------------------.........-KDNIREA..FQIYDKEA-SG.YVDR........D
hFl_ENSPANP00000016852 -------....----------------------.........-EARLKEL..FDSFDTTG-TG.SLGQ........E
hFl_ENSPANP00000000400 -------....RAADRKHTKKVDYNTFRD----.........----ILMS..FT-------VG.NLSE........Q
hFl_ENSPANP00000000366 -------....----------------------.........--HLVNTV..FKIFDVDK-DD.QLSY........K
hFl_ENSPANP00000014303 -------....----------------------.........------AI..IKKIDLDS-DG.FLTE........S
hFl_ENSPANP00000005825 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000007500 -------....------------------VVEH.........IEKMVESV..FRNFDVDG-DG.HISQ........E
hFl_ENSPANP00000000752 -------....------------------VVEH.........IEKMVESV..FRNFDVDG-DG.HISQ........E
hFl_ENSPANP00000008665 -------....----------------------.........----AQEF..FQTCDAEG-KG.FIAR........K
hFl_ENSPANP00000019328 -------....----------------------.........----LRSV..FAACDANR-SG.RLER........E
hFl_ENSPANP00000020336 -------....------------------KVEL.........SDHVCDVV..FALFDCDG-NG.ELSN........K
hFl_ENSPANP00000002971 -------....----------------------.........--------..WELSDIDH-DG.MLDR........D
hFl_ENSPANP00000020875 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000015375 -------....-------SQILPTEEYEEAMST.........MQVSQLDL..FQLLDQNR-DG.HLQL........R
hFl_ENSPANP00000013482 -------....---------------F------.........--------..-----------.----........-
hFl_ENSPANP00000001076 -------....----------------------.........RDSLALWT..FRLLDENS-DC.LINF........K
hFl_ENSPANP00000017843 -------....----------------------.........-RRKLMVI..FSKVDVNT-DR.KISA........K
hFl_ENSPANP00000006270 -------....----------------------.........----YREI..LSELDEHT-EN.K---........-
hFl_ENSPANP00000002752 -------....----------------------.........-----HES..FQEMDLND-DW.KLSK........D
hFl_ENSPANP00000010107 -------....----------------------.........--------..------DG-DG.WVSL........A
hFl_ENSPANP00000007279 -------....----------------------.........--------..--DIDKNG-DG.FVDQ........D
hFl_ENSPANP00000018263 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000013803 -------....----LQENFLLQFKMDACSTEE.........RKRDFEKI..FAHYDVSK-TG.ALEG........P
hFl_ENSPANP00000011977 -------....----------------------.........-EDKLEFT..FKLYDTDR-NG.ILDS........S
hFl_ENSPANP00000006880 -------....----------------------.........-EDKLEFT..FKLYDTDR-NG.ILDS........S
hFl_ENSPANP00000008114 -------....----------------------.........----AGRM..FRLLDKNK-DS.LINF........K
hFl_ENSPANP00000009030 -------....----------------------.........-----LDI..FRRADKND-DG.KLSL........E
hFl_ENSPANP00000016306 -------....--------------DPKTISKH.........VQRMVDSV..FKNYDHDQ-DG.YISQ........E
hFl_ENSPANP00000019993 -------....----------------------.........------VL..FDQFDPGN-TG.YIST........G
hFl_ENSPANP00000000366 -------....----------------------.........--------..FNMFDTDG-NE.MVDK........K
hFl_ENSPANP00000018199 KLVESVF....RNYDHDHDGYISQEDFESIAAN.........F--PFLDS..FCVLDKDQ-DG.LISK........D
hFl_ENSPANP00000020672 -------....----------------------.........-----ANL..FEDMDRNK-DG.EVPP........E
hFl_ENSPANP00000008729 KLVESVF....RNYDHDHDGYISQEDFESIAAN.........F--PFLDS..FCVLDKDQ-DG.LISK........D
hFl_ENSPANP00000006250 -------....----------------------.........-------M..LKLFDSNN-DG.KLEL........T
hFl_ENSPANP00000011328 -------....----------------------.........-----HVA..FKMLDTDG-NE.MIEK........R
hFl_ENSPANP00000012268 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000018718 -------....----------------------.........-------L..FEEIDKDG-NG.EVLL........E
hFl_ENSPANP00000010889 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000020671 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000011848 -------....----------------------.........------IL..FEDLDRNG-DG.VVDI........T
hFl_ENSPANP00000020673 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000006193 -------....----------------------.........--------..--RADKND-DG.KLSF........E
hFl_ENSPANP00000015860 -------....----------------------.........-------K..YMEFDLNG-NG.DIDI........M
hFl_ENSPANP00000003135 -------....----------------------.........------KY..FKNFD-NG-DS.RLDS........S
hFl_ENSPANP00000008557 -------....----------------------.........-----QEL..FLLCDKEA-KG.FITR........H
hFl_ENSPANP00000014970 -------....----------------------.........-------M..LKLFDSNN-DG.KLEL........T
hFl_ENSPANP00000009124 -------....----------------------.........AIETLIKN..FHQYSVEGGKE.TLTP........S
hFl_ENSPANP00000003056 -------....----------------------.........-------T..FKQIDTDN-DR.QLSK........A
hFl_ENSPANP00000013460 -------....----------------------.........----LRAV..FDALDGDG-DG.FVRI........E
hFl_ENSPANP00000016675 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000016846 -------....----------------------.........--------..----DINS-TG.ALGM........D
hFl_ENSPANP00000011328 -------....----------------------.........----FHVA..FKMLDTDG-NE.MIEK........R
hFl_ENSPANP00000004053 -------....------S---------------.........--------..-----------.----........-
hFl_ENSPANP00000017871 KNTVDDI....SESLRQGGGKLNFDELRQDLKGkgh......TDAEIEAI..FTKYDQDG-DQ.ELTE........H
hFl_ENSPANP00000004677 KNTVDDI....SESLRQGGGKLNFDELRQDLKGkgh......TDAEIEAI..FTKYDQDG-DQ.ELTE........H
hFl_ENSPANP00000018325 -------....----------------------.........REQVLLYL..FALHDYDQ-SG.QLDG........L
hFl_ENSPANP00000016823 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000016006 -------....-----------TSEEF------.........-----NAI..FTFYDKDG-SG.YIDE........H
hFl_ENSPANP00000018508 -------....----------------------.........--------..-S---------.----........-
hFl_ENSPANP00000018829 -------....----------------------.........--------..-MEFDLNN---.----........-
hFl_ENSPANP00000016824 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000010241 -------....Q---------------------.........--------..-----------.----........-
hFl_ENSPANP00000002202 -------....----------------------.........--------..--DIDKNG-DG.FVDQ........D
hFl_ENSPANP00000020427 -------....----------------------.........-EEKAKYI..FSLFSSES-GN.YVIR........E
hFl_ENSPANP00000020450 -------....----------------------.........---TLGQI..WALANRTT-PG.KLTK........E
hFl_ENSPANP00000019970 -------....----------------------.........----LREV..FEVCGRDP-DG.FLRV........E
hFl_ENSPANP00000017056 -------....----------------------.........--AFLREA..FSVLDRG--DG.TISK........N
hFl_ENSPANP00000012483 -------....----------------------.........----IWYA..FTALDVEK-SG.KVSK........S
hFl_ENSPANP00000017055 -------....----------------------.........--AFLREA..FSVLDRG--DG.TISK........N
hFl_ENSPANP00000009566 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000013482 -------....----------------------.........-------A..FTKIDKSK-TN.YI--........-
hFl_ENSPANP00000007665 -------....----------------------.........----IRKI..YSTLAGNRKDV.EVTK........E
hFl_ENSPANP00000018367 -------....----------------------.........----IRKI..YSTLAGNRKDV.EVTK........E
hFl_ENSPANP00000012679 -------....----------------------.........-----EWT..FTLYDFDN-NG.KVTR........E
hFl_ENSPANP00000012680 -------....----------------------.........-----EWT..FTLYDFDN-NG.KVTR........E
hFl_ENSPANP00000008763 -------....----------------------.........---AIWHA..FTALDQDH-SG.KVSK........S
hFl_ENSPANP00000019937 -------....----------------------.........---QARRV..FQTYDPED-NG.FIPD........S
hFl_ENSPANP00000012527 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000008287 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000004139 -------....----------------------.........-----EWT..FTLYDFDN-CG.KVTR........E
hFl_ENSPANP00000004290 -------....----------------------.........-----EWT..FTLYDFDN-CG.KVTR........E
hFl_ENSPANP00000020336 -------....-----------------AKVEL.........SDHVCDVV..FALFDCDG-NG.ELSN........K
hFl_ENSPANP00000003145 -------....----------------------.........------SL..FRDLDADG-NG.HLSS........S
hFl_ENSPANP00000017380 RPYAEQY....RIDARQFAHLFQLVSPWTCGAH.........TEILAERT..FRLLDDNM-DQ.LIE-........-
hFl_ENSPANP00000019527 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000016200 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000013484 ------V....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000019122 -------....----------------------.........QEEQAARQ..FAALDPEH---.----........-
hFl_ENSPANP00000011328 -------....--------------------EL.........SNNILDTV..FKIFDLDG-DE.CLSH........E
hFl_ENSPANP00000005617 --F----....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000011677 -------....----------------------.........--------..----------N.VISV........A
hFl_ENSPANP00000002004 -------....----------------------.........---KILEI..FHKVGQGE-NQ.RITR........E
hFl_ENSPANP00000005046 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000020438 -------....----------------------.........-----LMA..FVYFDQSH-CG.YLLE........K
hFl_ENSPANP00000020442 -------....----------------------.........-----LMA..FVYFDQSH-CG.YLLE........K
hFl_ENSPANP00000016734 F------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000008645 -------....----------------------.........------DL..FHKAGQDV-DG.KLTY........Q
hFl_ENSPANP00000003048 -------....----------------------.........-----LLA..FVFFDANW-CG.YLHR........R
hFl_ENSPANP00000001629 -------....----------------------.........--------..-----------.----........-
hFl_ENSPANP00000007857 -------....----------------------.........-------A..FQELDDDM-DG.TVSV........T
hFl_ENSPANP00000012179 -------....----------------------.........----IVAM..FEMMDSSG-RG.TI--........-
hFl_ENSPANP00000020858 -------....---------EIQFEDFTNTLREmghaeh...EITELTAT..FTKFDRDG-NR.ILDE........K


                       00                                           110            120           130
                        |                                             |              |             |
d1sraa_                ELA....PL.RAPL...............................IPMEHC.T.TRF...FETC..D.LDND.KYIA
hFl_ENSPANP00000005664 EML....EI.VQAIykmvssvmkmpede.................STPEKR.T.EKI...FRQM..D.TNRD.GKLS
hFl_ENSPANP00000015843 EML....EI.VQAIykmvssvmkmpede.................STPEKR.T.EKI...FRQM..D.TNND.GKLS
hFl_ENSPANP00000018838 EML....DI.VDAIyqmvgntvelpeee.................NTPEKR.V.DRI...FAMM..D.KNAD.GKLT
hFl_ENSPANP00000000687 EFK....YL.WNN-...............................--IKR-.W.QAI...YKQF..D.TDRS.GTIC
hFl_ENSPANP00000011132 ELF....QV.LKMMvgnnlkd........................TQLQQI.V.DKT...IINA..D.KDGD.GRIS
hFl_ENSPANP00000011888 ELR....HV.MTNLgek............................LTDEE-.V.DEM...IREA..D.IDGD.GQVN
hFl_ENSPANP00000012946 EML....EI.VQAIykmvssvmkmpede.................STPEKR.T.DKI...FRQM..D.TNND.GKLS
hFl_ENSPANP00000015640 ELR....HV.MTNLgek............................LTDEE-.V.DEM...IREA..D.IDGD.GQVN
hFl_ENSPANP00000008517 ELR....HV.MTRLgek............................LSDEE-.V.DEM...IRAA..D.TDGD.GQVN
hFl_ENSPANP00000017051 ---....--.----...............................------.I.EDL...FKKI..N.GDKT.DYLT
hFl_ENSPANP00000008208 EML....EI.IEAIykmvgtvimmkmnedg...............LTPEQR.V.DKI...FSKM..D.KNKD.DQIT
hFl_ENSPANP00000000685 ---....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000001217 ELA....PL.RAPL...............................IPMEHC.T.TRF...FETC..D.LDND.KYIA
hFl_ENSPANP00000009011 EML....EI.IEAIykmvgtvimmrmnqdgl..............TPQQR-.V.DKI...FKKM..D.QDKD.DQIT
hFl_ENSPANP00000016439 EFH....HL.WNKV...............................---KA-.W.QKI...FKHY..D.TDQS.GTIN
hFl_ENSPANP00000020904 EML....DI.MKSIydmmgkytypalree................APREH-.V.ENF...FQKM..D.RNKD.GVVT
hFl_ENSPANP00000011992 ELA....PL.RASL...............................VPMEHC.I.TRF...FEEC..D.PNKD.KHIT
hFl_ENSPANP00000011142 ---....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000008176 ---....-I.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000016326 ---....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000005573 ELKv...AM.RALGfe.............................PRKEE-.M.KKM...ISEV..D.KEGT.GKIS
hFl_ENSPANP00000018511 EML....DI.MKAIydmmgkctypvlked................APRQH-.V.ETF...FQKM..D.KNKD.GVVT
hFl_ENSPANP00000007984 EFV....EF.YKAL...............................TKRAE-.V.QEL...FESF..S.ADG-.QKLT
hFl_ENSPANP00000009334 ELK....QA.MAGLgqp............................LPQEE-.L.DAM...IREA..D.VDQD.GRVN
hFl_ENSPANP00000011977 ---....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000006880 ---....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000016389 ELL....QV.LRMMvgvnisd........................EQLGSI.A.DRT...IQEA..D.QDGD.SAIS
hFl_ENSPANP00000017625 ELA....EI.FRASgeh............................VTDEE-.I.ESL...MKDG..D.KNND.GRID
hFl_ENSPANP00000020753 NLK....RV.AKELgen............................LTDEE-.L.QEM...IDEA..D.RDGD.GEVS
hFl_ENSPANP00000011482 EML....AI.MKSIydmmgrhtypilred................TPAEH-.V.ERF...FQKM..D.RNQD.GVVT
hFl_ENSPANP00000008596 E--....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000014722 EMM....DI.VKAIydmmgkytypvlke.................DTPRQH.V.DVF...FQKM..D.KNKD.GIVT
hFl_ENSPANP00000010579 EMRm...AI.ESAGfklnkklyeliitrysepdlavdfdnfvcclVRLET-.M.FRF...FKTL..D.TDLD.GVVT
hFl_ENSPANP00000018638 EFK....EL.WAVL...............................NGWRQ-.-.--H...FISF..D.TDRS.GTVD
hFl_ENSPANP00000007213 ---....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000001594 ---....--.----...............................-----C.-.---...----..-.----.----
hFl_ENSPANP00000002108 ELQ....NF.LKELniq............................VDDSY-.A.RKI...FREC..D.RSQT.DSLE
hFl_ENSPANP00000007118 EIH....QL.MHKLnvn............................LPRRK-.V.RQM...FQEA..D.TDENqGTLT
hFl_ENSPANP00000006887 EFY....IL.WTKI...............................QKYQK-.-.--I...YREI..D.VDRS.GTMN
hFl_ENSPANP00000020829 EIE....EF.LRRL...............................LKRPE-.L.EEI...FHQY..-.SGED.RVLS
hFl_ENSPANP00000004533 ELK....MM.LQATget............................ITEDD-.I.EEL...MKDG..D.KNND.GRID
hFl_ENSPANP00000005357 ---....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000014595 ---....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000019694 EVL....EI.VMAIfkmitpedvkllpeden..............T-PEKR.A.EKI...WKYF..G.KRDD.DKLT
hFl_ENSPANP00000012647 ELL....TI.IQAIrainpcsdta.....................MTAEEF.T.DTV...FSKI..D.VNGD.GELS
hFl_ENSPANP00000011841 ELRt...AL.KAA-...............................------.-.---...----..-.----.----
hFl_ENSPANP00000007138 NLR....RV.ARELgen............................MSDEE-.L.RAM...IEEF..D.KDGD.GEIN
hFl_ENSPANP00000005603 TLK....YV.LMNAgeplne.........................VE----.A.EQM...MKEA..D.KDGD.GTID
hFl_ENSPANP00000003537 -LG....HI.--TL...............................CNAVQC.I.RN-...----..-.----.----
hFl_ENSPANP00000016730 DLH....DM.LASL...............................GKN---.-.---...----..-.----.----
hFl_ENSPANP00000004388 ---....--.----...............................------.V.KRI...FKDN..D.RLKQ.GRIT
hFl_ENSPANP00000004958 DLH....DM.LASL...............................GKN---.-.---...----..-.----.----
hFl_ENSPANP00000017808 EFK....EL.WAAL...............................NAWKQ-.-.--N...FMTV..D.QDGS.GTVE
hFl_ENSPANP00000006158 ---....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000000685 ---....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000001746 ELRe...AM.RKLLghq............................VGHRD-.I.EEI...IRDV..D.LNGD.GRVD
hFl_ENSPANP00000005266 ELRa...AL.KALLger............................LSQRE-.V.EEI...LQDV..D.LNGD.GLVD
hFl_ENSPANP00000011699 ELRe...AV.PALLgepl...........................AGPE--.L.DEM...LREV..D.LNGD.GTVD
hFl_ENSPANP00000001618 EIVq...SL.QTLGlt.............................ISEQQ-.A.ELI...LQSI..D.ADGT.MTVD
hFl_ENSPANP00000010432 ---....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000019362 EIMq...SL.RDLGvk.............................ISEQQ-.A.EKI...LKSM..D.KNGT.MTID
hFl_ENSPANP00000005159 ELQq...AM.QRLLger............................LTPRE-.I.SEV...VREA..D.VNGD.GTVD
hFl_ENSPANP00000011834 ---....--.----...............................------.-.---...---F..D.KEGD.GKVM
hFl_ENSPANP00000004357 ---....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000010858 ---....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000010399 ---....--.----...............................------.-.---...---I..-.----.----
hFl_ENSPANP00000004118 ---....--.----...............................------.-.---...-STI..D.LTCN.DYIS
hFl_ENSPANP00000010678 ---....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000008201 ---....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000000555 ---....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000014173 ---....-L.TSLGek.............................LTHKE-.V.DDL...FREA..G.IEPN.GKVK
hFl_ENSPANP00000002207 ---....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000001879 ---....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000005388 ELR....SI.--YL...............................DKNEQC.T.KAF...FNSC..D.TYKD.SLIS
hFl_ENSPANP00000002662 ---....--.----...............................------.-.---...-STI..D.LTCN.DYIS
hFl_ENSPANP00000009999 EFMk...GL.NDYAvv.............................MEREE-.V.EEL...FRRF..D.KDGN.GTID
hFl_ENSPANP00000004626 DLK....DT.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000006233 DLRd...TF.AALGrvn............................VKNEE-.I.DEM...IKE-..-.----.----
hFl_ENSPANP00000002660 ELL....DM.FVVSeavkaqqt.......................LSPEEF.T.NLV...FRKI..D.INND.GELT
hFl_ENSPANP00000011209 EIN....AI.--YL...............................DKYEPC.I.KPL...FNSC..D.SFKD.GKLS
hFl_ENSPANP00000020345 ELA....AI.--NL...............................DKYEVC.I.RPF...FNSC..D.TYKD.GRVS
hFl_ENSPANP00000020343 ELA....AI.--NL...............................DKYEVC.I.RPF...FNSC..D.TYKD.GRVS
hFl_ENSPANP00000008924 EWIh...GL.SLFLrgsle..........................EK----.M.KYC...FEVF..D.LNGD.GFIS
hFl_ENSPANP00000015530 DLRd...TF.AALGrin............................VKNEE-.L.EA-...----..-.----.----
hFl_ENSPANP00000008596 ---....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000002265 ELR....HV.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000014191 DLRd...TF.AAMGrln............................VKNEE-.L.DAM...MK--..-.----.----
hFl_ENSPANP00000012413 EML....QV.LRLMvgvqvte........................EQLENI.A.DRT...VQEA..D.EDGD.GAVS
hFl_ENSPANP00000007079 EFK....QL.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000012088 EIQq...SF.RALGis.............................ITLEQ-.A.EKI...LHSM..D.RDGT.MTID
hFl_ENSPANP00000020865 ELR....H-.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000003943 ELKq...AL.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000005422 EIK....PF.KRFLrkk............................SKPKKC.V.KKF...VEYC..D.VNND.KSIS
hFl_ENSPANP00000015281 DLR....GV.YSGRahpkvrsge......................WTEDEV.L.RRF...LDNF..DsSEKD.GQVT
hFl_ENSPANP00000017172 EMK....PF.KRYVkkk............................AKPKKC.A.RRF...TDYC..D.LNKD.KVIS
hFl_ENSPANP00000014458 DLS....RL.VNCLtgegedtrlsa....................SEMKQL.I.DNI...LEES..D.IDRD.GTIN
hFl_ENSPANP00000008201 ---....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000004357 ---....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000004505 ELAw...AF.EAAG...............................------.-.---...----..-.----.----
hFl_ENSPANP00000012751 EYVi...GL.AVLCnp.............................ANTEEI.I.QVA...FKLF..D.VDED.GYIT
hFl_ENSPANP00000001879 ---....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000001065 DLEq...TV.TKLTrgelsa.........................EEVSLV.C.EKV...LDEA..D.GDHD.GRLS
hFl_ENSPANP00000009095 EIQq...SF.RALGis.............................ITLEQ-.A.EKI...LHSM..D.RDGT.MTID
hFl_ENSPANP00000013050 EFIl...A-.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000013054 EFIl...A-.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000014002 EFL....DI.LVVFmkg............................SPEEK-.S.RLM...FRMY..D.FDGN.GLIS
hFl_ENSPANP00000008287 ---....--.----...............................------.-.---...WELS..D.ADCD.GALT
hFl_ENSPANP00000016675 ---....--.----...............................------.-.---...WELS..D.FDKD.GALT
hFl_ENSPANP00000013999 EFL....DI.LVVFmkg............................SPEDK-.S.RLM...FTMY..D.LDEN.GFLS
hFl_ENSPANP00000003565 ELA....AF.TKNQ...............................KDPGV-.L.DRM...MKRL..D.TNSD.GQLD
hFl_ENSPANP00000018211 DLQ....RI.ILRLlnsddmsed......................LLMDL-.T.NHV...LSES..D.LDDD.NMLS
hFl_ENSPANP00000010407 ---....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000016650 EFT....AF.LHPEeydy...........................MKDIV-.V.QET...MEDI..D.KNAD.GFID
hFl_ENSPANP00000001581 ELA....AF.TKNQ...............................KDPGV-.L.DRI...MKRL..D.TNSD.GQLD
hFl_ENSPANP00000016006 ELE....NF.FQELekarkgsgmmsksd.................NFGEK-.M.KEF...MQKY..D.KNSD.GKIE
hFl_ENSPANP00000015459 EFC....AF.YKMM...............................------.-.---...----..-.----.----
hFl_ENSPANP00000014312 DLEl...TL.ARLTkselde.........................EEVVLV.C.DKV...IEEA..D.LDGD.GKLG
hFl_ENSPANP00000010990 EFIl...AM.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000002202 ELKt...WI.KRVQkryi...........................FDN---.V.AKV...WKDY..D.RDKD.DKIS
hFl_ENSPANP00000007279 ELKt...WI.KRVQkryi...........................FDN---.V.AKV...WKDY..D.RDKD.DKIS
hFl_ENSPANP00000011150 DFKk...AF.RQVApk.............................L-PERT.V.LEV...FREV..D.RDSD.GHVS
hFl_ENSPANP00000008402 EFR....AM.WKLFsahynvl........................IDDSQ-.V.NKL...ANIM..D.LNKD.GSID
hFl_ENSPANP00000018674 EFR....DL.W---...............................------.-.---...----..-.----.----
hFl_ENSPANP00000002971 EVR....EI.--FLktg............................LPSTL-.L.AHI...WSLC..D.TKDC.GKLS
hFl_ENSPANP00000002116 ---....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000014197 EFK....SA.--LH...............................VKESFF.A.ERF...FALF..D.SDRS.GTIT
hFl_ENSPANP00000012648 ELL....NI.VEGIyqlkkacrrelqteqgql.............LTPEEV.V.DRI...FLLV..D.ENGD.GQLS
hFl_ENSPANP00000020427 EISc...GL.SACCrgpla..........................ERQKFC.-.---...FKVF..D.VDRD.GVLS
hFl_ENSPANP00000013098 ELGt...AM.RSLGy..............................MPNEVE.L.EVI...IQRL..D.MDGD.GQVD
hFl_ENSPANP00000010107 ELT....AF.LHPEefp............................HMRDIV.I.AET...LEDL..D.RNKD.GYVQ
hFl_ENSPANP00000010990 EFSi...AM.K---...............................------.-.---...----..-.----.----
hFl_ENSPANP00000001415 EFAv...AM.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000013054 EFSi...AM.K---...............................------.-.---...----..-.----.----
hFl_ENSPANP00000009206 ELE....YF.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000001415 EVK....EI.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000004159 EYR....NV.VEEL...............................------.-.---...----..-.----.----
hFl_ENSPANP00000013482 ---....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000018262 ELK....EL.LQTElsgfldaq.......................KDVDA-.V.DKV...MKEL..D.ENGD.GEVD
hFl_ENSPANP00000005398 ELRl...AL.NAAG...............................------.-.---...----..-.----.----
hFl_ENSPANP00000014303 ELL....PW.VVPNnqg............................IAQEE-.A.LHL...IDEM..D.LNGD.KKLS
hFl_ENSPANP00000012662 ELK....EL.INNElshflee........................IKEQEV.V.DKV...METL..D.SDGD.GECD
hFl_ENSPANP00000005019 EFR....QT.WKLLsshmni.........................DITDDC.I.CDL...ARSI..D.FNKD.GHID
hFl_ENSPANP00000014970 ELK....NF.LKDLlekanktvdd.....................TKLAEY.T.DLM...LKLF..D.SNND.GKLE
hFl_ENSPANP00000006250 ELK....NF.LKDLlekanktvdd.....................TKLAEY.T.DLM...LKLF..D.SNND.GKLE
hFl_ENSPANP00000011359 ELK....EL.LTRElpsflgk........................RTDEAA.F.QKL...MSNL..D.SNRD.NEVD
hFl_ENSPANP00000013050 EFSi...AM.K---...............................------.-.---...----..-.----.----
hFl_ENSPANP00000013482 ELR....RV.LETFclk............................LRDEE-.Y.EKF...SKHY..N.IHND.TAVD
hFl_ENSPANP00000018878 EFK....SC.LRSLgydlpmveege....................PDPE--.F.EAI...LDTV..D.PNRD.GHVS
hFl_ENSPANP00000002756 DLR....VL.MEKEfpgflenq.......................KDPLA-.V.DKI...MKDL..D.QCRD.GKVG
hFl_ENSPANP00000018444 ELK....VL.MEKElpgflqs........................GKDKDA.V.DKL...LKDL..D.ANGD.AQVD
hFl_ENSPANP00000004247 ELGm...AM.RSLGy..............................MPSEVE.L.AII...MQRL..D.MDGD.GQVD
hFl_ENSPANP00000006245 EFK....QL.VEKDlqnflkke.......................KKNDKI.I.DHI...MEDL..D.TNAD.KQLS
hFl_ENSPANP00000016200 ELE....YF.YEEQcrrldsmaiea....................LPFQDC.L.CQM...LDLV..K.PRSE.GRIT
hFl_ENSPANP00000013482 DIKn...AL.--YGfdip...........................LTPRE-.F.EKL...WASY..D.TEGK.GHIT
hFl_ENSPANP00000003778 ELG....FI.LKGFspdard.........................LSAKE-.T.KTL...MAAG..D.KDGD.GKIG
hFl_ENSPANP00000017843 EFV....SL.--PVgtvenqqgqdiddnw................VKDRK-.-.KEF...EELI..D.SNHD.GIVT
hFl_ENSPANP00000013803 ELR....NF.LRDLflhhrkaise.....................AKLEEY.T.GTM...MKIF..D.RNKD.GRLD
hFl_ENSPANP00000008015 EFA....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000001644 DFKe...AL.KVFHle.............................VSEKD-.F.ESA...WLIL..D.DNGN.GKAD
hFl_ENSPANP00000007019 EMK....EL.LQKElpsfvgek.......................VDEEG-.L.KKL...MGNL..D.ENSD.QQVD
hFl_ENSPANP00000001901 EFA....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000000771 EFK....AC.LISLgydvend........................RQGEAE.F.NRI...MSLV..D.PNHS.GLVT
hFl_ENSPANP00000019402 EFL....SL.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000006208 EFA....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000003981 EFL....SL.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000018508 EFL....AF.ESVL...............................CAP---.-.---...----..-.----.----
hFl_ENSPANP00000009319 DFR....AC.--LIsmgyd..........................LGEAE-.F.ARI...MTLV..D.PNGQ.GTVT
hFl_ENSPANP00000002116 ---....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000012089 ELRr...EL.--PA...............................EQAEYC.I.RRM...----..-.----.----
hFl_ENSPANP00000016429 EFA....L-.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000006158 ELE....NI.ISQMmhvaeylewdv....................TELNPI.L.HEM...MEEI..D.YDHD.GTVS
hFl_ENSPANP00000001648 ELK....EL.LEKEfhpvlknp.......................DDPDT-.V.DVI...MHML..D.RDHD.RRLD
hFl_ENSPANP00000016703 ELK....FF.LQKFesgare.........................LTESE-.T.KSL...MAAA..D.NDGD.GKIG
hFl_ENSPANP00000013482 EFR....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000001714 ELI....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000001561 ECV....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000011759 EFA....RL.WKRL...............................VHCQH-.-.---...----..-.----.----
hFl_ENSPANP00000016734 ELS....RY.GTAT...............................MTNVF-.L.DRV...FQEC..-.----.----
hFl_ENSPANP00000009674 NFG....-M.YRFLfn.............................IHKQE-.L.KDL...FHDF..D.VTGD.NLLN
hFl_ENSPANP00000007884 ELK....EL.LQNElatwtp.........................TEFRECdY.NKF...MSVL..D.TNKD.CEVD
hFl_ENSPANP00000002971 EFFv...AL.R---...............................------.-.---...----..-.----.----
hFl_ENSPANP00000015462 ELG....FI.LKGFspdard.........................LSAKE-.T.KTL...MAAG..D.KDGD.GKIG
hFl_ENSPANP00000005656 EFI....SL.SA--...............................------.-.---...----..-.----.----
hFl_ENSPANP00000009541 ELQ....DL.FKEAslplpg.........................YKVREI.V.EKI...ISVA..D.SNKD.GKIS
hFl_ENSPANP00000008758 ELRl...AL.NAAG...............................------.-.---...----..-.----.----
hFl_ENSPANP00000003523 ELKl...L-.IQAEfpsll..........................KGPNT-.L.DDL...FQEL..D.KNGD.GEVS
hFl_ENSPANP00000018367 ---....--.----...............................------.-.---...---V..D.QTKD.GLIS
hFl_ENSPANP00000007665 ---....--.----...............................------.-.---...---V..D.QTKD.GLIS
hFl_ENSPANP00000011360 EYL....LL.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000005386 ELRe...AC.DQANls.............................LDDKL-.L.DQL...FDYC..D.VDND.GFIN
hFl_ENSPANP00000009203 ELK....EL.IQKEltigsk.........................LQDAE-.I.ARL...MEDL..D.RNKD.QEVN
hFl_ENSPANP00000003466 ELKe...LI.KKELclge...........................MKDNS-.I.DDL...MKSL..D.KNSD.QEID
hFl_ENSPANP00000017137 EFK....AC.L---...............................------.-.---...----..-.----.----
hFl_ENSPANP00000013482 EFR....HI.LNCVavk............................LSDSE-.F.KEL...MQTL..D.PGNT.G---
hFl_ENSPANP00000002234 DLY....KF.LTKRgek............................MTREE-.V.NAI...INLT..D.VNAD.GKFD
hFl_ENSPANP00000003564 EFK....EL.VTQQlphll..........................KDVGS-.L.DEK...MKSL..D.VNQD.SELK
hFl_ENSPANP00000010846 ELK....LM.MEKLga.............................PQTHLG.L.KNM...IKEV..D.EDFD.SKLS
hFl_ENSPANP00000017187 ELAv...VC.QSVGlre............................LEKEE-.L.EDL...FNKL..D.QDRD.GKVS
hFl_ENSPANP00000008343 ELE....ALfTKELekvydpkneeddmvemee.............ERLRM-.R.EHV...MNEV..D.TNKD.RLVT
hFl_ENSPANP00000002482 ---....--.---Efgavlrrp.......................HDPKT-.V.DLI...LELL..D.RDRN.GRVD
hFl_ENSPANP00000010432 EMD....CI.VNQMlhiaqylewdp....................TELRPI.L.KEM...LQGM..D.YDRD.GFVS
hFl_ENSPANP00000017137 ELRr...EL.--PP...............................DQAEYC.I.ARM...AP--..-.----.----
hFl_ENSPANP00000005713 ELK....LM.MEKLga.............................PQTHLG.L.KSM...IKEV..D.EDFD.GKLS
hFl_ENSPANP00000002260 ELN....DL.FKAAclplpg.........................YRVREI.T.ENL...MATG..D.LDQD.GRIS
hFl_ENSPANP00000007108 ELN....HM.---Lsd.............................TGNRKA.A.DKL...IQNL..D.ANHD.GRIS
hFl_ENSPANP00000010072 ELE....ALfTKELekvydpkneeddmremee.............ERLRM-.R.EHV...MKNV..D.TNQD.RLVT
hFl_ENSPANP00000002141 ---....--.---Efadvivkp.......................HDPAT-.V.DEV...LRLL..D.EDHT.GTVE
hFl_ENSPANP00000010969 EFL....QL.MSA-...............................------.-.---...----..-.----.----
hFl_ENSPANP00000016650 ELKdwi.KF.AQKR...............................WIYED-.V.ERQ...WKGH..D.LNED.GLVS
hFl_ENSPANP00000017922 EFL....QL.MSA-...............................------.-.---...----..-.----.----
hFl_ENSPANP00000011099 EYL....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000005052 ---....--.----...............................------.-.---...----..-.--GD.SKIT
hFl_ENSPANP00000001415 ---....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000011769 ELH....EL.FKEAnmplpg.........................YKVREI.I.QKL...MLDG..D.RNKD.GKIS
hFl_ENSPANP00000009206 EIR....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000001646 ---....--.----...............................------.I.NKI...FQGL..D.ANQD.EQVD
hFl_ENSPANP00000020875 ---....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000000260 ELH....EL.FKEAnmplpg.........................YKVREI.I.QKL...MLDG..D.RNKD.GKIS
hFl_ENSPANP00000020875 ---....--.----...............................------.-.--V...IKAI..D.KIKD.KNVD
hFl_ENSPANP00000005819 EFId...GI.LASKfpt............................TKLE--.M.TAV...ADIF..D.RDGD.GYID
hFl_ENSPANP00000013481 ELN....AF.QKSC...............................------.-.---...----..-.----.----
hFl_ENSPANP00000016713 EFId...GI.LSSKfpt............................SRLE--.M.SAV...ADIF..D.RDGD.GYID
hFl_ENSPANP00000003270 EFL....SC.LRGLnyylpmvee......................DEHEPE.F.KKF...LDAV..D.PGRK.GYVS
hFl_ENSPANP00000020875 ---....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000019992 ELN....FF.QRIC...............................------.-.---...----..-.----.----
hFl_ENSPANP00000020877 ---....--.----...............................------.-.---...-KCA..D.IDRD.GKVN
hFl_ENSPANP00000017252 ELSt...AI.THVHkeegseqaplmse..................DELINI.I.DGV...LRDD..D.KNND.GYID
hFl_ENSPANP00000012991 MFF....KI.C---...............................------.-.---...----..-.----.----
hFl_ENSPANP00000016852 ELT....DL.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000000400 EFV....TI.VRHY...............................------.-.---...----..-.----.----
hFl_ENSPANP00000000366 EFI....GI.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000014303 ELS....SW.IQMSfkh............................YAMQE-.A.KQQ...FVEY..D.KNGD.DTVT
hFl_ENSPANP00000005825 ---....--.----...............................------.-.SRL...FQLL..D.ENGD.SLIN
hFl_ENSPANP00000007500 EFQ....II.RGNF...............................PYLSA-.-.---...FGDL..D.QNQD.GCIS
hFl_ENSPANP00000000752 EFQ....II.RGNF...............................PYLSA-.-.---...FGDL..D.QNQD.GCIS
hFl_ENSPANP00000008665 DMQ....RL.HKELp..............................LSLED-.L.EDV...FDAL..D.ADGN.GYLT
hFl_ENSPANP00000019328 EFG....SL.CAELr..............................VRPAD-.A.EAV...FQRL..D.ADHD.GAIT
hFl_ENSPANP00000020336 EFV....SI.M---...............................------.-.---...----..-.----.----
hFl_ENSPANP00000002971 EFAv...AM.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000020875 ---....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000015375 EVL....AQ.TRLGngww...........................MTPES-.I.QEM...YTAIkaD.PDGD.GVLS
hFl_ENSPANP00000013482 ---....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000001076 EFS....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000017843 EMQr...WI.MEKTaehfq..........................EAMEE-.S.KTH...FRAV..D.PDGD.GHVS
hFl_ENSPANP00000006270 ---....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000002752 EVKa...YL.KKEFekhgavvne......................SHHDAL.V.EDI...FDKE..D.EDKD.GFIS
hFl_ENSPANP00000010107 ELR....AW.IAHTqq.............................RHIRDS.V.SAA...WDTY..D.TDRD.GRVG
hFl_ENSPANP00000007279 EYIa...DM.FSHEengpepdw.......................VLSE--.R.EQF...NEFR..D.LNKD.GKLD
hFl_ENSPANP00000018263 ---....--.----...............................------.-.--N...SDLL..N.IDNN.GIIS
hFl_ENSPANP00000013803 EVD....GF.VKDMmelvqpsisg.....................VDLDKF.R.EIL...LRHC..D.VNKD.GKIQ
hFl_ENSPANP00000011977 EVD....KI.I--Lqmmrvaeyldwdv..................SELRPI.L.QEM...MKEI..D.YDGS.GSVS
hFl_ENSPANP00000006880 EVD....KI.I--Lqmmrvaeyldwdv..................SELRPI.L.QEM...MKEI..D.YDGS.GSVS
hFl_ENSPANP00000008114 EFV....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000009030 EFQ....LF.FADGv..............................LSEKE-.L.EDL...FHTI..D.SDNT.NHVD
hFl_ENSPANP00000016306 EFE....KI.-AAS...............................FPFSFC.V.---...---M..D.KDRE.GLIS
hFl_ENSPANP00000019993 KFR....SL.LESHssk............................LDPHK-.R.EVL...LALA..D.SHAD.GQIC
hFl_ENSPANP00000000366 EFL....VL.QEIFr..............................KK----.-.---...----..-.----.----
hFl_ENSPANP00000018199 EMM....A-.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000020672 EFS....TF.IKAQvsegkgrlmpg....................QDPEKT.I.GDM...FQNQ..D.RNQD.GKIT
hFl_ENSPANP00000008729 EMM....A-.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000006250 EMA....RL.LPVQenfllkf........................QGIKMC.G.KEFnkaFELY..D.QDGN.GYID
hFl_ENSPANP00000011328 EFF....KL.QKII...............................SK----.-.---...----..-.----.----
hFl_ENSPANP00000012268 ---....--.----...............................------.-.-DA...LMSA..D.VNGD.GHVD
hFl_ENSPANP00000018718 EFSe...YI.HAQVasgkgklapg.....................FDAELV.V.KNM...FTNQ..D.RNGD.GKVT
hFl_ENSPANP00000010889 ---....--.----...............................------.I.TEL...FQAA..D.KNKD.NQIC
hFl_ENSPANP00000020671 ---....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000011848 ELQe...GL.RN--...............................------.-.--W...----..-.----.----
hFl_ENSPANP00000020673 ---....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000006193 EFKa...YF.ADGV...............................LSGEE-.L.HEL...FHTI..D.THNT.NNLD
hFl_ENSPANP00000015860 SLK....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000003135 EFL....KF.VEQNetainittypdqennk...............LLRGLC.V.DAL...IELS..D.ENAD.WKLS
hFl_ENSPANP00000008557 DLQ....GL.QSDLp..............................LTPEQ-.L.EAV...FESL..D.QAHT.GFLT
hFl_ENSPANP00000014970 EMArrllPV.QENFllkf...........................QGIKMC.G.KEFnkaFELY..D.QDGN.GYID
hFl_ENSPANP00000009124 ELR....DL.V---...............................------.-.---...----..-.----.----
hFl_ENSPANP00000003056 EINl...YL.QREFekdekprdk......................SYQDAV.L.EDI...FKKN..D.HDGD.GFIS
hFl_ENSPANP00000013460 DFV....QF.-ATV...............................YGAEQ-.V.KDL...TKYL..D.PSGL.GVIS
hFl_ENSPANP00000016675 ---....--.----...............................------.-.SDL...FSYC..D.IEST.KKV-
hFl_ENSPANP00000016846 AFIk...AM.KKVLss.............................VSNEM-.L.KEL...FLKV..D.SDCE.GFVT
hFl_ENSPANP00000011328 EFF....KL.QKII...............................SK----.-.---...----..-.----.----
hFl_ENSPANP00000004053 ---....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000017871 EHQ....Q-.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000004677 EHQ....Q-.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000018325 ELL....SM.LTAAlapgaansptt....................NPVILI.V.DKV...LETQ..D.LNGD.GLMT
hFl_ENSPANP00000016823 ---....--.----...............................------.-.-DV...FRRA..D.KNDD.GKLS
hFl_ENSPANP00000016006 ELD....AL.LKDL...............................------.-.---...----..-.----.----
hFl_ENSPANP00000018508 ---....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000018829 ---....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000016824 ---....--.----...............................------.-.-DV...FRRA..D.KNDD.GKLS
hFl_ENSPANP00000010241 ---....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000002202 EYIa...DM.FSHEengpepdw.......................VLSE--.R.EQF...NEFR..D.LNKD.GKLD
hFl_ENSPANP00000020427 EME....RM.LHVVdgkvp..........................DTLRKC.F.S--...----..-.----.----
hFl_ENSPANP00000020450 ELY....TV.LA--...............................------.-.---...----..-.----.----
hFl_ENSPANP00000019970 RVA....AL.GLRF...............................GQGEE-.V.EKL...VKYL..D.PNDL.GRIN
hFl_ENSPANP00000017056 DF-....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000012483 QLK....VL.SHNL...............................------.-.---...----..-.----.----
hFl_ENSPANP00000017055 DF-....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000009566 ---....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000013482 ---....--.----...............................------.-.---...----..-.----.---S
hFl_ENSPANP00000007665 E--....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000018367 E--....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000012679 DIT....SL.----...............................------.L.---...----..-.----.----
hFl_ENSPANP00000012680 DIT....SL.----...............................------.L.---...----..-.----.----
hFl_ENSPANP00000008763 QLK....VL.SHN-...............................------.-.---...----..-.----.----
hFl_ENSPANP00000019937 LLE....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000012527 ---....--.----...............................------.S.EMI...FDWV..D.VERK.GHLS
hFl_ENSPANP00000008287 ---....--.----...............................----QC.Y.SEL...FARC..-.----.----
hFl_ENSPANP00000004139 DMS....SL.M---...............................------.-.---...----..-.----.----
hFl_ENSPANP00000004290 DMS....SL.M---...............................------.-.---...----..-.----.----
hFl_ENSPANP00000020336 EFV....SI.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000003145 ELAqh..VL.KKQDld.............................EDLLGC.SpGDL...LRFD..D.YNSD.SSLT
hFl_ENSPANP00000017380 -FK....AF.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000019527 ---....EA.RGAG...............................CSSEQ-.F.EEA...FAQF..D.AEGD.GTVD
hFl_ENSPANP00000016200 ---....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000013484 ---....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000019122 ---....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000011328 EFL....G-.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000005617 ---....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000011677 ELIs...AM.KQVKh..............................I-PESK.L.TSL...AAAL..D.ENKD.GKVN
hFl_ENSPANP00000002004 EFIt...AV.KAVG...............................VPLK--.-.---...----..-.----.----
hFl_ENSPANP00000005046 ---....--.----...............................------.Y.GEL...FDKV..D.VAQD.GFIN
hFl_ENSPANP00000020438 ---....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000020442 ---....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000016734 ---....--.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000008645 EIW....TS.RGSA...............................MPEPE-.-.--S...LRAF..D.SDGD.GRYS
hFl_ENSPANP00000003048 DLE....RI.----...............................------.-.---...----..-.----.----
hFl_ENSPANP00000001629 ---....--.----...............................------.-.---...---L..-.----.----
hFl_ENSPANP00000007857 ELQ....TH.----...............................------.-.---...-PEL..D.TDGD.GVLS
hFl_ENSPANP00000012179 ---....--.----...............................------.-.---...----..-.----.---S
hFl_ENSPANP00000020858 EQE....QM.RQ--...............................------.-.---...----..-.----.----


                              140       150                                                         
                                |         |                                                         
d1sraa_                LDEWAGCFGIKQKDIDKDL--vi......................................................
hFl_ENSPANP00000005664 LEEFI----------------rg......................................................
hFl_ENSPANP00000015843 LEEFI----------------rg......................................................
hFl_ENSPANP00000018838 LQEF-----------------qe......................................................
hFl_ENSPANP00000000687 SSELPGAFEAAGFHLNE----hlynmiirrysdesgnmdfdnfisclvrldamfrafksldkdgtgqiqvniqewlq
hFl_ENSPANP00000011132 FEEFCA---------------v.......................................................
hFl_ENSPANP00000011888 YEEFV----------------qmmt....................................................
hFl_ENSPANP00000012946 LEEFIK---------------gaksdpsivrllqc..........................................
hFl_ENSPANP00000015640 YEEFV----------------qmmt....................................................
hFl_ENSPANP00000008517 YEEFVRVL-------------v.......................................................
hFl_ENSPANP00000017051 VDQLVSFL-------------nehqrdprlneilfpfydakramqiiemyepdedlkkkglissdgfcrylmsdena
hFl_ENSPANP00000008208 LDEFKE---------------aaksdpsivlllq...........................................
hFl_ENSPANP00000000685 ---------------------eqehnnlvnvplcvdmclnwllnvydtgrtgrirvlsfktgiislck.........
hFl_ENSPANP00000001217 LDEWAGCFGIKQKDIDKD---l.......................................................
hFl_ENSPANP00000009011 LEEFKE---------------aaksdpsivlllqc..........................................
hFl_ENSPANP00000016439 SYEMRNA--------------vndagfhlnnqlydiitmryadkhmnidfdsficcfvrlegmfrafhafdkdgdgi
hFl_ENSPANP00000020904 IEEFIESCQKDE---------nimrsmqlfdn.............................................
hFl_ENSPANP00000011992 LKEWGHCFGIKEEDIDENL--l.......................................................
hFl_ENSPANP00000011142 ---------------------nyeefkkaleelatkrfkgkskeeafdaicqlvagkepanvgvtkaktggavdrlt
hFl_ENSPANP00000008176 ---------------------ferflnklclrpdidkilleigakgkpyltleqlmdfinqkqrdprlnevlypplr
hFl_ENSPANP00000016326 ---------------------syhakakpymtkehltkfinqkqrdsrlnsllfpparpdqvqglidkyepsginvq
hFl_ENSPANP00000005573 FNDFLAVMTQ-----------kmsekdtkeeilkafrlfdddetgkisfknlkrvanelgenltdeelqemideadr
hFl_ENSPANP00000018511 IDEFIESCQKDE---------nimrsmqlf...............................................
hFl_ENSPANP00000007984 LLEFLDFLREEQKE-------rdctselalelidryepsdsgklrhvlsmdgflsylcskdgdifnpaclpiy....
hFl_ENSPANP00000009334 YEEFARML-------------tq......................................................
hFl_ENSPANP00000011977 ---------------------nvprhlslalfqsfktdhclneanvtkdvvclndvscyfslleggrpedkleft..
hFl_ENSPANP00000006880 ---------------------nvprhlslalfqsfktdhclneanvtkdvvclndvscyfslleggrpedkleft..
hFl_ENSPANP00000016389 FTEFV----------------kv......................................................
hFl_ENSPANP00000017625 FDEFLK---------------mm......................................................
hFl_ENSPANP00000020753 EQEFLR---------------imkk....................................................
hFl_ENSPANP00000011482 IEEFL----------------etcqkv..................................................
hFl_ENSPANP00000008596 ---------------------vihcltalyerleeergilvnvplcvdmslnwllnvfdsgrsgkmralsfktgiac
hFl_ENSPANP00000014722 LDEFLE---------------scqeddnimrslqlfq........................................
hFl_ENSPANP00000010579 F--------------------dlfkwlqltm..............................................
hFl_ENSPANP00000018638 PQELQKALTTM----------gfrlspqavnsiakrystngkitfddyiaccvklraltdsfrrrdtaqqgvvnfpy
hFl_ENSPANP00000007213 ---------------------elakkrfkdksseeavrevhrliegkapiisgvtkaissptvsrltdttkftgshk
hFl_ENSPANP00000001594 ---------------------lrpdidkilleigakgkpyltleqlmdfinqkqrdprlnevlypplrpsqarllie
hFl_ENSPANP00000002108 DEE------------------ieafykmltqrveidrtfaeasgsgetlsvdqlvtflqhqqreeaagpalalslie
hFl_ENSPANP00000007118 FEEFCVFYK------------mmslrrdlyllllsysdkkdhltveelaqflkveqkmnnvttdycldiikkfevse
hFl_ENSPANP00000006887 SYEMRKALE------------eagfkmpcqlhqvivarfaddeliidfdnfvrclvrletlfkifkqldpentgtie
hFl_ENSPANP00000020829 APELLEFLED-----------qgeegatlaraqqliqtyelnetakqhelmtldgfmmyllspegaaldtthtcv..
hFl_ENSPANP00000004533 YDEFLEF--------------mkg.....................................................
hFl_ENSPANP00000005357 ---------------------ygfsalwkfiqqwknlfqqydrdrsgsisytelqqalsqmgynlspqftqllvsry
hFl_ENSPANP00000014595 ---------------------tfqqfkeavkelgqkrfkgkspdevlesiyglmegkdpattgatkattvgavdrlt
hFl_ENSPANP00000019694 EKEF-----------------iegtlankeilrliqfe.......................................
hFl_ENSPANP00000012647 LEEFIEGVQKD----------qmlldtlt................................................
hFl_ENSPANP00000011841 ---------------------gfqlsshllqlivlryadeelqmdfddflnclvrlenasrvfqalstknkefihlt
hFl_ENSPANP00000007138 QEEFI----------------aimt....................................................
hFl_ENSPANP00000005603 YEEFV----------------ammt....................................................
hFl_ENSPANP00000003537 ---------------------lnpglktskielkfkelhkskdkagtevtkeefievfhelctrpeiyfllvqfssn
hFl_ENSPANP00000016730 ---------------------ptdeylegmmseapgpinftmfltmfgeklngtdpedvirnafacfdeeasgfihe
hFl_ENSPANP00000004388 IEEFRA---------------iyrilthreeiveifnaysenrkillennlvqfltqeqytaemsktiafeiiqkye
hFl_ENSPANP00000004958 ---------------------ptdeyldammneapgpinftmfltmfgeklngtdpedvirnafacfdeeatgtiqe
hFl_ENSPANP00000017808 HHELRQAIGLMG---------yrlssqtittivkryskngriffddyvaccvklraltdffrkrdhlqqgsvnfmyd
hFl_ENSPANP00000006158 ---------------------qtidfegfklfmktfleaelpddftahlfmsfsnkfphsspmvkskpallsgglrm
hFl_ENSPANP00000000685 ------C--------------fqfannkpeieaalfldwmrlepqsmvwlpvlhrvaaaet................
hFl_ENSPANP00000001746 FEEFVR---------------mm......................................................
hFl_ENSPANP00000005266 FEEFVR---------------mm......................................................
hFl_ENSPANP00000011699 FDEFVM---------------mlsr....................................................
hFl_ENSPANP00000001618 WNEWRDYFLFNPVT-------dieeiirfwkhstgidigdsltipdefte...........................
hFl_ENSPANP00000010432 ---------------------dlpqplsthlflafsqkprqetsdhptegasnseanspdtniqnaenatkadeaca
hFl_ENSPANP00000019362 WNEWRDY--------------hllhpvenipeiilywkhstifdvgenltvpdeftv....................
hFl_ENSPANP00000005159 FE-------------------afv.....................................................
hFl_ENSPANP00000011834 GAELRHVLTTL----------gekmteeevetvlaghedsngcinyeaflkhil.......................
hFl_ENSPANP00000004357 ---------------------letvissiyyqlnkrlpsthqisveqsislllnfmiaaydsegrgkltvfsvkaml
hFl_ENSPANP00000010858 ---------------------trvteeefceafcelctrpevyfllvqisknkeyldandlmlfleaeqgvthited
hFl_ENSPANP00000010399 ---------------------dltcsghvsifefdvftrlfqpwptllknwqllav.....................
hFl_ENSPANP00000004118 VFEF-----------------diftrlfqpwssllrnwnslav..................................
hFl_ENSPANP00000010678 ---------------------tvaknkdqgtyedyveglrvfdkegngtvmgaeirhvlvtlgekmteeevemlvag
hFl_ENSPANP00000008201 ---------------------etvissiyyqlnkrlpsthqisveqsislllnfmiaaydsegrgkltvfsvkamla
hFl_ENSPANP00000000555 ---------------------tnaevlkvlgnpksdemnvkvldfehflpmlqtvaknkdqgtyedyveglrvfdke
hFl_ENSPANP00000014173 YDEF-----------------ihki....................................................
hFl_ENSPANP00000002207 ---------------------tnaevlkvlgnpksdemnvkvldfehflpmlqtvaknkdqgtyedyveglrvfdke
hFl_ENSPANP00000001879 ---------------------krmptthqihveqsislllnfllaafdpeghgkisvfavkmalatlcgg.......
hFl_ENSPANP00000005388 NNEWCYCFQRQQDPPCQT---e.......................................................
hFl_ENSPANP00000002662 VFEF-----------------diftrlfqpwgsilrnwnflav..................................
hFl_ENSPANP00000009999 FNEFLLTL-------------rppmsrarkevimqafrkldktgdgvitiedlrevynakhhpkyqngewseeqvfr
hFl_ENSPANP00000004626 ---------------------yaslgktnvkddeldamlkeasgpinftmflnmfgeklsgtdaeetilnafkmldp
hFl_ENSPANP00000006233 ---------------------apgpinftvfltmfgeklkgadpeetilnafkvfdpegkgvlkadyvrdmlttqae
hFl_ENSPANP00000002660 LEEFINGIAKDQD--------llei....................................................
hFl_ENSPANP00000011209 NNEWCYCFQKPGGLPCQN---e.......................................................
hFl_ENSPANP00000020345 TAEWCFCFWREKPPCLA----e.......................................................
hFl_ENSPANP00000020343 TAEWCFCFWREKPPCLA----e.......................................................
hFl_ENSPANP00000008924 KEEMFH---------------mlknsllkqpseedpdegikdlveitlkkmdhdhdgklsfadyelavreetlllea
hFl_ENSPANP00000015530 ---------------------mvkeapgpinftvfltmfgeklkgtdpeetilhafkvfdtegkgfvkadvikeklm
hFl_ENSPANP00000008596 ---------------------vepsvrscfrfstgkpvieasqflewvnlepqsmvwlavlhrvtiae.........
hFl_ENSPANP00000002265 ---------------------latlgerltedeveklmagqedsngcinyeafvkhim...................
hFl_ENSPANP00000014191 ---------------------easgpinftvfltmfgeklkgadpedvitgafkvldpegkgtikkkfleellttqc
hFl_ENSPANP00000012413 FVEFTKSLEKMDV--------eqk.....................................................
hFl_ENSPANP00000007079 ---------------------lltqadkfspaeveqmfaltpmdlagnidykslcyiithg................
hFl_ENSPANP00000012088 WQEWRDHFLLHS---------lenvedvlyfwkhs..........................................
hFl_ENSPANP00000020865 ---------------------vlatlgekmteaeveqllagqedangcinyeafvkhim..................
hFl_ENSPANP00000003943 ---------------------sgfgyrlsdqfhdilirkfdrqgrgqiafddfiqgcivlqrltdifrrydtdqdgw
hFl_ENSPANP00000005422 VQELMGCLGVAKEDGKA----d.......................................................
hFl_ENSPANP00000015281 LAEFQDY--------------ysgvsasmntdeefvammtsawq.................................
hFl_ENSPANP00000017172 LPELKGCLGVSKED-------........................................................
hFl_ENSPANP00000014458 LSEFQHVISRSP---------dfassfki................................................
hFl_ENSPANP00000008201 ---------------------vlklptavfegpsfgytehsvrtcfpqqrkimlnmfldtmmadpppqclvwlplmh
hFl_ENSPANP00000004357 ---------------------vlklptavfegpsfgytehsvrtcfpqqrkimlnmfldtmmadpppqclvwlplmh
hFl_ENSPANP00000004505 ---------------------fhlneqlqhnilhyldeggniefdnfisclirsdasfhalktlykddtrplqvniq
hFl_ENSPANP00000012751 EEEFSTILQA-----------slgvpdldvsglfkeiaqgdsisyeefksfalrhpeyakifttyldlqt.......
hFl_ENSPANP00000001879 ---------------------sarscfsqqkkvtlngfldtlmsdpppqclvwlpllhrlanven............
hFl_ENSPANP00000001065 LEDFRNMILRAPDF-------lrhstf..................................................
hFl_ENSPANP00000009095 WQEWRDHFLLHS---------lenvedvlyfwkhs..........................................
hFl_ENSPANP00000013050 ---------------------mhlidvamsgqplppvlppeyippsfr.............................
hFl_ENSPANP00000013054 ---------------------mhlidvamsgqplppvlppeyippsfr.............................
hFl_ENSPANP00000014002 KDEFIRML-------------rsfieisnnclskaqlaevvesmfresgfqdkeeltwedfhfmlrdhnselrftql
hFl_ENSPANP00000008287 LPEFCAAFHL-----------ivarkngyplpeglpptlqpey..................................
hFl_ENSPANP00000016675 LDEFCAAFHL-----------vvarkngydlpeklpeslmpkl..................................
hFl_ENSPANP00000013999 KDEFFT---------------mmrsfieisnnclskaqlaevvesmfresgfqdkeeltwedfhfmlrdhnselrft
hFl_ENSPANP00000003565 FSEFLNLIG------------glamachdsflkavps........................................
hFl_ENSPANP00000018211 FSEFEHAMAKSPDF-------mnsfrihfw...............................................
hFl_ENSPANP00000010407 ---------------------elyreapidkkgnfnyieftrilkh...............................
hFl_ENSPANP00000016650 LEEYIGDMYSHDGNTDEP---ewvktereqfvefrdknrdgkmdkeetkdwilpsdydhaeaearhlvyesdqnkdg
hFl_ENSPANP00000001581 FSEFLNLIG------------glamachdsflkavp.........................................
hFl_ENSPANP00000016006 MAELAQILPTEE---------nfllcfrqhvgssaefmeawrkydtdrsgyieanelkgflsdllkkanrpydepkl
hFl_ENSPANP00000015459 ---------------------strrdlyllmltysnhkdhldaaslqrflqveqkmtdvtlescqdiieqfepclen
hFl_ENSPANP00000014312 FADFEDMIAKA----------pdflstfhi...............................................
hFl_ENSPANP00000010990 ---------------------hltdmakagqplpltlppelvppsfr..............................
hFl_ENSPANP00000002202 WEEYK----------------qatygyylgnpaefhdssdhhtfkkmlprderrfkaadldgdltatreeftaflhp
hFl_ENSPANP00000007279 WEEYK----------------qatygyylgnpaefhdssdhhtfkkmlprderrfkaadldgdltatreeftaflhp
hFl_ENSPANP00000011150 FRDFEY---------------al......................................................
hFl_ENSPANP00000008402 FNEFLKAFYVV----------hryedl..................................................
hFl_ENSPANP00000018674 ---------------------kqlklyqkvfhkqdngsgylnweqlraamkeagivlsddvcqlmlvrygcprlqmg
hFl_ENSPANP00000002971 KDQFALAFHLI----------sqklikgidpphvltpemipp...................................
hFl_ENSPANP00000002116 ---------------------alcpvesatrscfqgvlspaikeekflswvqseppillwlptchrlsaae......
hFl_ENSPANP00000014197 LQELQEALAL-----------lihgspmdklkflfqvydidvcawqgasagtesgagagshaassplgtgsgsidpd
hFl_ENSPANP00000012648 LNEFVE---------------garrdkwvmkmlqmdm........................................
hFl_ENSPANP00000020427 RVELRD---------------mvvallevwkdnrtddipelhmdlsdivegilnahdttkmghltledyqiwsvknv
hFl_ENSPANP00000013098 FEEFVTLLG------------pklstsgipekfhgtdfdtvfwkcdmqkltvdelkrllydtfcehlsmkdieniim
hFl_ENSPANP00000010107 VEEYIADLYSAEP--------geeepawvqterqqfrdfrdlnkdghldgsevghwvlppaqdqplveanhllhesd
hFl_ENSPANP00000010990 ---------------------liklklqgqqlpvvlppimkqpp.................................
hFl_ENSPANP00000001415 ---------------------hlvyralekepvpsalppslippskr..............................
hFl_ENSPANP00000013054 ---------------------liklklqgyqlpsalppvmkq...................................
hFl_ENSPANP00000009206 ---------------------yeeqcermeamgieplpfhdllcqmldlvkpavdgkitlrdlkrcrmah.......
hFl_ENSPANP00000001415 ---------------------fmhsgltqnllahiwaladtrqtgklskdqfalamyfiqqkvskgidppqvlspdm
hFl_ENSPANP00000004159 ---------------------lsgnphiekesarsiadgammeaasvcmgqmepdqvyegitfedflkiwqgidiet
hFl_ENSPANP00000013482 ---------------------ssfysallriqpkivhcwrpmrrtfksydeagtgllsvadfrtvlrqysinlseee
hFl_ENSPANP00000018262 FQEYV----------------vlvaaltvacnnffw.........................................
hFl_ENSPANP00000005398 ---------------------fhlnnqltqaltsryrdsrlrvdferfvscvaqltcifchcsqhldggegviclth
hFl_ENSPANP00000014303 EEE------------------ilenpdlfltseatdygrqlh...................................
hFl_ENSPANP00000012662 FQEFMAFVAMVTTACH-----eff.....................................................
hFl_ENSPANP00000005019 INEFLEAF-------------r.......................................................
hFl_ENSPANP00000014970 LTE------------------marrll..................................................
hFl_ENSPANP00000006250 LTE------------------marllp..................................................
hFl_ENSPANP00000011359 FQEYCVFLS------------ciammcneffeg............................................
hFl_ENSPANP00000013050 ---------------------liklklqgyqlpsalppvmkq...................................
hFl_ENSPANP00000013482 ---------------------ynvflknlsi..............................................
hFl_ENSPANP00000018878 LQEYMAFMISRET--------envksseeiesafralssegkpyvtkeelyqnltreqadycvshmkpyvdgkgrel
hFl_ENSPANP00000002756 FQ-------------------sffsliagltiacndyfvv.....................................
hFl_ENSPANP00000018444 FSEFIVFVAA-----------itsachkyfek.............................................
hFl_ENSPANP00000004247 FDEFMTIL-------------g.......................................................
hFl_ENSPANP00000006245 FEEFI----------------mlmarltwashekmhe........................................
hFl_ENSPANP00000016200 LQDLKRC--------------klagvffdtffn............................................
hFl_ENSPANP00000013482 YQEF-----------------lqk.....................................................
hFl_ENSPANP00000003778 VDEFS----------------tlv.....................................................
hFl_ENSPANP00000017843 AEELESY--------------mdpmneynalneakqmiavadenqnhhlepeevlkysefftgsklvdyar......
hFl_ENSPANP00000013803 LNDLARILALQEN--------fllqf...................................................
hFl_ENSPANP00000008015 ---------------------lashlieakleghglpanlprrlvppskr...........................
hFl_ENSPANP00000001644 YGEFKRGI-------------igemnehrksyvrkafmkldfnktgsvpitnirkcycakkhsqvisghsteeeiks
hFl_ENSPANP00000007019 FQEYAVFLAL-----------itvmcndffq..............................................
hFl_ENSPANP00000001901 ---------------------lanhlikvkleghelpnelpahllppskr...........................
hFl_ENSPANP00000000771 FQAFIDFMSRETTD-------tdtadqviasfkvlagdknfitaeelrrelppdqaeyciarm..............
hFl_ENSPANP00000019402 ---------------------lgdvaidyhkimhgvvlcf.....................................
hFl_ENSPANP00000006208 ---------------------lanhlikvkleghelpadlpphlvppskr...........................
hFl_ENSPANP00000003981 -------L-------------gdiatdyhkqshggapcs......................................
hFl_ENSPANP00000018508 ---------------------dsmfivafqlfdksgngevtfenvkeifgqtiihhhipfnwdcefirlhfghnrkk
hFl_ENSPANP00000009319 FQSFIDFMTRETAD-------tdtaeqviasfrilasdkpyilaeelrrelppdqaqycikrmp.............
hFl_ENSPANP00000002116 ---------------------lsqalqelfqkareenpgqvhprapeltlsllttmcnstgtdflqlmpaaaalitl
hFl_ENSPANP00000012089 ---------------------........................................................
hFl_ENSPANP00000016429 ---------------------akhlikikldgyelpsslpphlvppshr............................
hFl_ENSPANP00000006158 LEEWI----------------qg......................................................
hFl_ENSPANP00000001648 FTEFL----------------lmifkltmacnkv...........................................
hFl_ENSPANP00000016703 AEEFQ----------------emv.....................................................
hFl_ENSPANP00000013482 ---------------------avcnrnvqiltdeqfdrlwnempvnakgrlkypdfls...................
hFl_ENSPANP00000001714 ---------------------kymte...................................................
hFl_ENSPANP00000001561 ---------------------valsvvcrpartldtiqlafkmygaqedgsvgegdlscilktalgvaeltvtdlfr
hFl_ENSPANP00000011759 ---------------------vfqkvqtspgvllssdlwkaientdflrgifvsrellrlvtlrysdsvgrvsfpsl
hFl_ENSPANP00000016734 ---------------------ltydgemdyktyldfvlalenrkepaalqyifklldienkgylnvfslnyffraiq
hFl_ENSPANP00000009674 YQEF-----------------kly.....................................................
hFl_ENSPANP00000007884 FVEYVRSL-------------aclclycheyfkd...........................................
hFl_ENSPANP00000002971 ---------------------lvacaqnglevslsslnlavppprfhd.............................
hFl_ENSPANP00000015462 V--------------------d.......................................................
hFl_ENSPANP00000005656 ---------------------ialkaahdhthk............................................
hFl_ENSPANP00000009541 FEEFVSLM-------------qelkskdisktfrki.........................................
hFl_ENSPANP00000008758 ---------------------fhlnnqltqaltsryrdsrlrvdferfvscvaqltciflvlrk.............
hFl_ENSPANP00000003523 FEEF-----------------qvlvkk..................................................
hFl_ENSPANP00000018367 FQEFV----------------afesvlcapdalfmvafqlfdkagkgevtfedvkqvfgqttihqhipfnwdsefvq
hFl_ENSPANP00000007665 FQEFV----------------afesvlcapdalfmvafqlfdkagkgevtfedvkqvfgqttihqhipfnwdsefvq
hFl_ENSPANP00000011360 ---------------------vfqlvqacyrk.............................................
hFl_ENSPANP00000005386 YLEFANFLNWKDK--------mllkeyeerviikegrkpdcvnptetnveepepallikpedivlkepgstektlrt
hFl_ENSPANP00000009203 FQEYVTFLG------------alaliyneal..............................................
hFl_ENSPANP00000003466 FKEYSVFLT------------tlcmayndffle............................................
hFl_ENSPANP00000017137 ---------------------islgydigndpqkktgmmdtddfraclismgynmgeaefarimsivdpnrlgvvtf
hFl_ENSPANP00000013482 ---------------------vvnisvfidlveknsrmrkaspctdt..............................
hFl_ENSPANP00000002234 YIKFCKLYMTANEQCLK----ttleklevdskmrrhqfgnhiegsperdpspvpkpspkiirktdqetfsnkgdtrs
hFl_ENSPANP00000003564 FNEYWRLIG------------elakeirkkkd.............................................
hFl_ENSPANP00000010846 FREFLLIFRK-----------aaagelqe................................................
hFl_ENSPANP00000017187 LEEFQ----------------lgl.....................................................
hFl_ENSPANP00000008343 LEEFLK---------------at......................................................
hFl_ENSPANP00000002482 FNEFLLF--------------vfkvaqacy...............................................
hFl_ENSPANP00000010432 LQEWVH---------------ggmttipllvllgmddsg......................................
hFl_ENSPANP00000017137 ---------------------ytgpdsvpgaldymsfstalygesd...............................
hFl_ENSPANP00000005713 FREFLL---------------ifh.....................................................
hFl_ENSPANP00000002260 FDEFIKIFH------------glkstdvaktfrka..........................................
hFl_ENSPANP00000007108 FDEYWTLI-------------ggitgpiak...............................................
hFl_ENSPANP00000010072 LEEFL----------------tst.....................................................
hFl_ENSPANP00000002141 FQEFL----------------vlvfkvaqacfk............................................
hFl_ENSPANP00000010969 ---------------------iqk.....................................................
hFl_ENSPANP00000016650 WEEYKN---------------atygy...................................................
hFl_ENSPANP00000017922 ---------------------iqk.....................................................
hFl_ENSPANP00000011099 ---------------------lmifklvrahnkiiskdycq....................................
hFl_ENSPANP00000005052 L--------------------sqvgdvlralgtnptnaevrkvlgnpsnevknvsrnraqfipdceiisnvkfksnf
hFl_ENSPANP00000001415 ---------------------kqgfyvalrlvacaqsghevtlsnlnlsmpppkfhd....................
hFl_ENSPANP00000011769 FDEFVYIFQEVK---------ssdiaktfrkainrkegicalggtselssegtqhsyseeekyafvnwinkalendp
hFl_ENSPANP00000009206 ---------------------k.......................................................
hFl_ENSPANP00000001646 FQEFI----------------slsaialkaahdhthk........................................
hFl_ENSPANP00000020875 ---------------------arleelqevvlaadllegdmiaeenledflrnigikspkeevekilqsdfvsednm
hFl_ENSPANP00000000260 FDEFVYIFQEVK---------ssdiaktfrkainrkegicalggtselssegtqhsyseeekyafvnwinkalendp
hFl_ENSPANP00000020875 YEDLNTCLQ------------nfgiylskpefkkitelteagetkkvnfkefidtmms...................
hFl_ENSPANP00000005819 YYEFVAALHP-----------nkd.....................................................
hFl_ENSPANP00000013481 ---------------------fghplapqaledvktvvcrnvaggvwedrltldgflflntlfiqrgrhettwtilr
hFl_ENSPANP00000016713 YYEFVAALHP-----------nkd.....................................................
hFl_ENSPANP00000003270 LEDYTAFLIHKESEN------ikssneienafqalaegksyitkedmkqaltpeqvsfcathm..............
hFl_ENSPANP00000020875 ---------------------lmdkdlhtanailtvmlrhvpehesgkvtiqefmtkf...................
hFl_ENSPANP00000019992 ---------------------fntplapqaledvknvvrkhisdgvadsgltlkgrlfsyvtlyiqrgrhettwtvl
hFl_ENSPANP00000020877 FSDFIKVL-------------tdknlflkav..............................................
hFl_ENSPANP00000017252 YAEFA----------------ks......................................................
hFl_ENSPANP00000012991 ---------------------eslnvpvddslvkelirmcshgegkinyynfvrafs....................
hFl_ENSPANP00000016852 ---------------------chmlsleevapvlqqtllqdnllgrvhfdqfkealililsrtlsneehfqepdcsl
hFl_ENSPANP00000000400 ---------------------rapedtcsdvdflialahekfkknmfenfdsfiyscvyedrekrnvlptkdikrlc
hFl_ENSPANP00000000366 ---------------------mk......................................................
hFl_ENSPANP00000014303 WDEY-----------------niqmydrvidfdentalddaeeesfrklhlkdkkrfekanqdsgpglsleefiaf.
hFl_ENSPANP00000005825 FREFVSGLS------------aachgdlteklkllykmhvlpepssdqdepdsafeatqyffeditpecthvvglds
hFl_ENSPANP00000007500 REEMVSYFLR-----------sss.....................................................
hFl_ENSPANP00000000752 REEMVSYFLR-----------sss.....................................................
hFl_ENSPANP00000008665 PEEFTTGFS------------hfffsqnn................................................
hFl_ENSPANP00000019328 FQEFARGF-------------rgalrggrre..............................................
hFl_ENSPANP00000020336 ---------------------kq......................................................
hFl_ENSPANP00000002971 ---------------------flvycalekepvplslppalvppskr..............................
hFl_ENSPANP00000020875 ---------------------ifcrikggrvstdeifgvldsmgipinpeileevikhtyidsnhmvdigdiifiln
hFl_ENSPANP00000015375 LQEFSN---------------mdlrdfhkymrshkaesselvrnshhtwly..........................
hFl_ENSPANP00000013482 ---------------------knciqqqdpefkkrfldfskepngkinvhdfkkvledtgmpmddeqyallttkigf
hFl_ENSPANP00000001076 ---------------------saidimyngsfteklkllfklhippaytevkskdtskgdelskeellyfsqlhvsk
hFl_ENSPANP00000017843 WDEY-----------------kv......................................................
hFl_ENSPANP00000006270 ---------------------ldfedfmilllsitvm........................................
hFl_ENSPANP00000002752 AREF-----------------t.......................................................
hFl_ENSPANP00000010107 WEELRN---------------atyghyapgeefhdve........................................
hFl_ENSPANP00000007279 KDEIRHWILPQDYDH------aqaearhlvyesdknkdekltkeeil..............................
hFl_ENSPANP00000018263 FDEFVLA--------------ifnllnlcyld.............................................
hFl_ENSPANP00000013803 KSELALCL-------------........................................................
hFl_ENSPANP00000011977 QAEWVR---------------a.......................................................
hFl_ENSPANP00000006880 QAEWVR---------------a.......................................................
hFl_ENSPANP00000008114 ---------------------tgmsgmyhgdlteklkvlyklhlppalspeeae.......................
hFl_ENSPANP00000009030 TKELCDYFVD-----------hmgdyed.................................................
hFl_ENSPANP00000016306 RDEITAYFM------------ra......................................................
hFl_ENSPANP00000019993 YH-------------------dfislmsnk...............................................
hFl_ENSPANP00000000366 ---------------------nekretkgdeekramlrlqlygyhsptnsvlktdaeelvsrsywdtlrrntsqalf
hFl_ENSPANP00000018199 ---------------------yflra...................................................
hFl_ENSPANP00000020672 VEE------------------lk......................................................
hFl_ENSPANP00000008729 ---------------------yflra...................................................
hFl_ENSPANP00000006250 ENEL-----------------dallkdlceknkq...........................................
hFl_ENSPANP00000011328 ---------------------qddmmtvntnetgcqeatvkepeinttlqmrffgkrgqrklhykefrrfmenlqte
hFl_ENSPANP00000012268 FKDF-----------------lavm....................................................
hFl_ENSPANP00000018718 AEEF-----------------k.......................................................
hFl_ENSPANP00000010889 FDEFLYILGKLVKDY------hlqyhrqlcahh............................................
hFl_ENSPANP00000020671 ---------------------dentsdlqpdldlltrnvsdlglfikskqqlsdnqrqisdaiaaasivtngtgies
hFl_ENSPANP00000011848 ---------------------ssafdpnseevvarspnhldsslgieeiesllhiikdntecpfkpvdldyvldwit
hFl_ENSPANP00000020673 ---------------------dentsdlqpdldlltrnvsdlglfikskqqlsdnqrqisdaiaaasivtngtgies
hFl_ENSPANP00000006193 TEELCEYFSQ-----------hlgeye..................................................
hFl_ENSPANP00000015860 ---------------------rmleklgvpkthlelkkligevssgsgetfsypdflrmml................
hFl_ENSPANP00000003135 FQEFLKCL-------------........................................................
hFl_ENSPANP00000008557 AREFCLGLGM-----------fvgvesaqgatprrtpe.......................................
hFl_ENSPANP00000014970 ENEL-----------------dallkdlceknkqe..........................................
hFl_ENSPANP00000009124 ---------------------tqqlphlmpsncgleekianlgscndsklefgsfwelige................
hFl_ENSPANP00000003056 PKEY-----------------nvy.....................................................
hFl_ENSPANP00000013460 FEDFYQGIT------------airngdpd................................................
hFl_ENSPANP00000016675 ---------------------vvngrvlelfraaqlpndvvlqimelcgatrlgyfgrsqfyialklvavaqsgfpl
hFl_ENSPANP00000016846 WQKYVDYMMRE----------fqgkedmqksq.............................................
hFl_ENSPANP00000011328 ---------------------qddmmtvntnetgcqeatvkepeinttlqmrffgkrgqrklhykefrrfmenlqte
hFl_ENSPANP00000004053 ---------------------nrklslqekrkexlrttngrlnidnlnlsfrkedrsfsgclpppkvraicgkhgly
hFl_ENSPANP00000017871 ---------------------m.......................................................
hFl_ENSPANP00000004677 ---------------------m.......................................................
hFl_ENSPANP00000018325 PAELIN---------------f.......................................................
hFl_ENSPANP00000016823 FEEFQNYF-------------adgvlspgelqelfsgidghltdnleteklcdyf......................
hFl_ENSPANP00000016006 ---------------------yeknkkemniq.............................................
hFl_ENSPANP00000018508 ---------------------yfnafnsllnnmelvrkiystlagtrkdvevtkeefaqsairygqvtpleidilyq
hFl_ENSPANP00000018829 ---------------------egeiadlmslkrmmeklgvpkthlemkkmisevtggvsdtisyrdfvnmml.....
hFl_ENSPANP00000016824 FEEFQNYF-------------adgvlspgelqelfsgidghltdnleteklcdyf......................
hFl_ENSPANP00000010241 ---------------------ehwaqdlskvrermtkfiddtmretaepflfvdefltylfsrensiwdekydav..
hFl_ENSPANP00000002202 KDEIRHWILPQDYDH------aqaearhlvyesdknk........................................
hFl_ENSPANP00000020427 ---------------------egekvnyekfrnwlflnkdaftfsrwlls...........................
hFl_ENSPANP00000020450 ---------------------miavtqrgv...............................................
hFl_ENSPANP00000019970 FKDFCR---------------gvf.....................................................
hFl_ENSPANP00000017056 ---------------------vmvleerqeyasseqltaiaqlhektrgggvnineffkg.................
hFl_ENSPANP00000012483 ---------------------ytvlhiphdpvaleehfrddddgpvssqgympylnkyildkveegafvkehfdelc
hFl_ENSPANP00000017055 ---------------------vmvleerqeyasseqltaiaqlhektrgggvnineffkg.................
hFl_ENSPANP00000009566 ---------------------gntmsgihksfevlgytnskgkkairredflrllvtkgehmteeemldcfasll..
hFl_ENSPANP00000013482 ---------------------ickmqkvleecgcsltegeltnllnrtswgvsrhdnsinyldflra..........
hFl_ENSPANP00000007665 ---------------------fvlaaqkfgqvtpmevdilfrladlyeprgrmtlad....................
hFl_ENSPANP00000018367 ---------------------fvlaaqkfgqvtpmevdilfrladlyeprgrmtlad....................
hFl_ENSPANP00000012679 ---------------------htiyevvdssvnhs..........................................
hFl_ENSPANP00000012680 ---------------------htiyevvdssvnhs..........................................
hFl_ENSPANP00000008763 ---------------------lctvlkvphdpvaleehfrdddegpvsnqgympylnrfilekvqdnfdkiefn...
hFl_ENSPANP00000019937 ---------------------dvmkaldlvsdpeyinlmknkldpeglgiillgpflqe..................
hFl_ENSPANP00000012527 LEEFSSGLK------------nifgssqsshrlrrrkplpskrvsattsfpaleeadaeekeaflafieqlgtghll
hFl_ENSPANP00000008287 ---------------------agaagggpgsgppeaarvapgtataaagpvadlfrasqlpaetlhqitelcgakrv
hFl_ENSPANP00000004139 ---------------------htiyevvdasvnhssgss......................................
hFl_ENSPANP00000004290 ---------------------htiyevvdasvnhssgss......................................
hFl_ENSPANP00000020336 ---------------------m.......................................................
hFl_ENSPANP00000003145 LREFYMAFQVV----------qlslap..................................................
hFl_ENSPANP00000017380 ---------------------vscldtmyngemnekikllyrlh.................................
hFl_ENSPANP00000019527 ---------------------aenmlealknssganlqgelshiirql.............................
hFl_ENSPANP00000016200 ---------------------kilhnchddaakfvhllmspgcnylvpddfvpflqvr...................
hFl_ENSPANP00000013484 ---------------------alaqsneqgqvcyqelvdlis...................................
hFl_ENSPANP00000019122 ---------------------rghiewpdflsheslll.......................................
hFl_ENSPANP00000011328 ---------------------vl......................................................
hFl_ENSPANP00000005617 ---------------------llscseadeneminceefanrf..................................
hFl_ENSPANP00000011677 IDD------------------lvkvie..................................................
hFl_ENSPANP00000002004 ---------------------nqevediviylsslgkhntitmdilantykqw........................
hFl_ENSPANP00000005046 WDK------------------ltsfil..................................................
hFl_ENSPANP00000020438 ---------------------dleeilytlglhlsraqvkkllnkv...............................
hFl_ENSPANP00000020442 ---------------------dleeilytlglhlsraqvkkllnkv...............................
hFl_ENSPANP00000016734 ---------------------takvfakllhtdsygrisimqffnyvmrkvwlhqtriglslydvagqgylresdle
hFl_ENSPANP00000008645 FLELRVA--------------l.......................................................
hFl_ENSPANP00000003048 ---------------------lltlgirlsaeqakqlvsrv....................................
hFl_ENSPANP00000001629 ---------------------dpngegpnatvdldtflvvmrdwiaacqlh..........................
hFl_ENSPANP00000007857 EAE------------------aqall...................................................
hFl_ENSPANP00000012179 F--------------------vqykealktlglctededlkddghiitldkfkeevnkr..................
hFl_ENSPANP00000020858 ---------------------dl......................................................


                                                                                                    
                                                                                                    
d1sraa_                .............................................................................
hFl_ENSPANP00000005664 .............................................................................
hFl_ENSPANP00000015843 .............................................................................
hFl_ENSPANP00000018838 .............................................................................
hFl_ENSPANP00000000687 ltm..........................................................................
hFl_ENSPANP00000011132 .............................................................................
hFl_ENSPANP00000011888 .............................................................................
hFl_ENSPANP00000012946 .............................................................................
hFl_ENSPANP00000015640 .............................................................................
hFl_ENSPANP00000008517 .............................................................................
hFl_ENSPANP00000017051 pvfldrlely...................................................................
hFl_ENSPANP00000008208 .............................................................................
hFl_ENSPANP00000000685 .............................................................................
hFl_ENSPANP00000001217 .............................................................................
hFl_ENSPANP00000009011 .............................................................................
hFl_ENSPANP00000016439 iklnvlewlqltm................................................................
hFl_ENSPANP00000020904 .............................................................................
hFl_ENSPANP00000011992 .............................................................................
hFl_ENSPANP00000011142 dtsrytgshker.................................................................
hFl_ENSPANP00000008176 psqarlliekyepnqqflerdqmsmegfsrylggeengilpleald...............................
hFl_ENSPANP00000016326 rgqlspegmvwflcgpensvlaqdkl...................................................
hFl_ENSPANP00000005573 dgdgevneeeflrimkkt...........................................................
hFl_ENSPANP00000018511 .............................................................................
hFl_ENSPANP00000007984 .............................................................................
hFl_ENSPANP00000009334 .............................................................................
hFl_ENSPANP00000011977 .............................................................................
hFl_ENSPANP00000006880 .............................................................................
hFl_ENSPANP00000016389 .............................................................................
hFl_ENSPANP00000017625 .............................................................................
hFl_ENSPANP00000020753 .............................................................................
hFl_ENSPANP00000011482 .............................................................................
hFl_ENSPANP00000008596 lcg..........................................................................
hFl_ENSPANP00000014722 .............................................................................
hFl_ENSPANP00000010579 .............................................................................
hFl_ENSPANP00000018638 ddfiqcvms....................................................................
hFl_ENSPANP00000007213 er...........................................................................
hFl_ENSPANP00000001594 kyepnqqflerdqmsmegfsrylggeengilpleald........................................
hFl_ENSPANP00000002108 ryepsetakaqrqmtkdgflmyllsadgsafslahrrvy......................................
hFl_ENSPANP00000007118 enkvknvlgiegftnfmrspacdifnplhhevy............................................
hFl_ENSPANP00000006887 ldliswlcf....................................................................
hFl_ENSPANP00000020829 .............................................................................
hFl_ENSPANP00000004533 .............................................................................
hFl_ENSPANP00000005357 cprsanpamqldrfiqvctqlqvlteafrekdtavqgnirlsfedfvtmt...........................
hFl_ENSPANP00000014595 dtskytgthker.................................................................
hFl_ENSPANP00000019694 .............................................................................
hFl_ENSPANP00000012647 .............................................................................
hFl_ENSPANP00000011841 inefihlt.....................................................................
hFl_ENSPANP00000007138 .............................................................................
hFl_ENSPANP00000005603 .............................................................................
hFl_ENSPANP00000003537 kefldtkdlmmfleaeqgvahineeisleiihkyepskegqekgwlsidgftnylmspdcyifdpehkkvc......
hFl_ENSPANP00000016730 dhlrellttmgdrftdeevdemyreapidkkgnfnyveftrilkh................................
hFl_ENSPANP00000004388 pieevrkarqmsfegftrymdsrecqlfknecrkvy.........................................
hFl_ENSPANP00000004958 dylrellttmgdrftdeevdelyreapidkkgnfnyieftrilkh................................
hFl_ENSPANP00000017808 dflqgtm......................................................................
hFl_ENSPANP00000006158 nkgaitpprttspanssspevihlkdivcylsllergrpedklefm...............................
hFl_ENSPANP00000000685 .............................................................................
hFl_ENSPANP00000001746 .............................................................................
hFl_ENSPANP00000005266 .............................................................................
hFl_ENSPANP00000011699 .............................................................................
hFl_ENSPANP00000001618 .............................................................................
hFl_ENSPANP00000010432 pdtesnmaekqaptedqvaatppeppvprssssrspvvylkdvvcylslletgrpqdklefm...............
hFl_ENSPANP00000019362 .............................................................................
hFl_ENSPANP00000005159 .............................................................................
hFl_ENSPANP00000011834 .............................................................................
hFl_ENSPANP00000004357 atmcgg.......................................................................
hFl_ENSPANP00000010858 mcldiirryelseegrqkgflaidgftqyllssecdifdpeqkkv................................
hFl_ENSPANP00000010399 .............................................................................
hFl_ENSPANP00000004118 .............................................................................
hFl_ENSPANP00000010678 hedsngcinyeelvrmvl...........................................................
hFl_ENSPANP00000008201 tmcgg........................................................................
hFl_ENSPANP00000000555 gngtvmgaeirhvlvtlgekmteeevemlvaghedsngcinyeafvrhil...........................
hFl_ENSPANP00000014173 .............................................................................
hFl_ENSPANP00000002207 gngtvmgaeirhvlvtlgekmteeevemlvaghedsngcinyeafvrhil...........................
hFl_ENSPANP00000001879 .............................................................................
hFl_ENSPANP00000005388 .............................................................................
hFl_ENSPANP00000002662 .............................................................................
hFl_ENSPANP00000009999 kfldnfdspydkdglvtpeefmnyyagvsasidtdvyfivmmrtaw...............................
hFl_ENSPANP00000004626 dgkgkinkeyikrllmsqadkmtadevdqmfqfasidaagnldykalsyvithg.......................
hFl_ENSPANP00000006233 rfskeeidqmfaafppdvtgnlnyknlvhiithg...........................................
hFl_ENSPANP00000002660 .............................................................................
hFl_ENSPANP00000011209 .............................................................................
hFl_ENSPANP00000020345 .............................................................................
hFl_ENSPANP00000020343 .............................................................................
hFl_ENSPANP00000008924 fgpclpdpksqmef...............................................................
hFl_ENSPANP00000015530 tqadrfseeevkqmfaafppdvcgnldyrnlcyvithg.......................................
hFl_ENSPANP00000008596 .............................................................................
hFl_ENSPANP00000002265 .............................................................................
hFl_ENSPANP00000014191 drftpeeiknmwaafppdvggnvdyknicyvithg..........................................
hFl_ENSPANP00000012413 .............................................................................
hFl_ENSPANP00000007079 .............................................................................
hFl_ENSPANP00000012088 .............................................................................
hFl_ENSPANP00000020865 .............................................................................
hFl_ENSPANP00000003943 iqvsyeqylsmvfs...............................................................
hFl_ENSPANP00000005422 .............................................................................
hFl_ENSPANP00000015281 .............................................................................
hFl_ENSPANP00000017172 .............................................................................
hFl_ENSPANP00000014458 .............................................................................
hFl_ENSPANP00000008201 rlahven......................................................................
hFl_ENSPANP00000004357 rlahven......................................................................
hFl_ENSPANP00000004505 ewlqltm......................................................................
hFl_ENSPANP00000012751 .............................................................................
hFl_ENSPANP00000001879 .............................................................................
hFl_ENSPANP00000001065 .............................................................................
hFl_ENSPANP00000009095 .............................................................................
hFl_ENSPANP00000013050 .............................................................................
hFl_ENSPANP00000013054 .............................................................................
hFl_ENSPANP00000014002 cv...........................................................................
hFl_ENSPANP00000008287 .............................................................................
hFl_ENSPANP00000016675 .............................................................................
hFl_ENSPANP00000013999 qlcvkgg......................................................................
hFl_ENSPANP00000003565 .............................................................................
hFl_ENSPANP00000018211 .............................................................................
hFl_ENSPANP00000010407 .............................................................................
hFl_ENSPANP00000016650 kltkeeivdkydlfvgsqatdfgeal...................................................
hFl_ENSPANP00000001581 .............................................................................
hFl_ENSPANP00000016006 qeytqtilrmfdlngdgklglsemsrll.................................................
hFl_ENSPANP00000015459 kskgllgidgftnytrspagdifnpdhhhvh..............................................
hFl_ENSPANP00000014312 .............................................................................
hFl_ENSPANP00000010990 .............................................................................
hFl_ENSPANP00000002202 eefehmkeivvletledidkngdgfvdqdeyiadmfs........................................
hFl_ENSPANP00000007279 eefehmkeivvletledidkngdgfvdqdeyiadmfs........................................
hFl_ENSPANP00000011150 .............................................................................
hFl_ENSPANP00000008402 .............................................................................
hFl_ENSPANP00000018674 fvsfvhlmlrvenmedvfqnltqdgkgiylqkpewmmm.......................................
hFl_ENSPANP00000002971 .............................................................................
hFl_ENSPANP00000002116 .............................................................................
hFl_ENSPANP00000014197 elrtvlqsclresaislpdekldqltlalfesadtdgngaitfeelrdelqrfpgvmenl.................
hFl_ENSPANP00000012648 .............................................................................
hFl_ENSPANP00000020427 laneflnll....................................................................
hFl_ENSPANP00000013098 .............................................................................
hFl_ENSPANP00000010107 tdkdgrlskaeilgnwnmfvgsqatnygedl..............................................
hFl_ENSPANP00000010990 .............................................................................
hFl_ENSPANP00000001415 .............................................................................
hFl_ENSPANP00000013054 .............................................................................
hFl_ENSPANP00000009206 .............................................................................
hFl_ENSPANP00000001415 vppser.......................................................................
hFl_ENSPANP00000004159 kmhvrfl......................................................................
hFl_ENSPANP00000013482 ffhileyydktlsskisyndflraf....................................................
hFl_ENSPANP00000018262 .............................................................................
hFl_ENSPANP00000005398 rqwme........................................................................
hFl_ENSPANP00000014303 .............................................................................
hFl_ENSPANP00000012662 .............................................................................
hFl_ENSPANP00000005019 .............................................................................
hFl_ENSPANP00000014970 .............................................................................
hFl_ENSPANP00000006250 .............................................................................
hFl_ENSPANP00000011359 .............................................................................
hFl_ENSPANP00000013050 .............................................................................
hFl_ENSPANP00000013482 .............................................................................
hFl_ENSPANP00000018878 ptafdyvef....................................................................
hFl_ENSPANP00000002756 .............................................................................
hFl_ENSPANP00000018444 .............................................................................
hFl_ENSPANP00000004247 .............................................................................
hFl_ENSPANP00000006245 .............................................................................
hFl_ENSPANP00000016200 .............................................................................
hFl_ENSPANP00000013482 .............................................................................
hFl_ENSPANP00000003778 .............................................................................
hFl_ENSPANP00000017843 .............................................................................
hFl_ENSPANP00000013803 .............................................................................
hFl_ENSPANP00000008015 .............................................................................
hFl_ENSPANP00000001644 sfletlkfacsksdevsygefedyye...................................................
hFl_ENSPANP00000007019 .............................................................................
hFl_ENSPANP00000001901 .............................................................................
hFl_ENSPANP00000000771 .............................................................................
hFl_ENSPANP00000019402 .............................................................................
hFl_ENSPANP00000006208 .............................................................................
hFl_ENSPANP00000003981 .............................................................................
hFl_ENSPANP00000018508 hlnyteftqflqelqleharqafalkdksksgmisgldfsdimvtirsh............................
hFl_ENSPANP00000009319 .............................................................................
hFl_ENSPANP00000002116 sg...........................................................................
hFl_ENSPANP00000012089 .............................................................................
hFl_ENSPANP00000016429 .............................................................................
hFl_ENSPANP00000006158 .............................................................................
hFl_ENSPANP00000001648 .............................................................................
hFl_ENSPANP00000016703 .............................................................................
hFl_ENSPANP00000013482 .............................................................................
hFl_ENSPANP00000001714 .............................................................................
hFl_ENSPANP00000001561 aidqeekgkitfadfhrfaemypdfaeeylypdq...........................................
hFl_ENSPANP00000011759 vcflmrleamaktfrnlskdgkglyltemewmnlvm.........................................
hFl_ENSPANP00000016734 elmkihgqdpvsfqdvkdeifdmvkpkdplkislqdlin......................................
hFl_ENSPANP00000009674 .............................................................................
hFl_ENSPANP00000007884 .............................................................................
hFl_ENSPANP00000002971 .............................................................................
hFl_ENSPANP00000015462 .............................................................................
hFl_ENSPANP00000005656 .............................................................................
hFl_ENSPANP00000009541 .............................................................................
hFl_ENSPANP00000008758 .............................................................................
hFl_ENSPANP00000003523 .............................................................................
hFl_ENSPANP00000018367 lhfgkerkrhltyaeftqfllei......................................................
hFl_ENSPANP00000007665 lhfgkerkrhltyaeftqflle.......................................................
hFl_ENSPANP00000011360 .............................................................................
hFl_ENSPANP00000005386 llrpsdkvsnyykttsseinavvgavpatcypicgvptirsdipaprirrisdrtnygeegsaysllyptifaqkgv
hFl_ENSPANP00000009203 .............................................................................
hFl_ENSPANP00000003466 .............................................................................
hFl_ENSPANP00000017137 qafidfmsret..................................................................
hFl_ENSPANP00000013482 .............................................................................
hFl_ENSPANP00000002234 sllsatrkfktsvsftitmgangnrnskltepnlikdwqymqskgcffleedgeiishqyrmqiaqrsmvyltikpl
hFl_ENSPANP00000003564 .............................................................................
hFl_ENSPANP00000010846 .............................................................................
hFl_ENSPANP00000017187 .............................................................................
hFl_ENSPANP00000008343 .............................................................................
hFl_ENSPANP00000002482 .............................................................................
hFl_ENSPANP00000010432 .............................................................................
hFl_ENSPANP00000017137 .............................................................................
hFl_ENSPANP00000005713 .............................................................................
hFl_ENSPANP00000002260 .............................................................................
hFl_ENSPANP00000007108 .............................................................................
hFl_ENSPANP00000010072 .............................................................................
hFl_ENSPANP00000002141 .............................................................................
hFl_ENSPANP00000010969 .............................................................................
hFl_ENSPANP00000016650 .............................................................................
hFl_ENSPANP00000017922 .............................................................................
hFl_ENSPANP00000011099 .............................................................................
hFl_ENSPANP00000005052 inflnylkfkeregppkagdkggictkesfvssgekmkeeevealmagqedsngcinyeafvkhims..........
hFl_ENSPANP00000001415 .............................................................................
hFl_ENSPANP00000011769 d............................................................................
hFl_ENSPANP00000009206 .............................................................................
hFl_ENSPANP00000001646 .............................................................................
hFl_ENSPANP00000020875 vnikdcmral...................................................................
hFl_ENSPANP00000000260 d............................................................................
hFl_ENSPANP00000020875 .............................................................................
hFl_ENSPANP00000005819 .............................................................................
hFl_ENSPANP00000013481 sfgysdtleltadylfpplhvppgcstelnhlgyqfvqrvfekhdqdrdgalspmelqslfsvfpaapwgpellrtv
hFl_ENSPANP00000016713 .............................................................................
hFl_ENSPANP00000003270 .............................................................................
hFl_ENSPANP00000020875 .............................................................................
hFl_ENSPANP00000019992 rrfgydddldltpeylfplyvfphdsnfssscgdykylflfvllrkenqdrdcalspdelkdlfkvfpyipwgpdvn
hFl_ENSPANP00000020877 .............................................................................
hFl_ENSPANP00000017252 .............................................................................
hFl_ENSPANP00000012991 .............................................................................
hFl_ENSPANP00000016852 eaqpkyvrggkrygrrslpefqesveefaevtviepldeearpshipasdcsehwktqrseeyeaegqlrfwnpddl
hFl_ENSPANP00000000400 kssrlplsddllesllsrfedsekqidyksffsal..........................................
hFl_ENSPANP00000000366 .............................................................................
hFl_ENSPANP00000014303 .............................................................................
hFl_ENSPANP00000005825 rskqgaddgfvtvslkpdkgkransqenrnylrlwtpenksksknakdlpklnqgqfielcktmynmfsedpneqel
hFl_ENSPANP00000007500 .............................................................................
hFl_ENSPANP00000000752 .............................................................................
hFl_ENSPANP00000008665 .............................................................................
hFl_ENSPANP00000019328 .............................................................................
hFl_ENSPANP00000020336 .............................................................................
hFl_ENSPANP00000002971 .............................................................................
hFl_ENSPANP00000020875 e............................................................................
hFl_ENSPANP00000015375 .............................................................................
hFl_ENSPANP00000013482 ekegm........................................................................
hFl_ENSPANP00000001076 penekeeesakhspekgkgkidiqaylsqwq..............................................
hFl_ENSPANP00000017843 .............................................................................
hFl_ENSPANP00000006270 .............................................................................
hFl_ENSPANP00000002752 .............................................................................
hFl_ENSPANP00000010107 .............................................................................
hFl_ENSPANP00000007279 .............................................................................
hFl_ENSPANP00000018263 .............................................................................
hFl_ENSPANP00000013803 .............................................................................
hFl_ENSPANP00000011977 .............................................................................
hFl_ENSPANP00000006880 .............................................................................
hFl_ENSPANP00000008114 .............................................................................
hFl_ENSPANP00000009030 .............................................................................
hFl_ENSPANP00000016306 .............................................................................
hFl_ENSPANP00000019993 .............................................................................
hFl_ENSPANP00000000366 sdlaeradditslvtdttllvhffgkkgkaelnfedfyrfmdnlqtevleieflsysngmntiseedfahillrytn
hFl_ENSPANP00000018199 .............................................................................
hFl_ENSPANP00000020672 .............................................................................
hFl_ENSPANP00000008729 .............................................................................
hFl_ENSPANP00000006250 .............................................................................
hFl_ENSPANP00000011328 iqemeflqfskglsfmrkedfaewllfftntenkdiywknvreklsagerrkcndmrilcnflktlenfhleyqyil
hFl_ENSPANP00000012268 .............................................................................
hFl_ENSPANP00000018718 .............................................................................
hFl_ENSPANP00000010889 .............................................................................
hFl_ENSPANP00000020671 tslgifgvgilqlndflvncqgehctydeilsiiqkfepnismchqglmsfegfarflmdkenfa............
hFl_ENSPANP00000011848 vngsvrrkgfylkmsqyentnfsmdtdgsmtvdwdewkyyfllhpaknvteiihfwkrstlidigesiaipdefte.
hFl_ENSPANP00000020673 tslgifgvgilqlndflvncqgehctydeilsiiqkfepnismchqglmsfegfarflmdkenfa............
hFl_ENSPANP00000006193 .............................................................................
hFl_ENSPANP00000015860 .............................................................................
hFl_ENSPANP00000003135 .............................................................................
hFl_ENSPANP00000008557 .............................................................................
hFl_ENSPANP00000014970 .............................................................................
hFl_ENSPANP00000009124 .............................................................................
hFl_ENSPANP00000003056 .............................................................................
hFl_ENSPANP00000013460 .............................................................................
hFl_ENSPANP00000016675 rvesintvkdlp.................................................................
hFl_ENSPANP00000016846 .............................................................................
hFl_ENSPANP00000011328 iqemeflq.....................................................................
hFl_ENSPANP00000004053 ltlslletllnhqdlgyqneikwqnfvaml...............................................
hFl_ENSPANP00000017871 .............................................................................
hFl_ENSPANP00000004677 .............................................................................
hFl_ENSPANP00000018325 .............................................................................
hFl_ENSPANP00000016823 .............................................................................
hFl_ENSPANP00000016006 .............................................................................
hFl_ENSPANP00000018508 ladlynasgrltladi.............................................................
hFl_ENSPANP00000018829 .............................................................................
hFl_ENSPANP00000016824 .............................................................................
hFl_ENSPANP00000010241 .............................................................................
hFl_ENSPANP00000002202 .............................................................................
hFl_ENSPANP00000020427 .............................................................................
hFl_ENSPANP00000020450 .............................................................................
hFl_ENSPANP00000019970 .............................................................................
hFl_ENSPANP00000017056 .............................................................................
hFl_ENSPANP00000012483 wtltakknyradsngnsmlsnqdafrlwclfnflsedkyplimvpdeveyllkkvlssmslevs.............
hFl_ENSPANP00000017055 .............................................................................
hFl_ENSPANP00000009566 .............................................................................
hFl_ENSPANP00000013482 .............................................................................
hFl_ENSPANP00000007665 .............................................................................
hFl_ENSPANP00000018367 .............................................................................
hFl_ENSPANP00000012679 .............................................................................
hFl_ENSPANP00000012680 .............................................................................
hFl_ENSPANP00000008763 .............................................................................
hFl_ENSPANP00000019937 .............................................................................
hFl_ENSPANP00000012527 pkqteiwqlwgqlrqeepqlagnlagflakmtsrlqeaqadkealeltlkkcdsdh.....................
hFl_ENSPANP00000008287 gyfgatqfyialkliaaaqsgl.......................................................
hFl_ENSPANP00000004139 .............................................................................
hFl_ENSPANP00000004290 .............................................................................
hFl_ENSPANP00000020336 .............................................................................
hFl_ENSPANP00000003145 .............................................................................
hFl_ENSPANP00000017380 .............................................................................
hFl_ENSPANP00000019527 .............................................................................
hFl_ENSPANP00000016200 .............................................................................
hFl_ENSPANP00000013484 .............................................................................
hFl_ENSPANP00000019122 .............................................................................
hFl_ENSPANP00000011328 .............................................................................
hFl_ENSPANP00000005617 .............................................................................
hFl_ENSPANP00000011677 .............................................................................
hFl_ENSPANP00000002004 .............................................................................
hFl_ENSPANP00000005046 .............................................................................
hFl_ENSPANP00000020438 .............................................................................
hFl_ENSPANP00000020442 .............................................................................
hFl_ENSPANP00000016734 nyileli......................................................................
hFl_ENSPANP00000008645 .............................................................................
hFl_ENSPANP00000003048 .............................................................................
hFl_ENSPANP00000001629 .............................................................................
hFl_ENSPANP00000007857 .............................................................................
hFl_ENSPANP00000012179 .............................................................................
hFl_ENSPANP00000020858 .............................................................................


                                                                                                    
                                                                                                    
d1sraa_                .............................................................................
hFl_ENSPANP00000005664 .............................................................................
hFl_ENSPANP00000015843 .............................................................................
hFl_ENSPANP00000018838 .............................................................................
hFl_ENSPANP00000000687 .............................................................................
hFl_ENSPANP00000011132 .............................................................................
hFl_ENSPANP00000011888 .............................................................................
hFl_ENSPANP00000012946 .............................................................................
hFl_ENSPANP00000015640 .............................................................................
hFl_ENSPANP00000008517 .............................................................................
hFl_ENSPANP00000017051 .............................................................................
hFl_ENSPANP00000008208 .............................................................................
hFl_ENSPANP00000000685 .............................................................................
hFl_ENSPANP00000001217 .............................................................................
hFl_ENSPANP00000009011 .............................................................................
hFl_ENSPANP00000016439 .............................................................................
hFl_ENSPANP00000020904 .............................................................................
hFl_ENSPANP00000011992 .............................................................................
hFl_ENSPANP00000011142 .............................................................................
hFl_ENSPANP00000008176 .............................................................................
hFl_ENSPANP00000016326 .............................................................................
hFl_ENSPANP00000005573 .............................................................................
hFl_ENSPANP00000018511 .............................................................................
hFl_ENSPANP00000007984 .............................................................................
hFl_ENSPANP00000009334 .............................................................................
hFl_ENSPANP00000011977 .............................................................................
hFl_ENSPANP00000006880 .............................................................................
hFl_ENSPANP00000016389 .............................................................................
hFl_ENSPANP00000017625 .............................................................................
hFl_ENSPANP00000020753 .............................................................................
hFl_ENSPANP00000011482 .............................................................................
hFl_ENSPANP00000008596 .............................................................................
hFl_ENSPANP00000014722 .............................................................................
hFl_ENSPANP00000010579 .............................................................................
hFl_ENSPANP00000018638 .............................................................................
hFl_ENSPANP00000007213 .............................................................................
hFl_ENSPANP00000001594 .............................................................................
hFl_ENSPANP00000002108 .............................................................................
hFl_ENSPANP00000007118 .............................................................................
hFl_ENSPANP00000006887 .............................................................................
hFl_ENSPANP00000020829 .............................................................................
hFl_ENSPANP00000004533 .............................................................................
hFl_ENSPANP00000005357 .............................................................................
hFl_ENSPANP00000014595 .............................................................................
hFl_ENSPANP00000019694 .............................................................................
hFl_ENSPANP00000012647 .............................................................................
hFl_ENSPANP00000011841 .............................................................................
hFl_ENSPANP00000007138 .............................................................................
hFl_ENSPANP00000005603 .............................................................................
hFl_ENSPANP00000003537 .............................................................................
hFl_ENSPANP00000016730 .............................................................................
hFl_ENSPANP00000004388 .............................................................................
hFl_ENSPANP00000004958 .............................................................................
hFl_ENSPANP00000017808 .............................................................................
hFl_ENSPANP00000006158 .............................................................................
hFl_ENSPANP00000000685 .............................................................................
hFl_ENSPANP00000001746 .............................................................................
hFl_ENSPANP00000005266 .............................................................................
hFl_ENSPANP00000011699 .............................................................................
hFl_ENSPANP00000001618 .............................................................................
hFl_ENSPANP00000010432 .............................................................................
hFl_ENSPANP00000019362 .............................................................................
hFl_ENSPANP00000005159 .............................................................................
hFl_ENSPANP00000011834 .............................................................................
hFl_ENSPANP00000004357 .............................................................................
hFl_ENSPANP00000010858 .............................................................................
hFl_ENSPANP00000010399 .............................................................................
hFl_ENSPANP00000004118 .............................................................................
hFl_ENSPANP00000010678 .............................................................................
hFl_ENSPANP00000008201 .............................................................................
hFl_ENSPANP00000000555 .............................................................................
hFl_ENSPANP00000014173 .............................................................................
hFl_ENSPANP00000002207 .............................................................................
hFl_ENSPANP00000001879 .............................................................................
hFl_ENSPANP00000005388 .............................................................................
hFl_ENSPANP00000002662 .............................................................................
hFl_ENSPANP00000009999 .............................................................................
hFl_ENSPANP00000004626 .............................................................................
hFl_ENSPANP00000006233 .............................................................................
hFl_ENSPANP00000002660 .............................................................................
hFl_ENSPANP00000011209 .............................................................................
hFl_ENSPANP00000020345 .............................................................................
hFl_ENSPANP00000020343 .............................................................................
hFl_ENSPANP00000008924 .............................................................................
hFl_ENSPANP00000015530 .............................................................................
hFl_ENSPANP00000008596 .............................................................................
hFl_ENSPANP00000002265 .............................................................................
hFl_ENSPANP00000014191 .............................................................................
hFl_ENSPANP00000012413 .............................................................................
hFl_ENSPANP00000007079 .............................................................................
hFl_ENSPANP00000012088 .............................................................................
hFl_ENSPANP00000020865 .............................................................................
hFl_ENSPANP00000003943 .............................................................................
hFl_ENSPANP00000005422 .............................................................................
hFl_ENSPANP00000015281 .............................................................................
hFl_ENSPANP00000017172 .............................................................................
hFl_ENSPANP00000014458 .............................................................................
hFl_ENSPANP00000008201 .............................................................................
hFl_ENSPANP00000004357 .............................................................................
hFl_ENSPANP00000004505 .............................................................................
hFl_ENSPANP00000012751 .............................................................................
hFl_ENSPANP00000001879 .............................................................................
hFl_ENSPANP00000001065 .............................................................................
hFl_ENSPANP00000009095 .............................................................................
hFl_ENSPANP00000013050 .............................................................................
hFl_ENSPANP00000013054 .............................................................................
hFl_ENSPANP00000014002 .............................................................................
hFl_ENSPANP00000008287 .............................................................................
hFl_ENSPANP00000016675 .............................................................................
hFl_ENSPANP00000013999 .............................................................................
hFl_ENSPANP00000003565 .............................................................................
hFl_ENSPANP00000018211 .............................................................................
hFl_ENSPANP00000010407 .............................................................................
hFl_ENSPANP00000016650 .............................................................................
hFl_ENSPANP00000001581 .............................................................................
hFl_ENSPANP00000016006 .............................................................................
hFl_ENSPANP00000015459 .............................................................................
hFl_ENSPANP00000014312 .............................................................................
hFl_ENSPANP00000010990 .............................................................................
hFl_ENSPANP00000002202 .............................................................................
hFl_ENSPANP00000007279 .............................................................................
hFl_ENSPANP00000011150 .............................................................................
hFl_ENSPANP00000008402 .............................................................................
hFl_ENSPANP00000018674 .............................................................................
hFl_ENSPANP00000002971 .............................................................................
hFl_ENSPANP00000002116 .............................................................................
hFl_ENSPANP00000014197 .............................................................................
hFl_ENSPANP00000012648 .............................................................................
hFl_ENSPANP00000020427 .............................................................................
hFl_ENSPANP00000013098 .............................................................................
hFl_ENSPANP00000010107 .............................................................................
hFl_ENSPANP00000010990 .............................................................................
hFl_ENSPANP00000001415 .............................................................................
hFl_ENSPANP00000013054 .............................................................................
hFl_ENSPANP00000009206 .............................................................................
hFl_ENSPANP00000001415 .............................................................................
hFl_ENSPANP00000004159 .............................................................................
hFl_ENSPANP00000013482 .............................................................................
hFl_ENSPANP00000018262 .............................................................................
hFl_ENSPANP00000005398 .............................................................................
hFl_ENSPANP00000014303 .............................................................................
hFl_ENSPANP00000012662 .............................................................................
hFl_ENSPANP00000005019 .............................................................................
hFl_ENSPANP00000014970 .............................................................................
hFl_ENSPANP00000006250 .............................................................................
hFl_ENSPANP00000011359 .............................................................................
hFl_ENSPANP00000013050 .............................................................................
hFl_ENSPANP00000013482 .............................................................................
hFl_ENSPANP00000018878 .............................................................................
hFl_ENSPANP00000002756 .............................................................................
hFl_ENSPANP00000018444 .............................................................................
hFl_ENSPANP00000004247 .............................................................................
hFl_ENSPANP00000006245 .............................................................................
hFl_ENSPANP00000016200 .............................................................................
hFl_ENSPANP00000013482 .............................................................................
hFl_ENSPANP00000003778 .............................................................................
hFl_ENSPANP00000017843 .............................................................................
hFl_ENSPANP00000013803 .............................................................................
hFl_ENSPANP00000008015 .............................................................................
hFl_ENSPANP00000001644 .............................................................................
hFl_ENSPANP00000007019 .............................................................................
hFl_ENSPANP00000001901 .............................................................................
hFl_ENSPANP00000000771 .............................................................................
hFl_ENSPANP00000019402 .............................................................................
hFl_ENSPANP00000006208 .............................................................................
hFl_ENSPANP00000003981 .............................................................................
hFl_ENSPANP00000018508 .............................................................................
hFl_ENSPANP00000009319 .............................................................................
hFl_ENSPANP00000002116 .............................................................................
hFl_ENSPANP00000012089 .............................................................................
hFl_ENSPANP00000016429 .............................................................................
hFl_ENSPANP00000006158 .............................................................................
hFl_ENSPANP00000001648 .............................................................................
hFl_ENSPANP00000016703 .............................................................................
hFl_ENSPANP00000013482 .............................................................................
hFl_ENSPANP00000001714 .............................................................................
hFl_ENSPANP00000001561 .............................................................................
hFl_ENSPANP00000011759 .............................................................................
hFl_ENSPANP00000016734 .............................................................................
hFl_ENSPANP00000009674 .............................................................................
hFl_ENSPANP00000007884 .............................................................................
hFl_ENSPANP00000002971 .............................................................................
hFl_ENSPANP00000015462 .............................................................................
hFl_ENSPANP00000005656 .............................................................................
hFl_ENSPANP00000009541 .............................................................................
hFl_ENSPANP00000008758 .............................................................................
hFl_ENSPANP00000003523 .............................................................................
hFl_ENSPANP00000018367 .............................................................................
hFl_ENSPANP00000007665 .............................................................................
hFl_ENSPANP00000011360 .............................................................................
hFl_ENSPANP00000005386 ferdffktrskeeiaeilcnigvklsdeefenvwnlaskkhhrgevcvenirnvl......................
hFl_ENSPANP00000009203 .............................................................................
hFl_ENSPANP00000003466 .............................................................................
hFl_ENSPANP00000017137 .............................................................................
hFl_ENSPANP00000013482 .............................................................................
hFl_ENSPANP00000002234 nlsqvevgkpspwlsvdtalyilkenesqanlqlvcftelrnrevfgwtgelgpgiywlipsttgcrlrkkinpvtd
hFl_ENSPANP00000003564 .............................................................................
hFl_ENSPANP00000010846 .............................................................................
hFl_ENSPANP00000017187 .............................................................................
hFl_ENSPANP00000008343 .............................................................................
hFl_ENSPANP00000002482 .............................................................................
hFl_ENSPANP00000010432 .............................................................................
hFl_ENSPANP00000017137 .............................................................................
hFl_ENSPANP00000005713 .............................................................................
hFl_ENSPANP00000002260 .............................................................................
hFl_ENSPANP00000007108 .............................................................................
hFl_ENSPANP00000010072 .............................................................................
hFl_ENSPANP00000002141 .............................................................................
hFl_ENSPANP00000010969 .............................................................................
hFl_ENSPANP00000016650 .............................................................................
hFl_ENSPANP00000017922 .............................................................................
hFl_ENSPANP00000011099 .............................................................................
hFl_ENSPANP00000005052 .............................................................................
hFl_ENSPANP00000001415 .............................................................................
hFl_ENSPANP00000011769 .............................................................................
hFl_ENSPANP00000009206 .............................................................................
hFl_ENSPANP00000001646 .............................................................................
hFl_ENSPANP00000020875 .............................................................................
hFl_ENSPANP00000000260 .............................................................................
hFl_ENSPANP00000020875 .............................................................................
hFl_ENSPANP00000005819 .............................................................................
hFl_ENSPANP00000013481 .............................................................................
hFl_ENSPANP00000016713 .............................................................................
hFl_ENSPANP00000003270 .............................................................................
hFl_ENSPANP00000020875 .............................................................................
hFl_ENSPANP00000019992 ntvctnergwityqgflsqwtlttyldvqrcleylgylgys....................................
hFl_ENSPANP00000020877 .............................................................................
hFl_ENSPANP00000017252 .............................................................................
hFl_ENSPANP00000012991 .............................................................................
hFl_ENSPANP00000016852 nasqsgssppqdwieeklqevcedlgitrdghlnrkklvsiceqyglqsvdgemleevfhnldpdgtmsvedffygl
hFl_ENSPANP00000000400 .............................................................................
hFl_ENSPANP00000000366 .............................................................................
hFl_ENSPANP00000014303 .............................................................................
hFl_ENSPANP00000005825 yhataavtsllleigevgklfvaqpakeggsggsgpschqgipgmlfpkkgpgqpyvvesveplpaslapdseehsl
hFl_ENSPANP00000007500 .............................................................................
hFl_ENSPANP00000000752 .............................................................................
hFl_ENSPANP00000008665 .............................................................................
hFl_ENSPANP00000019328 .............................................................................
hFl_ENSPANP00000020336 .............................................................................
hFl_ENSPANP00000002971 .............................................................................
hFl_ENSPANP00000020875 .............................................................................
hFl_ENSPANP00000015375 .............................................................................
hFl_ENSPANP00000013482 .............................................................................
hFl_ENSPANP00000001076 .............................................................................
hFl_ENSPANP00000017843 .............................................................................
hFl_ENSPANP00000006270 .............................................................................
hFl_ENSPANP00000002752 .............................................................................
hFl_ENSPANP00000010107 .............................................................................
hFl_ENSPANP00000007279 .............................................................................
hFl_ENSPANP00000018263 .............................................................................
hFl_ENSPANP00000013803 .............................................................................
hFl_ENSPANP00000011977 .............................................................................
hFl_ENSPANP00000006880 .............................................................................
hFl_ENSPANP00000008114 .............................................................................
hFl_ENSPANP00000009030 .............................................................................
hFl_ENSPANP00000016306 .............................................................................
hFl_ENSPANP00000019993 .............................................................................
hFl_ENSPANP00000000366 ventsvflenvrysipeekgitfdefrsffqflnnledfaialnmynfasrsigqdefkravyvatglklsphlvnt
hFl_ENSPANP00000018199 .............................................................................
hFl_ENSPANP00000020672 .............................................................................
hFl_ENSPANP00000008729 .............................................................................
hFl_ENSPANP00000006250 .............................................................................
hFl_ENSPANP00000011328 lfshspkkktefkravkvatgqelsnnildtvfkifdldgdeclsheeflgvlk.......................
hFl_ENSPANP00000012268 .............................................................................
hFl_ENSPANP00000018718 .............................................................................
hFl_ENSPANP00000010889 .............................................................................
hFl_ENSPANP00000020671 .............................................................................
hFl_ENSPANP00000011848 .............................................................................
hFl_ENSPANP00000020673 .............................................................................
hFl_ENSPANP00000006193 .............................................................................
hFl_ENSPANP00000015860 .............................................................................
hFl_ENSPANP00000003135 .............................................................................
hFl_ENSPANP00000008557 .............................................................................
hFl_ENSPANP00000014970 .............................................................................
hFl_ENSPANP00000009124 .............................................................................
hFl_ENSPANP00000003056 .............................................................................
hFl_ENSPANP00000013460 .............................................................................
hFl_ENSPANP00000016675 .............................................................................
hFl_ENSPANP00000016846 .............................................................................
hFl_ENSPANP00000011328 .............................................................................
hFl_ENSPANP00000004053 .............................................................................
hFl_ENSPANP00000017871 .............................................................................
hFl_ENSPANP00000004677 .............................................................................
hFl_ENSPANP00000018325 .............................................................................
hFl_ENSPANP00000016823 .............................................................................
hFl_ENSPANP00000016006 .............................................................................
hFl_ENSPANP00000018508 .............................................................................
hFl_ENSPANP00000018829 .............................................................................
hFl_ENSPANP00000016824 .............................................................................
hFl_ENSPANP00000010241 .............................................................................
hFl_ENSPANP00000002202 .............................................................................
hFl_ENSPANP00000020427 .............................................................................
hFl_ENSPANP00000020450 .............................................................................
hFl_ENSPANP00000019970 .............................................................................
hFl_ENSPANP00000017056 .............................................................................
hFl_ENSPANP00000012483 .............................................................................
hFl_ENSPANP00000017055 .............................................................................
hFl_ENSPANP00000009566 .............................................................................
hFl_ENSPANP00000013482 .............................................................................
hFl_ENSPANP00000007665 .............................................................................
hFl_ENSPANP00000018367 .............................................................................
hFl_ENSPANP00000012679 .............................................................................
hFl_ENSPANP00000012680 .............................................................................
hFl_ENSPANP00000008763 .............................................................................
hFl_ENSPANP00000019937 .............................................................................
hFl_ENSPANP00000012527 .............................................................................
hFl_ENSPANP00000008287 .............................................................................
hFl_ENSPANP00000004139 .............................................................................
hFl_ENSPANP00000004290 .............................................................................
hFl_ENSPANP00000020336 .............................................................................
hFl_ENSPANP00000003145 .............................................................................
hFl_ENSPANP00000017380 .............................................................................
hFl_ENSPANP00000019527 .............................................................................
hFl_ENSPANP00000016200 .............................................................................
hFl_ENSPANP00000013484 .............................................................................
hFl_ENSPANP00000019122 .............................................................................
hFl_ENSPANP00000011328 .............................................................................
hFl_ENSPANP00000005617 .............................................................................
hFl_ENSPANP00000011677 .............................................................................
hFl_ENSPANP00000002004 .............................................................................
hFl_ENSPANP00000005046 .............................................................................
hFl_ENSPANP00000020438 .............................................................................
hFl_ENSPANP00000020442 .............................................................................
hFl_ENSPANP00000016734 .............................................................................
hFl_ENSPANP00000008645 .............................................................................
hFl_ENSPANP00000003048 .............................................................................
hFl_ENSPANP00000001629 .............................................................................
hFl_ENSPANP00000007857 .............................................................................
hFl_ENSPANP00000012179 .............................................................................
hFl_ENSPANP00000020858 .............................................................................


                                                                                                    
                                                                                                    
d1sraa_                .............................................................................
hFl_ENSPANP00000005664 .............................................................................
hFl_ENSPANP00000015843 .............................................................................
hFl_ENSPANP00000018838 .............................................................................
hFl_ENSPANP00000000687 .............................................................................
hFl_ENSPANP00000011132 .............................................................................
hFl_ENSPANP00000011888 .............................................................................
hFl_ENSPANP00000012946 .............................................................................
hFl_ENSPANP00000015640 .............................................................................
hFl_ENSPANP00000008517 .............................................................................
hFl_ENSPANP00000017051 .............................................................................
hFl_ENSPANP00000008208 .............................................................................
hFl_ENSPANP00000000685 .............................................................................
hFl_ENSPANP00000001217 .............................................................................
hFl_ENSPANP00000009011 .............................................................................
hFl_ENSPANP00000016439 .............................................................................
hFl_ENSPANP00000020904 .............................................................................
hFl_ENSPANP00000011992 .............................................................................
hFl_ENSPANP00000011142 .............................................................................
hFl_ENSPANP00000008176 .............................................................................
hFl_ENSPANP00000016326 .............................................................................
hFl_ENSPANP00000005573 .............................................................................
hFl_ENSPANP00000018511 .............................................................................
hFl_ENSPANP00000007984 .............................................................................
hFl_ENSPANP00000009334 .............................................................................
hFl_ENSPANP00000011977 .............................................................................
hFl_ENSPANP00000006880 .............................................................................
hFl_ENSPANP00000016389 .............................................................................
hFl_ENSPANP00000017625 .............................................................................
hFl_ENSPANP00000020753 .............................................................................
hFl_ENSPANP00000011482 .............................................................................
hFl_ENSPANP00000008596 .............................................................................
hFl_ENSPANP00000014722 .............................................................................
hFl_ENSPANP00000010579 .............................................................................
hFl_ENSPANP00000018638 .............................................................................
hFl_ENSPANP00000007213 .............................................................................
hFl_ENSPANP00000001594 .............................................................................
hFl_ENSPANP00000002108 .............................................................................
hFl_ENSPANP00000007118 .............................................................................
hFl_ENSPANP00000006887 .............................................................................
hFl_ENSPANP00000020829 .............................................................................
hFl_ENSPANP00000004533 .............................................................................
hFl_ENSPANP00000005357 .............................................................................
hFl_ENSPANP00000014595 .............................................................................
hFl_ENSPANP00000019694 .............................................................................
hFl_ENSPANP00000012647 .............................................................................
hFl_ENSPANP00000011841 .............................................................................
hFl_ENSPANP00000007138 .............................................................................
hFl_ENSPANP00000005603 .............................................................................
hFl_ENSPANP00000003537 .............................................................................
hFl_ENSPANP00000016730 .............................................................................
hFl_ENSPANP00000004388 .............................................................................
hFl_ENSPANP00000004958 .............................................................................
hFl_ENSPANP00000017808 .............................................................................
hFl_ENSPANP00000006158 .............................................................................
hFl_ENSPANP00000000685 .............................................................................
hFl_ENSPANP00000001746 .............................................................................
hFl_ENSPANP00000005266 .............................................................................
hFl_ENSPANP00000011699 .............................................................................
hFl_ENSPANP00000001618 .............................................................................
hFl_ENSPANP00000010432 .............................................................................
hFl_ENSPANP00000019362 .............................................................................
hFl_ENSPANP00000005159 .............................................................................
hFl_ENSPANP00000011834 .............................................................................
hFl_ENSPANP00000004357 .............................................................................
hFl_ENSPANP00000010858 .............................................................................
hFl_ENSPANP00000010399 .............................................................................
hFl_ENSPANP00000004118 .............................................................................
hFl_ENSPANP00000010678 .............................................................................
hFl_ENSPANP00000008201 .............................................................................
hFl_ENSPANP00000000555 .............................................................................
hFl_ENSPANP00000014173 .............................................................................
hFl_ENSPANP00000002207 .............................................................................
hFl_ENSPANP00000001879 .............................................................................
hFl_ENSPANP00000005388 .............................................................................
hFl_ENSPANP00000002662 .............................................................................
hFl_ENSPANP00000009999 .............................................................................
hFl_ENSPANP00000004626 .............................................................................
hFl_ENSPANP00000006233 .............................................................................
hFl_ENSPANP00000002660 .............................................................................
hFl_ENSPANP00000011209 .............................................................................
hFl_ENSPANP00000020345 .............................................................................
hFl_ENSPANP00000020343 .............................................................................
hFl_ENSPANP00000008924 .............................................................................
hFl_ENSPANP00000015530 .............................................................................
hFl_ENSPANP00000008596 .............................................................................
hFl_ENSPANP00000002265 .............................................................................
hFl_ENSPANP00000014191 .............................................................................
hFl_ENSPANP00000012413 .............................................................................
hFl_ENSPANP00000007079 .............................................................................
hFl_ENSPANP00000012088 .............................................................................
hFl_ENSPANP00000020865 .............................................................................
hFl_ENSPANP00000003943 .............................................................................
hFl_ENSPANP00000005422 .............................................................................
hFl_ENSPANP00000015281 .............................................................................
hFl_ENSPANP00000017172 .............................................................................
hFl_ENSPANP00000014458 .............................................................................
hFl_ENSPANP00000008201 .............................................................................
hFl_ENSPANP00000004357 .............................................................................
hFl_ENSPANP00000004505 .............................................................................
hFl_ENSPANP00000012751 .............................................................................
hFl_ENSPANP00000001879 .............................................................................
hFl_ENSPANP00000001065 .............................................................................
hFl_ENSPANP00000009095 .............................................................................
hFl_ENSPANP00000013050 .............................................................................
hFl_ENSPANP00000013054 .............................................................................
hFl_ENSPANP00000014002 .............................................................................
hFl_ENSPANP00000008287 .............................................................................
hFl_ENSPANP00000016675 .............................................................................
hFl_ENSPANP00000013999 .............................................................................
hFl_ENSPANP00000003565 .............................................................................
hFl_ENSPANP00000018211 .............................................................................
hFl_ENSPANP00000010407 .............................................................................
hFl_ENSPANP00000016650 .............................................................................
hFl_ENSPANP00000001581 .............................................................................
hFl_ENSPANP00000016006 .............................................................................
hFl_ENSPANP00000015459 .............................................................................
hFl_ENSPANP00000014312 .............................................................................
hFl_ENSPANP00000010990 .............................................................................
hFl_ENSPANP00000002202 .............................................................................
hFl_ENSPANP00000007279 .............................................................................
hFl_ENSPANP00000011150 .............................................................................
hFl_ENSPANP00000008402 .............................................................................
hFl_ENSPANP00000018674 .............................................................................
hFl_ENSPANP00000002971 .............................................................................
hFl_ENSPANP00000002116 .............................................................................
hFl_ENSPANP00000014197 .............................................................................
hFl_ENSPANP00000012648 .............................................................................
hFl_ENSPANP00000020427 .............................................................................
hFl_ENSPANP00000013098 .............................................................................
hFl_ENSPANP00000010107 .............................................................................
hFl_ENSPANP00000010990 .............................................................................
hFl_ENSPANP00000001415 .............................................................................
hFl_ENSPANP00000013054 .............................................................................
hFl_ENSPANP00000009206 .............................................................................
hFl_ENSPANP00000001415 .............................................................................
hFl_ENSPANP00000004159 .............................................................................
hFl_ENSPANP00000013482 .............................................................................
hFl_ENSPANP00000018262 .............................................................................
hFl_ENSPANP00000005398 .............................................................................
hFl_ENSPANP00000014303 .............................................................................
hFl_ENSPANP00000012662 .............................................................................
hFl_ENSPANP00000005019 .............................................................................
hFl_ENSPANP00000014970 .............................................................................
hFl_ENSPANP00000006250 .............................................................................
hFl_ENSPANP00000011359 .............................................................................
hFl_ENSPANP00000013050 .............................................................................
hFl_ENSPANP00000013482 .............................................................................
hFl_ENSPANP00000018878 .............................................................................
hFl_ENSPANP00000002756 .............................................................................
hFl_ENSPANP00000018444 .............................................................................
hFl_ENSPANP00000004247 .............................................................................
hFl_ENSPANP00000006245 .............................................................................
hFl_ENSPANP00000016200 .............................................................................
hFl_ENSPANP00000013482 .............................................................................
hFl_ENSPANP00000003778 .............................................................................
hFl_ENSPANP00000017843 .............................................................................
hFl_ENSPANP00000013803 .............................................................................
hFl_ENSPANP00000008015 .............................................................................
hFl_ENSPANP00000001644 .............................................................................
hFl_ENSPANP00000007019 .............................................................................
hFl_ENSPANP00000001901 .............................................................................
hFl_ENSPANP00000000771 .............................................................................
hFl_ENSPANP00000019402 .............................................................................
hFl_ENSPANP00000006208 .............................................................................
hFl_ENSPANP00000003981 .............................................................................
hFl_ENSPANP00000018508 .............................................................................
hFl_ENSPANP00000009319 .............................................................................
hFl_ENSPANP00000002116 .............................................................................
hFl_ENSPANP00000012089 .............................................................................
hFl_ENSPANP00000016429 .............................................................................
hFl_ENSPANP00000006158 .............................................................................
hFl_ENSPANP00000001648 .............................................................................
hFl_ENSPANP00000016703 .............................................................................
hFl_ENSPANP00000013482 .............................................................................
hFl_ENSPANP00000001714 .............................................................................
hFl_ENSPANP00000001561 .............................................................................
hFl_ENSPANP00000011759 .............................................................................
hFl_ENSPANP00000016734 .............................................................................
hFl_ENSPANP00000009674 .............................................................................
hFl_ENSPANP00000007884 .............................................................................
hFl_ENSPANP00000002971 .............................................................................
hFl_ENSPANP00000015462 .............................................................................
hFl_ENSPANP00000005656 .............................................................................
hFl_ENSPANP00000009541 .............................................................................
hFl_ENSPANP00000008758 .............................................................................
hFl_ENSPANP00000003523 .............................................................................
hFl_ENSPANP00000018367 .............................................................................
hFl_ENSPANP00000007665 .............................................................................
hFl_ENSPANP00000011360 .............................................................................
hFl_ENSPANP00000005386 .............................................................................
hFl_ENSPANP00000009203 .............................................................................
hFl_ENSPANP00000003466 .............................................................................
hFl_ENSPANP00000017137 .............................................................................
hFl_ENSPANP00000013482 .............................................................................
hFl_ENSPANP00000002234 eaqlvyrdetgklfltkefkstlsdifevidldgngllsleeynffelrtsgekcdedawavcrdnfdtkrneltrq
hFl_ENSPANP00000003564 .............................................................................
hFl_ENSPANP00000010846 .............................................................................
hFl_ENSPANP00000017187 .............................................................................
hFl_ENSPANP00000008343 .............................................................................
hFl_ENSPANP00000002482 .............................................................................
hFl_ENSPANP00000010432 .............................................................................
hFl_ENSPANP00000017137 .............................................................................
hFl_ENSPANP00000005713 .............................................................................
hFl_ENSPANP00000002260 .............................................................................
hFl_ENSPANP00000007108 .............................................................................
hFl_ENSPANP00000010072 .............................................................................
hFl_ENSPANP00000002141 .............................................................................
hFl_ENSPANP00000010969 .............................................................................
hFl_ENSPANP00000016650 .............................................................................
hFl_ENSPANP00000017922 .............................................................................
hFl_ENSPANP00000011099 .............................................................................
hFl_ENSPANP00000005052 .............................................................................
hFl_ENSPANP00000001415 .............................................................................
hFl_ENSPANP00000011769 .............................................................................
hFl_ENSPANP00000009206 .............................................................................
hFl_ENSPANP00000001646 .............................................................................
hFl_ENSPANP00000020875 .............................................................................
hFl_ENSPANP00000000260 .............................................................................
hFl_ENSPANP00000020875 .............................................................................
hFl_ENSPANP00000005819 .............................................................................
hFl_ENSPANP00000013481 .............................................................................
hFl_ENSPANP00000016713 .............................................................................
hFl_ENSPANP00000003270 .............................................................................
hFl_ENSPANP00000020875 .............................................................................
hFl_ENSPANP00000019992 .............................................................................
hFl_ENSPANP00000020877 .............................................................................
hFl_ENSPANP00000017252 .............................................................................
hFl_ENSPANP00000012991 .............................................................................
hFl_ENSPANP00000016852 fk...........................................................................
hFl_ENSPANP00000000400 .............................................................................
hFl_ENSPANP00000000366 .............................................................................
hFl_ENSPANP00000014303 .............................................................................
hFl_ENSPANP00000005825 ggqmedikledssprdngacssmlisdddtkddssmssysvlsagsheedklhcedigedtvlvrsgqgtaalprst
hFl_ENSPANP00000007500 .............................................................................
hFl_ENSPANP00000000752 .............................................................................
hFl_ENSPANP00000008665 .............................................................................
hFl_ENSPANP00000019328 .............................................................................
hFl_ENSPANP00000020336 .............................................................................
hFl_ENSPANP00000002971 .............................................................................
hFl_ENSPANP00000020875 .............................................................................
hFl_ENSPANP00000015375 .............................................................................
hFl_ENSPANP00000013482 .............................................................................
hFl_ENSPANP00000001076 .............................................................................
hFl_ENSPANP00000017843 .............................................................................
hFl_ENSPANP00000006270 .............................................................................
hFl_ENSPANP00000002752 .............................................................................
hFl_ENSPANP00000010107 .............................................................................
hFl_ENSPANP00000007279 .............................................................................
hFl_ENSPANP00000018263 .............................................................................
hFl_ENSPANP00000013803 .............................................................................
hFl_ENSPANP00000011977 .............................................................................
hFl_ENSPANP00000006880 .............................................................................
hFl_ENSPANP00000008114 .............................................................................
hFl_ENSPANP00000009030 .............................................................................
hFl_ENSPANP00000016306 .............................................................................
hFl_ENSPANP00000019993 .............................................................................
hFl_ENSPANP00000000366 vfkifdvdkddqlsykefigimk......................................................
hFl_ENSPANP00000018199 .............................................................................
hFl_ENSPANP00000020672 .............................................................................
hFl_ENSPANP00000008729 .............................................................................
hFl_ENSPANP00000006250 .............................................................................
hFl_ENSPANP00000011328 .............................................................................
hFl_ENSPANP00000012268 .............................................................................
hFl_ENSPANP00000018718 .............................................................................
hFl_ENSPANP00000010889 .............................................................................
hFl_ENSPANP00000020671 .............................................................................
hFl_ENSPANP00000011848 .............................................................................
hFl_ENSPANP00000020673 .............................................................................
hFl_ENSPANP00000006193 .............................................................................
hFl_ENSPANP00000015860 .............................................................................
hFl_ENSPANP00000003135 .............................................................................
hFl_ENSPANP00000008557 .............................................................................
hFl_ENSPANP00000014970 .............................................................................
hFl_ENSPANP00000009124 .............................................................................
hFl_ENSPANP00000003056 .............................................................................
hFl_ENSPANP00000013460 .............................................................................
hFl_ENSPANP00000016675 .............................................................................
hFl_ENSPANP00000016846 .............................................................................
hFl_ENSPANP00000011328 .............................................................................
hFl_ENSPANP00000004053 .............................................................................
hFl_ENSPANP00000017871 .............................................................................
hFl_ENSPANP00000004677 .............................................................................
hFl_ENSPANP00000018325 .............................................................................
hFl_ENSPANP00000016823 .............................................................................
hFl_ENSPANP00000016006 .............................................................................
hFl_ENSPANP00000018508 .............................................................................
hFl_ENSPANP00000018829 .............................................................................
hFl_ENSPANP00000016824 .............................................................................
hFl_ENSPANP00000010241 .............................................................................
hFl_ENSPANP00000002202 .............................................................................
hFl_ENSPANP00000020427 .............................................................................
hFl_ENSPANP00000020450 .............................................................................
hFl_ENSPANP00000019970 .............................................................................
hFl_ENSPANP00000017056 .............................................................................
hFl_ENSPANP00000012483 .............................................................................
hFl_ENSPANP00000017055 .............................................................................
hFl_ENSPANP00000009566 .............................................................................
hFl_ENSPANP00000013482 .............................................................................
hFl_ENSPANP00000007665 .............................................................................
hFl_ENSPANP00000018367 .............................................................................
hFl_ENSPANP00000012679 .............................................................................
hFl_ENSPANP00000012680 .............................................................................
hFl_ENSPANP00000008763 .............................................................................
hFl_ENSPANP00000019937 .............................................................................
hFl_ENSPANP00000012527 .............................................................................
hFl_ENSPANP00000008287 .............................................................................
hFl_ENSPANP00000004139 .............................................................................
hFl_ENSPANP00000004290 .............................................................................
hFl_ENSPANP00000020336 .............................................................................
hFl_ENSPANP00000003145 .............................................................................
hFl_ENSPANP00000017380 .............................................................................
hFl_ENSPANP00000019527 .............................................................................
hFl_ENSPANP00000016200 .............................................................................
hFl_ENSPANP00000013484 .............................................................................
hFl_ENSPANP00000019122 .............................................................................
hFl_ENSPANP00000011328 .............................................................................
hFl_ENSPANP00000005617 .............................................................................
hFl_ENSPANP00000011677 .............................................................................
hFl_ENSPANP00000002004 .............................................................................
hFl_ENSPANP00000005046 .............................................................................
hFl_ENSPANP00000020438 .............................................................................
hFl_ENSPANP00000020442 .............................................................................
hFl_ENSPANP00000016734 .............................................................................
hFl_ENSPANP00000008645 .............................................................................
hFl_ENSPANP00000003048 .............................................................................
hFl_ENSPANP00000001629 .............................................................................
hFl_ENSPANP00000007857 .............................................................................
hFl_ENSPANP00000012179 .............................................................................
hFl_ENSPANP00000020858 .............................................................................


                                                   
                                                   
d1sraa_                ............................
hFl_ENSPANP00000005664 ............................
hFl_ENSPANP00000015843 ............................
hFl_ENSPANP00000018838 ............................
hFl_ENSPANP00000000687 ............................
hFl_ENSPANP00000011132 ............................
hFl_ENSPANP00000011888 ............................
hFl_ENSPANP00000012946 ............................
hFl_ENSPANP00000015640 ............................
hFl_ENSPANP00000008517 ............................
hFl_ENSPANP00000017051 ............................
hFl_ENSPANP00000008208 ............................
hFl_ENSPANP00000000685 ............................
hFl_ENSPANP00000001217 ............................
hFl_ENSPANP00000009011 ............................
hFl_ENSPANP00000016439 ............................
hFl_ENSPANP00000020904 ............................
hFl_ENSPANP00000011992 ............................
hFl_ENSPANP00000011142 ............................
hFl_ENSPANP00000008176 ............................
hFl_ENSPANP00000016326 ............................
hFl_ENSPANP00000005573 ............................
hFl_ENSPANP00000018511 ............................
hFl_ENSPANP00000007984 ............................
hFl_ENSPANP00000009334 ............................
hFl_ENSPANP00000011977 ............................
hFl_ENSPANP00000006880 ............................
hFl_ENSPANP00000016389 ............................
hFl_ENSPANP00000017625 ............................
hFl_ENSPANP00000020753 ............................
hFl_ENSPANP00000011482 ............................
hFl_ENSPANP00000008596 ............................
hFl_ENSPANP00000014722 ............................
hFl_ENSPANP00000010579 ............................
hFl_ENSPANP00000018638 ............................
hFl_ENSPANP00000007213 ............................
hFl_ENSPANP00000001594 ............................
hFl_ENSPANP00000002108 ............................
hFl_ENSPANP00000007118 ............................
hFl_ENSPANP00000006887 ............................
hFl_ENSPANP00000020829 ............................
hFl_ENSPANP00000004533 ............................
hFl_ENSPANP00000005357 ............................
hFl_ENSPANP00000014595 ............................
hFl_ENSPANP00000019694 ............................
hFl_ENSPANP00000012647 ............................
hFl_ENSPANP00000011841 ............................
hFl_ENSPANP00000007138 ............................
hFl_ENSPANP00000005603 ............................
hFl_ENSPANP00000003537 ............................
hFl_ENSPANP00000016730 ............................
hFl_ENSPANP00000004388 ............................
hFl_ENSPANP00000004958 ............................
hFl_ENSPANP00000017808 ............................
hFl_ENSPANP00000006158 ............................
hFl_ENSPANP00000000685 ............................
hFl_ENSPANP00000001746 ............................
hFl_ENSPANP00000005266 ............................
hFl_ENSPANP00000011699 ............................
hFl_ENSPANP00000001618 ............................
hFl_ENSPANP00000010432 ............................
hFl_ENSPANP00000019362 ............................
hFl_ENSPANP00000005159 ............................
hFl_ENSPANP00000011834 ............................
hFl_ENSPANP00000004357 ............................
hFl_ENSPANP00000010858 ............................
hFl_ENSPANP00000010399 ............................
hFl_ENSPANP00000004118 ............................
hFl_ENSPANP00000010678 ............................
hFl_ENSPANP00000008201 ............................
hFl_ENSPANP00000000555 ............................
hFl_ENSPANP00000014173 ............................
hFl_ENSPANP00000002207 ............................
hFl_ENSPANP00000001879 ............................
hFl_ENSPANP00000005388 ............................
hFl_ENSPANP00000002662 ............................
hFl_ENSPANP00000009999 ............................
hFl_ENSPANP00000004626 ............................
hFl_ENSPANP00000006233 ............................
hFl_ENSPANP00000002660 ............................
hFl_ENSPANP00000011209 ............................
hFl_ENSPANP00000020345 ............................
hFl_ENSPANP00000020343 ............................
hFl_ENSPANP00000008924 ............................
hFl_ENSPANP00000015530 ............................
hFl_ENSPANP00000008596 ............................
hFl_ENSPANP00000002265 ............................
hFl_ENSPANP00000014191 ............................
hFl_ENSPANP00000012413 ............................
hFl_ENSPANP00000007079 ............................
hFl_ENSPANP00000012088 ............................
hFl_ENSPANP00000020865 ............................
hFl_ENSPANP00000003943 ............................
hFl_ENSPANP00000005422 ............................
hFl_ENSPANP00000015281 ............................
hFl_ENSPANP00000017172 ............................
hFl_ENSPANP00000014458 ............................
hFl_ENSPANP00000008201 ............................
hFl_ENSPANP00000004357 ............................
hFl_ENSPANP00000004505 ............................
hFl_ENSPANP00000012751 ............................
hFl_ENSPANP00000001879 ............................
hFl_ENSPANP00000001065 ............................
hFl_ENSPANP00000009095 ............................
hFl_ENSPANP00000013050 ............................
hFl_ENSPANP00000013054 ............................
hFl_ENSPANP00000014002 ............................
hFl_ENSPANP00000008287 ............................
hFl_ENSPANP00000016675 ............................
hFl_ENSPANP00000013999 ............................
hFl_ENSPANP00000003565 ............................
hFl_ENSPANP00000018211 ............................
hFl_ENSPANP00000010407 ............................
hFl_ENSPANP00000016650 ............................
hFl_ENSPANP00000001581 ............................
hFl_ENSPANP00000016006 ............................
hFl_ENSPANP00000015459 ............................
hFl_ENSPANP00000014312 ............................
hFl_ENSPANP00000010990 ............................
hFl_ENSPANP00000002202 ............................
hFl_ENSPANP00000007279 ............................
hFl_ENSPANP00000011150 ............................
hFl_ENSPANP00000008402 ............................
hFl_ENSPANP00000018674 ............................
hFl_ENSPANP00000002971 ............................
hFl_ENSPANP00000002116 ............................
hFl_ENSPANP00000014197 ............................
hFl_ENSPANP00000012648 ............................
hFl_ENSPANP00000020427 ............................
hFl_ENSPANP00000013098 ............................
hFl_ENSPANP00000010107 ............................
hFl_ENSPANP00000010990 ............................
hFl_ENSPANP00000001415 ............................
hFl_ENSPANP00000013054 ............................
hFl_ENSPANP00000009206 ............................
hFl_ENSPANP00000001415 ............................
hFl_ENSPANP00000004159 ............................
hFl_ENSPANP00000013482 ............................
hFl_ENSPANP00000018262 ............................
hFl_ENSPANP00000005398 ............................
hFl_ENSPANP00000014303 ............................
hFl_ENSPANP00000012662 ............................
hFl_ENSPANP00000005019 ............................
hFl_ENSPANP00000014970 ............................
hFl_ENSPANP00000006250 ............................
hFl_ENSPANP00000011359 ............................
hFl_ENSPANP00000013050 ............................
hFl_ENSPANP00000013482 ............................
hFl_ENSPANP00000018878 ............................
hFl_ENSPANP00000002756 ............................
hFl_ENSPANP00000018444 ............................
hFl_ENSPANP00000004247 ............................
hFl_ENSPANP00000006245 ............................
hFl_ENSPANP00000016200 ............................
hFl_ENSPANP00000013482 ............................
hFl_ENSPANP00000003778 ............................
hFl_ENSPANP00000017843 ............................
hFl_ENSPANP00000013803 ............................
hFl_ENSPANP00000008015 ............................
hFl_ENSPANP00000001644 ............................
hFl_ENSPANP00000007019 ............................
hFl_ENSPANP00000001901 ............................
hFl_ENSPANP00000000771 ............................
hFl_ENSPANP00000019402 ............................
hFl_ENSPANP00000006208 ............................
hFl_ENSPANP00000003981 ............................
hFl_ENSPANP00000018508 ............................
hFl_ENSPANP00000009319 ............................
hFl_ENSPANP00000002116 ............................
hFl_ENSPANP00000012089 ............................
hFl_ENSPANP00000016429 ............................
hFl_ENSPANP00000006158 ............................
hFl_ENSPANP00000001648 ............................
hFl_ENSPANP00000016703 ............................
hFl_ENSPANP00000013482 ............................
hFl_ENSPANP00000001714 ............................
hFl_ENSPANP00000001561 ............................
hFl_ENSPANP00000011759 ............................
hFl_ENSPANP00000016734 ............................
hFl_ENSPANP00000009674 ............................
hFl_ENSPANP00000007884 ............................
hFl_ENSPANP00000002971 ............................
hFl_ENSPANP00000015462 ............................
hFl_ENSPANP00000005656 ............................
hFl_ENSPANP00000009541 ............................
hFl_ENSPANP00000008758 ............................
hFl_ENSPANP00000003523 ............................
hFl_ENSPANP00000018367 ............................
hFl_ENSPANP00000007665 ............................
hFl_ENSPANP00000011360 ............................
hFl_ENSPANP00000005386 ............................
hFl_ENSPANP00000009203 ............................
hFl_ENSPANP00000003466 ............................
hFl_ENSPANP00000017137 ............................
hFl_ENSPANP00000013482 ............................
hFl_ENSPANP00000002234 gfmdlnlme...................
hFl_ENSPANP00000003564 ............................
hFl_ENSPANP00000010846 ............................
hFl_ENSPANP00000017187 ............................
hFl_ENSPANP00000008343 ............................
hFl_ENSPANP00000002482 ............................
hFl_ENSPANP00000010432 ............................
hFl_ENSPANP00000017137 ............................
hFl_ENSPANP00000005713 ............................
hFl_ENSPANP00000002260 ............................
hFl_ENSPANP00000007108 ............................
hFl_ENSPANP00000010072 ............................
hFl_ENSPANP00000002141 ............................
hFl_ENSPANP00000010969 ............................
hFl_ENSPANP00000016650 ............................
hFl_ENSPANP00000017922 ............................
hFl_ENSPANP00000011099 ............................
hFl_ENSPANP00000005052 ............................
hFl_ENSPANP00000001415 ............................
hFl_ENSPANP00000011769 ............................
hFl_ENSPANP00000009206 ............................
hFl_ENSPANP00000001646 ............................
hFl_ENSPANP00000020875 ............................
hFl_ENSPANP00000000260 ............................
hFl_ENSPANP00000020875 ............................
hFl_ENSPANP00000005819 ............................
hFl_ENSPANP00000013481 ............................
hFl_ENSPANP00000016713 ............................
hFl_ENSPANP00000003270 ............................
hFl_ENSPANP00000020875 ............................
hFl_ENSPANP00000019992 ............................
hFl_ENSPANP00000020877 ............................
hFl_ENSPANP00000017252 ............................
hFl_ENSPANP00000012991 ............................
hFl_ENSPANP00000016852 ............................
hFl_ENSPANP00000000400 ............................
hFl_ENSPANP00000000366 ............................
hFl_ENSPANP00000014303 ............................
hFl_ENSPANP00000005825 sldrdwaitfeqflaslltepalvkyfd
hFl_ENSPANP00000007500 ............................
hFl_ENSPANP00000000752 ............................
hFl_ENSPANP00000008665 ............................
hFl_ENSPANP00000019328 ............................
hFl_ENSPANP00000020336 ............................
hFl_ENSPANP00000002971 ............................
hFl_ENSPANP00000020875 ............................
hFl_ENSPANP00000015375 ............................
hFl_ENSPANP00000013482 ............................
hFl_ENSPANP00000001076 ............................
hFl_ENSPANP00000017843 ............................
hFl_ENSPANP00000006270 ............................
hFl_ENSPANP00000002752 ............................
hFl_ENSPANP00000010107 ............................
hFl_ENSPANP00000007279 ............................
hFl_ENSPANP00000018263 ............................
hFl_ENSPANP00000013803 ............................
hFl_ENSPANP00000011977 ............................
hFl_ENSPANP00000006880 ............................
hFl_ENSPANP00000008114 ............................
hFl_ENSPANP00000009030 ............................
hFl_ENSPANP00000016306 ............................
hFl_ENSPANP00000019993 ............................
hFl_ENSPANP00000000366 ............................
hFl_ENSPANP00000018199 ............................
hFl_ENSPANP00000020672 ............................
hFl_ENSPANP00000008729 ............................
hFl_ENSPANP00000006250 ............................
hFl_ENSPANP00000011328 ............................
hFl_ENSPANP00000012268 ............................
hFl_ENSPANP00000018718 ............................
hFl_ENSPANP00000010889 ............................
hFl_ENSPANP00000020671 ............................
hFl_ENSPANP00000011848 ............................
hFl_ENSPANP00000020673 ............................
hFl_ENSPANP00000006193 ............................
hFl_ENSPANP00000015860 ............................
hFl_ENSPANP00000003135 ............................
hFl_ENSPANP00000008557 ............................
hFl_ENSPANP00000014970 ............................
hFl_ENSPANP00000009124 ............................
hFl_ENSPANP00000003056 ............................
hFl_ENSPANP00000013460 ............................
hFl_ENSPANP00000016675 ............................
hFl_ENSPANP00000016846 ............................
hFl_ENSPANP00000011328 ............................
hFl_ENSPANP00000004053 ............................
hFl_ENSPANP00000017871 ............................
hFl_ENSPANP00000004677 ............................
hFl_ENSPANP00000018325 ............................
hFl_ENSPANP00000016823 ............................
hFl_ENSPANP00000016006 ............................
hFl_ENSPANP00000018508 ............................
hFl_ENSPANP00000018829 ............................
hFl_ENSPANP00000016824 ............................
hFl_ENSPANP00000010241 ............................
hFl_ENSPANP00000002202 ............................
hFl_ENSPANP00000020427 ............................
hFl_ENSPANP00000020450 ............................
hFl_ENSPANP00000019970 ............................
hFl_ENSPANP00000017056 ............................
hFl_ENSPANP00000012483 ............................
hFl_ENSPANP00000017055 ............................
hFl_ENSPANP00000009566 ............................
hFl_ENSPANP00000013482 ............................
hFl_ENSPANP00000007665 ............................
hFl_ENSPANP00000018367 ............................
hFl_ENSPANP00000012679 ............................
hFl_ENSPANP00000012680 ............................
hFl_ENSPANP00000008763 ............................
hFl_ENSPANP00000019937 ............................
hFl_ENSPANP00000012527 ............................
hFl_ENSPANP00000008287 ............................
hFl_ENSPANP00000004139 ............................
hFl_ENSPANP00000004290 ............................
hFl_ENSPANP00000020336 ............................
hFl_ENSPANP00000003145 ............................
hFl_ENSPANP00000017380 ............................
hFl_ENSPANP00000019527 ............................
hFl_ENSPANP00000016200 ............................
hFl_ENSPANP00000013484 ............................
hFl_ENSPANP00000019122 ............................
hFl_ENSPANP00000011328 ............................
hFl_ENSPANP00000005617 ............................
hFl_ENSPANP00000011677 ............................
hFl_ENSPANP00000002004 ............................
hFl_ENSPANP00000005046 ............................
hFl_ENSPANP00000020438 ............................
hFl_ENSPANP00000020442 ............................
hFl_ENSPANP00000016734 ............................
hFl_ENSPANP00000008645 ............................
hFl_ENSPANP00000003048 ............................
hFl_ENSPANP00000001629 ............................
hFl_ENSPANP00000007857 ............................
hFl_ENSPANP00000012179 ............................
hFl_ENSPANP00000020858 ............................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0043728 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Bathycoccus prasinos
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Cyanidioschyzon merolae strain 10D 22
NoYes   Cyanidioschyzon merolae
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Giardia lamblia 2.3
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Ichthyophthirius multifiliis strain G5
NoYes   Cryptosporidium hominis
NoYes   Cryptosporidium muris
NoYes   Cryptosporidium parvum Iowa II
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Babesia bovis T2Bo
NoYes   Theileria parva
NoYes   Theileria annulata
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Plasmodium yoelii ssp. yoelii 1
NoYes   Plasmodium chabaudi
NoYes   Plasmodium berghei ANKA
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Leptolyngbya sp. PCC 7376
NoYes   Acaryochloris marina MBIC11017
NoYes   Synechocystis sp. PCC 6803
NoYes   Thermosynechococcus sp. NK55
NoYes   Thermosynechococcus elongatus BP-1
NoYes   Synechococcus sp. PCC 7502
NoYes   Synechococcus sp. PCC 6312
NoYes   Synechococcus sp. CC9311
NoYes   Synechococcus elongatus PCC 7942
NoYes   Microcoleus sp. PCC 7113
NoYes   Trichodesmium erythraeum IMS101
NoYes   Geitlerinema sp. PCC 7407
NoYes   Cyanothece sp. PCC 8802
NoYes   cyanobacterium UCYN-A
NoYes   Microcystis aeruginosa NIES-843
NoYes   Gloeobacter violaceus PCC 7421
NoYes   Rivularia sp. PCC 7116
NoYes   Calothrix sp. PCC 7507
NoYes   Anabaena variabilis ATCC 29413
NoYes   Nostoc sp. PCC 7107
NoYes   Nostoc punctiforme PCC 73102
NoYes   Nostoc sp. PCC 7120
NoYes   Mycoplasma wenyonii str. Massachusetts
NoYes   Slackia heliotrinireducens DSM 20476
NoYes   Catenulispora acidiphila DSM 44928
NoYes   Stackebrandtia nassauensis DSM 44728
NoYes   Frankia symbiont of Datisca glomerata
NoYes   Thermobifida fusca YX
NoYes   Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111
NoYes   Thermomonospora curvata DSM 43183
NoYes   Streptosporangium roseum DSM 43021
NoYes   Kitasatospora setae KM-6054
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces sp. PAMC26508
NoYes   Streptomyces flavogriseus ATCC 33331
NoYes   Streptomyces sp. SirexAA-E
NoYes   Streptomyces griseus subsp. griseus NBRC 13350
NoYes   Streptomyces bingchenggensis BCW-1
NoYes   Streptomyces violaceusniger Tu 4113
NoYes   Streptomyces avermitilis MA-4680
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces scabiei 87.22
NoYes   Streptomyces hygroscopicus subsp. jinggangensis 5008
NoYes   Actinosynnema mirum DSM 43827
NoYes   Saccharopolyspora erythraea NRRL 2338
NoYes   Amycolatopsis mediterranei U32
NoYes   Actinoplanes sp. N902-109
NoYes   Deinococcus deserti VCD115
NoYes   Ruminococcus albus 7
NoYes   Oscillibacter valericigenes Sjm18-20
NoYes   Desulfotomaculum acetoxidans DSM 771
NoYes   Desulfotomaculum ruminis DSM 2154
NoYes   Bacillus weihenstephanensis KBAB4
NoYes   Bacillus thuringiensis str. Al Hakam
NoYes   Bacillus cereus 03BB102
NoYes   Bacillus anthracis str. A0248
NoYes   Staphylococcus pseudintermedius HKU10-03
NoYes   Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305
NoYes   Staphylococcus lugdunensis HKU09-01
NoYes   Staphylococcus haemolyticus JCSC1435
NoYes   Staphylococcus carnosus subsp. carnosus TM300
NoYes   Staphylococcus aureus subsp. aureus JH1
NoYes   Saprospira grandis str. Lewin
NoYes   Chitinophaga pinensis DSM 2588
NoYes   Krokinobacter sp. 4H-3-7-5
NoYes   Lacinutrix sp. 5H-3-7-4
NoYes   Maribacter sp. HTCC2170
NoYes   Zobellia galactanivorans
NoYes   Cellulophaga algicola DSM 14237
NoYes   Cellulophaga lytica DSM 7489
NoYes   Polaribacter sp. MED152
NoYes   Planctomyces brasiliensis DSM 5305
NoYes   Planctomyces limnophilus DSM 3776
NoYes   Rhodopirellula baltica SH 1
NoYes   Pirellula staleyi DSM 6068
NoYes   Coraliomargarita akajimensis DSM 45221
NoYes   Opitutus terrae PB90-1
NoYes   Akkermansia muciniphila ATCC BAA-835
NoYes   Turneriella parva DSM 21527
NoYes   Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'
NoYes   Denitrovibrio acetiphilus DSM 12809
NoYes   Candidatus Solibacter usitatus Ellin6076
NoYes   Terriglobus saanensis SP1PR4
NoYes   Terriglobus roseus DSM 18391
NoYes   Thermodesulfovibrio yellowstonii DSM 11347
NoYes   Candidatus Methylomirabilis oxyfera
NoYes   Bdellovibrio bacteriovorus HD100
NoYes   Sulfurospirillum deleyianum DSM 6946
NoYes   Sulfurospirillum barnesii SES-3
NoYes   Arcobacter sp. L
NoYes   Arcobacter nitrofigilis DSM 7299
NoYes   Arcobacter butzleri RM4018
NoYes   Campylobacter concisus 13826
NoYes   uncultured Sulfuricurvum sp. RIFRC-1
NoYes   Sulfuricurvum kujiense DSM 16994
NoYes   Sulfurimonas denitrificans DSM 1251
NoYes   Wolinella succinogenes DSM 1740
NoYes   Helicobacter cinaedi PAGU611
NoYes   Desulfarculus baarsii DSM 2075
NoYes   Desulfobacca acetoxidans DSM 11109
NoYes   Syntrophobacter fumaroxidans MPOB
NoYes   Desulfotalea psychrophila LSv54
NoYes   Desulfatibacillum alkenivorans AK-01
NoYes   Desulfobacterium autotrophicum HRM2
NoYes   Desulfovibrio piezophilus
NoYes   Desulfovibrio aespoeensis Aspo-2
NoYes   Lawsonia intracellularis PHE/MN1-00
NoYes   Desulfovibrio magneticus RS-1
NoYes   Desulfovibrio alaskensis G20
NoYes   Desulfovibrio vulgaris subsp. vulgaris DP4
NoYes   Desulfovibrio salexigens DSM 2638
NoYes   Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774
NoYes   Desulfovibrio africanus str. Walvis Bay
NoYes   Geobacter lovleyi SZ
NoYes   Geobacter sulfurreducens KN400
NoYes   Pelobacter propionicus DSM 2379
NoYes   Pelobacter carbinolicus DSM 2380
NoYes   Haliangium ochraceum DSM 14365
NoYes   Sorangium cellulosum 'So ce 56'
NoYes   Stigmatella aurantiaca DW4/3-1
NoYes   Myxococcus xanthus DK 1622
NoYes   Myxococcus fulvus HW-1
NoYes   Dechloromonas aromatica RCB
NoYes   Azoarcus sp. KH32C
NoYes   Pandoraea sp. RB-44
NoYes   Azoarcus sp. BH72
NoYes   Aromatoleum aromaticum EbN1
NoYes   Dechlorosoma suillum PS
NoYes   Pseudogulbenkiania sp. NH8B
NoYes   Laribacter hongkongensis HLHK9
NoYes   beta proteobacterium CB
NoYes   Methylibium petroleiphilum PM1
NoYes   Rubrivivax gelatinosus IL144
NoYes   Burkholderia phytofirmans PsJN
NoYes   Burkholderia phymatum STM815
NoYes   Burkholderia xenovorans LB400
NoYes   Ralstonia eutropha JMP134
NoYes   Cupriavidus taiwanensis LMG 19424
NoYes   Cupriavidus metallidurans CH34
NoYes   Cupriavidus necator N-1
NoYes   Ralstonia eutropha H16
NoYes   Ralstonia pickettii 12D
NoYes   Ralstonia solanacearum CFBP2957
NoYes   Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1
NoYes   Burkholderia sp. RPE64
NoYes   Burkholderia sp. CCGE1002
NoYes   Burkholderia ambifaria AMMD
NoYes   Burkholderia cenocepacia HI2424
NoYes   Burkholderia multivorans ATCC 17616
NoYes   Burkholderia vietnamiensis G4
NoYes   Burkholderia gladioli BSR3
NoYes   Verminephrobacter eiseniae EF01-2
NoYes   Ramlibacter tataouinensis TTB310
NoYes   Delftia sp. Cs1-4
NoYes   Delftia acidovorans SPH-1
NoYes   Polaromonas sp. JS666
NoYes   Polaromonas naphthalenivorans CJ2
NoYes   Acidovorax ebreus TPSY
NoYes   Acidovorax sp. KKS102
NoYes   Acidovorax sp. JS42
NoYes   Acidovorax citrulli AAC00-1
NoYes   Acidovorax avenae subsp. avenae ATCC 19860
NoYes   Comamonas testosteroni CNB-2
NoYes   Pusillimonas sp. T7-7
NoYes   Advenella kashmirensis WT001
NoYes   Bordetella avium 197N
NoYes   Bordetella parapertussis 12822
NoYes   Bordetella bronchiseptica RB50
NoYes   Achromobacter xylosoxidans
NoYes   Thiobacillus denitrificans ATCC 25259
NoYes   Nitrosospira multiformis ATCC 25196
NoYes   Nitrosomonas sp. Is79A3
NoYes   Sideroxydans lithotrophicus ES-1
NoYes   Gallionella capsiferriformans ES-2
NoYes   Methylotenera versatilis 301
NoYes   Methylotenera mobilis JLW8
NoYes   Methylovorus sp. MP688
NoYes   Methylovorus glucosetrophus SIP3-4
NoYes   Methylobacillus flagellatus KT
NoYes   Magnetococcus marinus MC-1
NoYes   Parvularcula bermudensis HTCC2503
NoYes   Asticcacaulis excentricus CB 48
NoYes   Brevundimonas subvibrioides ATCC 15264
NoYes   Caulobacter sp. K31
NoYes   Caulobacter crescentus NA1000
NoYes   Caulobacter segnis ATCC 21756
NoYes   Phenylobacterium zucineum HLK1
NoYes   Erythrobacter litoralis HTCC2594
NoYes   Sphingopyxis alaskensis RB2256
NoYes   Novosphingobium sp. PP1Y
NoYes   Novosphingobium aromaticivorans DSM 12444
NoYes   Sphingobium sp. SYK-6
NoYes   Sphingobium japonicum UT26S
NoYes   Sphingobium chlorophenolicum L-1
NoYes   Sphingomonas sp. MM-1
NoYes   Sphingomonas wittichii RW1
NoYes   Zymomonas mobilis subsp. mobilis NCIMB 11163
NoYes   Maricaulis maris MCS10
NoYes   Hirschia baltica ATCC 49814
NoYes   Hyphomonas neptunium ATCC 15444
NoYes   Dinoroseobacter shibae DFL 12
NoYes   Phaeobacter gallaeciensis 2.10
NoYes   Pseudovibrio sp. FO-BEG1
NoYes   Jannaschia sp. CCS1
NoYes   Ruegeria sp. TM1040
NoYes   Ruegeria pomeroyi DSS-3
NoYes   Ketogulonicigenium vulgare Y25
NoYes   Ketogulonigenium vulgarum WSH-001
NoYes   Roseobacter litoralis Och 149
NoYes   Roseobacter denitrificans OCh 114
NoYes   Rhodobacter sphaeroides ATCC 17029
NoYes   Rhodobacter capsulatus SB 1003
NoYes   Rhodospirillum photometricum DSM 122
NoYes   Tistrella mobilis KA081020-065
NoYes   Magnetospirillum magneticum AMB-1
NoYes   Rhodospirillum centenum SW
NoYes   Rhodospirillum rubrum F11
NoYes   Azospirillum lipoferum 4B
NoYes   Azospirillum brasilense Sp245
NoYes   Granulibacter bethesdensis CGDNIH1
NoYes   Acetobacter pasteurianus IFO 3283-01
NoYes   Polymorphum gilvum SL003B-26A1
NoYes   Micavibrio aeruginosavorus ARL-13
NoYes   Candidatus Puniceispirillum marinum IMCC1322
NoYes   Candidatus Pelagibacter sp. IMCC9063
NoYes   Xanthobacter autotrophicus Py2
NoYes   Methylobacterium chloromethanicum CM4
NoYes   Methylobacterium extorquens AM1
NoYes   Methylobacterium sp. 4-46
NoYes   Methylobacterium populi BJ001
NoYes   Methylobacterium nodulans ORS 2060
NoYes   Methylobacterium radiotolerans JCM 2831
NoYes   Parvibaculum lavamentivorans DS-1
NoYes   Ochrobactrum anthropi ATCC 49188
NoYes   Brucella microti CCM 4915
NoYes   Brucella pinnipedialis B2/94
NoYes   Brucella canis ATCC 23365
NoYes   Brucella suis ATCC 23445
NoYes   Brucella melitensis ATCC 23457
NoYes   Brucella ovis ATCC 25840
NoYes   Brucella abortus S19
NoYes   Sinorhizobium fredii NGR234
NoYes   Sinorhizobium medicae WSM419
NoYes   Sinorhizobium meliloti AK83
NoYes   Genome sequence of Rhizobium sp. strain IRBG74
NoYes   Rhizobium etli CIAT 652
NoYes   Rhizobium leguminosarum bv. viciae 3841
NoYes   Agrobacterium tumefaciens str. C58
NoYes   Agrobacterium radiobacter K84
NoYes   Agrobacterium sp. H13-3
NoYes   Agrobacterium vitis S4
NoYes   Mesorhizobium sp. BNC1
NoYes   Mesorhizobium opportunistum WSM2075
NoYes   Mesorhizobium ciceri biovar biserrulae WSM1271
NoYes   Mesorhizobium loti MAFF303099
NoYes   Methylocella silvestris BL2
NoYes   Beijerinckia indica subsp. indica ATCC 9039
NoYes   Pelagibacterium halotolerans B2
NoYes   Rhodomicrobium vannielii ATCC 17100
NoYes   Hyphomicrobium sp. MC1
NoYes   Hyphomicrobium denitrificans ATCC 51888
NoYes   Oligotropha carboxidovorans OM4
NoYes   Rhodopseudomonas palustris BisA53
NoYes   Bradyrhizobium japonicum USDA 110
NoYes   Bradyrhizobium sp. ORS 278
NoYes   Methylocystis sp. SC2
NoYes   Saccharophagus degradans 2-40
NoYes   Teredinibacter turnerae T7901
NoYes   Cellvibrio japonicus Ueda107
NoYes   Tolumonas auensis DSM 9187
NoYes   Vibrio furnissii NCTC 11218
NoYes   Psychromonas ingrahamii 37
NoYes   Shewanella halifaxensis HAW-EB4
NoYes   Shewanella sediminis HAW-EB3
NoYes   Shewanella woodyi ATCC 51908
NoYes   Shewanella frigidimarina NCIMB 400
NoYes   Colwellia psychrerythraea 34H
NoYes   Pseudoalteromonas sp. SM9913
NoYes   Pseudoalteromonas atlantica T6c
NoYes   Pseudoalteromonas haloplanktis TAC125
NoYes   Glaciecola sp. 4H-3-7+YE-5
NoYes   Glaciecola nitratireducens FR1064
NoYes   Alteromonas sp. SN2
NoYes   Alteromonas macleodii str. 'Deep ecotype'
NoYes   Kangiella koreensis DSM 16069
NoYes   Hahella chejuensis KCTC 2396
NoYes   Marinomonas mediterranea MMB-1
NoYes   Halomonas elongata DSM 2581
NoYes   Methylomicrobium alcaliphilum
NoYes   Methylomonas methanica MC09
NoYes   Rhodanobacter denitrificans
NoYes   Pseudoxanthomonas spadix BD-a59
NoYes   Pseudoxanthomonas suwonensis 11-1
NoYes   Stenotrophomonas maltophilia K279a
NoYes   Xylella fastidiosa M23
NoYes   Xanthomonas axonopodis pv. citri str. 306
NoYes   Xanthomonas albilineans GPE PC73
NoYes   Xanthomonas oryzae pv. oryzae PXO99A
NoYes   Xanthomonas campestris pv. campestris str. B100
NoYes   Spiribacter sp. UAH-SP71
NoYes   Allochromatium vinosum DSM 180
NoYes   Thiocystis violascens DSM 198
NoYes   Nitrosococcus watsonii C-113
NoYes   Nitrosococcus halophilus Nc4
NoYes   Nitrosococcus oceani ATCC 19707
NoYes   gamma proteobacterium HdN1
NoYes   Azotobacter vinelandii DJ
NoYes   Pseudomonas sp. TKP
NoYes   Pseudomonas sp. UW4
NoYes   Pseudomonas brassicacearum subsp. brassicacearum NFM421
NoYes   Pseudomonas entomophila L48
NoYes   Pseudomonas putida F1
NoYes   Pseudomonas protegens Pf-5
NoYes   Pseudomonas sp. VLB120
NoYes   Acinetobacter oleivorans DR1
NoYes   Acinetobacter calcoaceticus PHEA-2
NoYes   Thiomicrospira crunogena XCL-2
NoYes   Francisella noatunensis subsp. orientalis str. Toba 04
NoYes   Francisella philomiragia subsp. philomiragia ATCC 25017
NoYes   Francisella tularensis subsp. tularensis WY96-3418
NoYes   Francisella novicida U112
NoYes   Pyrobaculum sp. 1860
NoYes   Thermoproteus uzoniensis 768-20
NoYes   Methanohalobium evestigatum Z-7303
NoYes   Thermococcus gammatolerans EJ3
NoYes   Haloquadratum walsbyi DSM 16790
NoYes   Methanobrevibacter sp. AbM4
NoYes   Methanobrevibacter ruminantium M1
NoYes   Methanobrevibacter smithii ATCC 35061
NoYes   Aciduliprofundum boonei T469
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Cryptococcus neoformans var. grubii H99
NoYes   Cryptococcus neoformans B-3501A
NoYes   Cryptococcus neoformans JEC21
NoYes   Paracoccidioides brasiliensis Pb01
NoYes   Paracoccidioides brasiliensis Pb03
NoYes   Coccidioides posadasii str. Silveira
NoYes   Coccidioides immitis RMSCC 3703
NoYes   Coccidioides immitis RMSCC 2394
NoYes   Coccidioides immitis H538.4
NoYes   Ajellomyces dermatitidis ER-3
NoYes   Histoplasma capsulatum H143
NoYes   Histoplasma capsulatum H88
NoYes   Histoplasma capsulatum G186AR
NoYes   Aspergillus fumigatus A1163
NoYes   Candida albicans WO-1
NoYes   Saccharomyces cerevisiae UC5
NoYes   Saccharomyces cerevisiae PW5
NoYes   Saccharomyces cerevisiae FL100
NoYes   Saccharomyces cerevisiae CLIB324
NoYes   Saccharomyces cerevisiae CBS7960
NoYes   Saccharomyces cerevisiae YJM269
NoYes   Saccharomyces cerevisiae T7
NoYes   Saccharomyces cerevisiae FostersB
NoYes   Saccharomyces cerevisiae FostersO
NoYes   Saccharomyces cerevisiae VL3
NoYes   Saccharomyces cerevisiae Vin13
NoYes   Saccharomyces cerevisiae LalvinQA23
NoYes   Saccharomyces cerevisiae AWRI796
NoYes   Saccharomyces cerevisiae Sigma1278b
NoYes   Saccharomyces cerevisiae W303
NoYes   Saccharomyces cerevisiae JAY291
NoYes   Saccharomyces cerevisiae AWRI1631
NoYes   Saccharomyces cerevisiae YPS163
NoYes   Saccharomyces cerevisiae M22
NoYes   Saccharomyces cerevisiae T73
NoYes   Saccharomyces cerevisiae CLIB215
NoYes   Saccharomyces cerevisiae Y10
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae SGD - Baker's yeast
NoYes   Schizosaccharomyces pombe 972h-
NoYes   Batrachochytrium dendrobatidis JEL423
NoYes   Batrachochytrium dendrobatidis JAM81
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Trypanosoma brucei Lister 427 v4.1
NoYes   Neospora caninum Nc-Liverpool 6.2
NoYes   Plasmodium falciparum HB3
NoYes   Plasmodium falciparum Dd2
NoYes   Synechocystis sp. PCC 6803 substr. PCC-P
NoYes   Synechocystis sp. PCC 6803 substr. PCC-N
NoYes   Synechocystis sp. PCC 6803 substr. GT-I
NoYes   Synechocystis sp. PCC 6803
NoYes   Cyanobium gracile PCC 6307
NoYes   Synechococcus sp. JA-2-3B'a(2-13)
NoYes   Synechococcus sp. JA-3-3Ab
NoYes   Synechococcus sp. CC9902
NoYes   Synechococcus sp. RCC307
NoYes   Synechococcus sp. CC9605
NoYes   Synechococcus sp. WH 8102
NoYes   Synechococcus sp. WH 7803
NoYes   Synechococcus elongatus PCC 6301
NoYes   Prochlorococcus marinus str. AS9601
NoYes   Prochlorococcus marinus str. MIT 9313
NoYes   Prochlorococcus marinus str. MIT 9303
NoYes   Crinalium epipsammum PCC 9333
NoYes   Oscillatoria nigro-viridis PCC 7112
NoYes   Cyanothece sp. PCC 7822
NoYes   Cyanothece sp. PCC 7425
NoYes   Cyanothece sp. PCC 7424
NoYes   Cyanothece sp. ATCC 51142
NoYes   Cyanothece sp. PCC 8801
NoYes   Cyanobacterium aponinum PCC 10605
NoYes   Cyanobacterium stanieri PCC 7202
NoYes   Pleurocapsa minor Pleurocapsa sp. PCC 7327
NoYes   Calothrix parietina Calothrix sp. PCC 6303
NoYes   Cylindrospermum stagnale PCC 7417
NoYes   Mycoplasma ovis str. Michigan
NoYes   Mycoplasma cynos C142
NoYes   Candidatus Mycoplasma haemolamae str. Purdue
NoYes   Nocardiopsis alba ATCC BAA-2165
NoYes   Streptomyces albus J1074
NoYes   Streptomyces rapamycinicus NRRL 5491
NoYes   Streptomyces davawensis JCM 4913
NoYes   Streptomyces fulvissimus DSM 40593
NoYes   Streptomyces venezuelae ATCC 10712
NoYes   Streptomyces collinus Tu 365
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces hygroscopicus subsp. jinggangensis TL01
NoYes   Saccharothrix espanaensis DSM 44229
NoYes   Amycolatopsis mediterranei RB
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis orientalis HCCB10007
NoYes   Nocardia brasiliensis ATCC 700358
NoYes   Deinococcus peraridilitoris DSM 19664
NoYes   Thermacetogenium phaeum DSM 12270
NoYes   Streptococcus oligofermentans AS 1.3089
NoYes   Exiguobacterium antarcticum B7
NoYes   Bacillus toyonensis BCT-7112
NoYes   Bacillus thuringiensis HD-771
NoYes   Bacillus thuringiensis HD-789
NoYes   Bacillus thuringiensis MC28
NoYes   Bacillus thuringiensis YBT-1518
NoYes   Bacillus thuringiensis Bt407
NoYes   Bacillus thuringiensis BMB171
NoYes   Bacillus thuringiensis serovar finitimus YBT-020
NoYes   Bacillus thuringiensis serovar thuringiensis str. IS5056
NoYes   Bacillus cereus FRI-35
NoYes   Bacillus cereus biovar anthracis str. CI
NoYes   Bacillus cereus AH820
NoYes   Bacillus cereus AH187
NoYes   Bacillus cereus B4264
NoYes   Bacillus cereus Q1
NoYes   Bacillus cereus F837/76
NoYes   Bacillus cereus NC7401
NoYes   Bacillus cereus E33L
NoYes   Bacillus cereus ATCC 14579
NoYes   Bacillus cereus ATCC 10987
NoYes   Bacillus anthracis str. H9401
NoYes   Bacillus anthracis str. CDC 684
NoYes   Bacillus anthracis str. 'Ames Ancestor'
NoYes   Bacillus anthracis str. Sterne
NoYes   Bacillus anthracis str. Ames
NoYes   Staphylococcus aureus subsp. aureus MSHR1132
NoYes   Staphylococcus pseudintermedius ED99
NoYes   Staphylococcus pasteuri SP1
NoYes   Staphylococcus lugdunensis N920143
NoYes   Staphylococcus warneri SG1
NoYes   Staphylococcus epidermidis ATCC 12228
NoYes   Staphylococcus aureus CA-347
NoYes   Staphylococcus aureus Bmb9393
NoYes   Staphylococcus aureus M1
NoYes   Staphylococcus aureus 08BA02176
NoYes   Staphylococcus aureus 04-02981
NoYes   Staphylococcus aureus RF122
NoYes   Staphylococcus aureus subsp. aureus Z172
NoYes   Staphylococcus aureus subsp. aureus 6850
NoYes   Staphylococcus aureus subsp. aureus SA957
NoYes   Staphylococcus aureus subsp. aureus SA40
NoYes   Staphylococcus aureus subsp. aureus 11819-97
NoYes   Staphylococcus aureus subsp. aureus M013
NoYes   Staphylococcus aureus subsp. aureus HO 5096 0412
NoYes   Staphylococcus aureus subsp. aureus VC40
NoYes   Staphylococcus aureus subsp. aureus T0131
NoYes   Staphylococcus aureus subsp. aureus LGA251
NoYes   Staphylococcus aureus subsp. aureus ECT-R 2
NoYes   Staphylococcus aureus subsp. aureus JKD6159
NoYes   Staphylococcus aureus subsp. aureus ED133
NoYes   Staphylococcus aureus subsp. aureus ED98
NoYes   Staphylococcus aureus subsp. aureus TW20
NoYes   Staphylococcus aureus subsp. aureus str. JKD6008
NoYes   Staphylococcus aureus subsp. aureus S0385
NoYes   Staphylococcus aureus subsp. aureus Mu3
NoYes   Staphylococcus aureus subsp. aureus USA300_TCH1516
NoYes   Staphylococcus aureus subsp. aureus USA300_FPR3757
NoYes   Staphylococcus aureus subsp. aureus JH9
NoYes   Staphylococcus aureus subsp. aureus MSSA476
NoYes   Staphylococcus aureus subsp. aureus MRSA252
NoYes   Staphylococcus aureus subsp. aureus MW2
NoYes   Staphylococcus aureus subsp. aureus N315
NoYes   Staphylococcus aureus subsp. aureus Mu50
NoYes   Staphylococcus aureus subsp. aureus COL
NoYes   Staphylococcus aureus subsp. aureus NCTC 8325
NoYes   Nonlabens dokdonensis DSW-6
NoYes   Singulisphaera acidiphila DSM 18658
NoYes   Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'
NoYes   Bdellovibrio exovorus JSS
NoYes   Bdellovibrio bacteriovorus str. Tiberius
NoYes   Arcobacter butzleri 7h1h
NoYes   Desulfocapsa sulfexigens DSM 10523
NoYes   Lawsonia intracellularis N343
NoYes   Desulfovibrio hydrothermalis AM13 = DSM 14728
NoYes   Desulfovibrio vulgaris RCH1
NoYes   Desulfovibrio vulgaris str. 'Miyazaki F'
NoYes   Desulfovibrio vulgaris str. Hildenborough
NoYes   Desulfovibrio gigas DSM 1382 = ATCC 19364
NoYes   Desulfovibrio desulfuricans ND132
NoYes   Geobacter sulfurreducens PCA
NoYes   Sorangium cellulosum So0157-2
NoYes   Myxococcus stipitatus DSM 14675
NoYes   Burkholderia phenoliruptrix BR3459a
NoYes   Pandoraea pnomenusa 3kgm
NoYes   Ralstonia pickettii 12J
NoYes   Ralstonia solanacearum FQY_4
NoYes   Ralstonia solanacearum Po82
NoYes   Ralstonia solanacearum PSI07
NoYes   Ralstonia solanacearum CMR15
NoYes   Ralstonia solanacearum GMI1000
NoYes   Burkholderia sp. YI23
NoYes   Burkholderia sp. CCGE1003
NoYes   Burkholderia sp. CCGE1001
NoYes   Burkholderia sp. KJ006
NoYes   Burkholderia thailandensis MSMB121
NoYes   Burkholderia lata
NoYes   Burkholderia ambifaria MC40-6
NoYes   Burkholderia cenocepacia MC0-3
NoYes   Burkholderia cenocepacia AU 1054
NoYes   Burkholderia cenocepacia J2315
NoYes   Burkholderia multivorans ATCC 17616
NoYes   Burkholderia cepacia GG4
NoYes   Candidatus Symbiobacter mobilis Comamonadaceae bacterium CR
NoYes   Variovorax paradoxus B4
NoYes   Bordetella parapertussis Bpp5
NoYes   Bordetella bronchiseptica MO149
NoYes   Bordetella bronchiseptica 253
NoYes   Achromobacter xylosoxidans NBRC 15126 = ATCC 27061
NoYes   Nitrosomonas sp. AL212
NoYes   Sulfuricella denitrificans skB26
NoYes   Caulobacter crescentus CB15
NoYes   Zymomonas mobilis subsp. mobilis ATCC 29191
NoYes   Zymomonas mobilis subsp. mobilis CP4
NoYes   Zymomonas mobilis subsp. mobilis ATCC 10988
NoYes   Zymomonas mobilis subsp. mobilis ZM4
NoYes   Zymomonas mobilis subsp. pomaceae ATCC 29192
NoYes   Phaeobacter gallaeciensis DSM 17395
NoYes   Phaeobacter gallaeciensis DSM 26640
NoYes   Leisingera methylohalidivorans DSM 14336
NoYes   Octadecabacter antarcticus 307
NoYes   Octadecabacter arcticus 238
NoYes   Rhodobacter sphaeroides KD131
NoYes   Rhodobacter sphaeroides ATCC 17025
NoYes   Rhodobacter sphaeroides 2.4.1
NoYes   Paracoccus aminophilus JCM 7686
NoYes   Magnetospirillum gryphiswaldense MSR-1 v2
NoYes   Rhodospirillum rubrum ATCC 11170
NoYes   Gluconobacter oxydans H24
NoYes   Acetobacter pasteurianus 386B
NoYes   Acetobacter pasteurianus IFO 3283-12
NoYes   Acetobacter pasteurianus IFO 3283-01-42C
NoYes   Acetobacter pasteurianus IFO 3283-32
NoYes   Acetobacter pasteurianus IFO 3283-26
NoYes   Acetobacter pasteurianus IFO 3283-22
NoYes   Acetobacter pasteurianus IFO 3283-07
NoYes   Acetobacter pasteurianus IFO 3283-03
NoYes   Micavibrio aeruginosavorus EPB
NoYes   Methylobacterium extorquens DM4
NoYes   Methylobacterium extorquens PA1
NoYes   Brucella ceti TE10759-12
NoYes   Brucella ceti TE28753-12
NoYes   Brucella canis HSK A52141
NoYes   Brucella suis VBI22
NoYes   Brucella suis 1330
NoYes   Brucella suis 1330
NoYes   Brucella melitensis bv. 1 str. 16M
NoYes   Brucella melitensis biovar Abortus 2308
NoYes   Brucella abortus bv. 1 str. 9-941
NoYes   Sinorhizobium fredii USDA 257
NoYes   Sinorhizobium fredii HH103
NoYes   Sinorhizobium meliloti 2011
NoYes   Sinorhizobium meliloti GR4
NoYes   Sinorhizobium meliloti Rm41
NoYes   Sinorhizobium meliloti SM11
NoYes   Sinorhizobium meliloti BL225C
NoYes   Sinorhizobium meliloti 1021
NoYes   Rhizobium etli CFN 42
NoYes   Rhizobium etli bv. mimosae str. Mim1
NoYes   Rhizobium tropici CIAT 899
NoYes   Rhizobium leguminosarum bv. trifolii WSM2304
NoYes   Rhizobium leguminosarum bv. trifolii WSM1325
NoYes   Mesorhizobium australicum WSM2073
NoYes   Hyphomicrobium nitrativorans NL23
NoYes   Hyphomicrobium denitrificans 1NES1
NoYes   Oligotropha carboxidovorans OM5
NoYes   Oligotropha carboxidovorans OM5
NoYes   Rhodopseudomonas palustris DX-1
NoYes   Rhodopseudomonas palustris TIE-1
NoYes   Rhodopseudomonas palustris HaA2
NoYes   Rhodopseudomonas palustris BisB5
NoYes   Rhodopseudomonas palustris BisB18
NoYes   Rhodopseudomonas palustris CGA009
NoYes   Bradyrhizobium sp. S23321
NoYes   Bradyrhizobium sp. BTAi1
NoYes   Bradyrhizobium oligotrophicum S58
NoYes   Bradyrhizobium japonicum USDA 6
NoYes   Simiduia agarivorans SA1 = DSM 21679
NoYes   Vibrio sp. EJY3
NoYes   Glaciecola psychrophila 170
NoYes   Alteromonas macleodii str. 'Ionian Sea UM4b'
NoYes   Alteromonas macleodii str. 'Ionian Sea UM7'
NoYes   Alteromonas macleodii str. 'Ionian Sea U8'
NoYes   Alteromonas macleodii str. 'Ionian Sea U7'
NoYes   Alteromonas macleodii str. 'Ionian Sea U4'
NoYes   Alteromonas macleodii str. 'Aegean Sea MED64'
NoYes   Alteromonas macleodii str. 'English Channel 615'
NoYes   Alteromonas macleodii AltDE1
NoYes   Alteromonas macleodii str. 'English Channel 673'
NoYes   Alteromonas macleodii str. 'Balearic Sea AD45'
NoYes   Alteromonas macleodii str. 'Black Sea 11'
NoYes   Alteromonas macleodii ATCC 27126
NoYes   Thalassolituus oleivorans MIL-1
NoYes   Stenotrophomonas maltophilia D457
NoYes   Stenotrophomonas maltophilia JV3
NoYes   Stenotrophomonas maltophilia R551-3
NoYes   Xylella fastidiosa subsp. fastidiosa GB514
NoYes   Xylella fastidiosa M12
NoYes   Xylella fastidiosa Temecula1
NoYes   Xylella fastidiosa 9a5c
NoYes   Xanthomonas citri subsp. citri Aw12879
NoYes   Xanthomonas campestris pv. vesicatoria str. 85-10
NoYes   Xanthomonas axonopodis pv. citrumelo F1
NoYes   Xanthomonas axonopodis Xac29-1
NoYes   Xanthomonas oryzae pv. oryzicola BLS256
NoYes   Xanthomonas oryzae pv. oryzae MAFF 311018
NoYes   Xanthomonas oryzae pv. oryzae KACC 10331
NoYes   Xanthomonas campestris pv. raphani 756C
NoYes   Xanthomonas campestris pv. campestris str. 8004
NoYes   Xanthomonas campestris pv. campestris str. ATCC 33913
NoYes   Thioflavicoccus mobilis 8321
NoYes   Dickeya dadantii 3937
NoYes   Azotobacter vinelandii CA6
NoYes   Azotobacter vinelandii CA
NoYes   Pseudomonas denitrificans ATCC 13867
NoYes   Pseudomonas syringae pv. phaseolicola 1448A
NoYes   Pseudomonas syringae pv. syringae B728a
NoYes   Pseudomonas monteilii SB3101
NoYes   Pseudomonas monteilii SB3078
NoYes   Pseudomonas putida HB3267
NoYes   Pseudomonas putida NBRC 14164
NoYes   Pseudomonas putida DOT-T1E
NoYes   Pseudomonas putida S16
NoYes   Pseudomonas putida BIRD-1
NoYes   Pseudomonas putida W619
NoYes   Pseudomonas putida ND6
NoYes   Pseudomonas putida KT2440
NoYes   Pseudomonas putida GB-1
NoYes   Pseudomonas protegens CHA0
NoYes   Pseudomonas fluorescens F113
NoYes   Pseudomonas fluorescens R124
NoYes   Pseudomonas fluorescens Pf0-1
NoYes   Pseudomonas resinovorans NBRC 106553
NoYes   Pseudomonas aeruginosa SCV20265
NoYes   Pseudomonas aeruginosa LES431
NoYes   Pseudomonas aeruginosa RP73
NoYes   Pseudomonas aeruginosa PA1R
NoYes   Pseudomonas aeruginosa PA1
NoYes   Pseudomonas aeruginosa DK2
NoYes   Pseudomonas aeruginosa M18
NoYes   Pseudomonas aeruginosa LESB58
NoYes   Pseudomonas aeruginosa PA7
NoYes   Pseudomonas aeruginosa PAO1
NoYes   Acinetobacter genomosp. 13TU RUH2624
NoYes   Acinetobacter sp. SH024
NoYes   Acinetobacter calcoaceticus ruh2202
NoYes   Francisella noatunensis subsp. orientalis LADL--07-285A
NoYes   Francisella tularensis subsp. holarctica F92
NoYes   Francisella tularensis subsp. holarctica FTNF002-00
NoYes   Francisella tularensis subsp. holarctica OSU18
NoYes   Francisella tularensis subsp. holarctica LVS
NoYes   Francisella tularensis subsp. holarctica FSC200
NoYes   Francisella tularensis subsp. tularensis TIGB03
NoYes   Francisella tularensis subsp. tularensis TI0902
NoYes   Francisella tularensis subsp. tularensis NE061598
NoYes   Francisella tularensis subsp. tularensis FSC198
NoYes   Francisella tularensis subsp. tularensis SCHU S4
NoYes   Francisella cf. novicida Fx1
NoYes   Archaeoglobus sulfaticallidus PM70-1
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Caenorhabditis elegans 69_215 - Roundworm
NoYes   Saccharomyces cerevisiae 69_4 - Baker's yeast
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Heliconius numata
NoYes   Loa loa v3.3 - Eye worm
NoYes   Wuchereria bancrofti v1.0 - Agent of lymphatic filariasis
NoYes   Brugia malayi v1.0 - Agent of lymphatic filariasis
NoYes   Moniliophthora perniciosa FA553
NoYes   Encephalitozoon intestinalis
NoYes   Encephalitozoon cuniculi
NoYes   Picea sitchensis - Sitka spruce
NoYes   Lotus japonicus
NoYes   Malus x domestica - Apple
NoYes   Ricinus communis - Castor bean
NoYes   Nicotiana benthamiana 0.4.4
NoYes   Solanum pimpinellifolium A-1.0 - Currant tomato
NoYes   Solanum lycopersicum v2.3 - Tomato
NoYes   Phoenix dactylifera - Date palm
NoYes   1_050719N (meta-genome)
NoYes   1_Upper_euphotic (meta-genome)
NoYes   2_050719S (meta-genome)
NoYes   3_Below_base_of_euphotic (meta-genome)
NoYes   4_050719Q (meta-genome)
NoYes   4_Deep_abyss (meta-genome)
NoYes   5_050719P (meta-genome)
NoYes   5_Below_upper_mesopelagic (meta-genome)
NoYes   6_Upper_euphotic (meta-genome)
NoYes   7_Oxygen_minimum_layer (meta-genome)
NoYes   Activated sludge plasmid pool Morges-2009 (Newbler) (meta-genome)
NoYes   Activated sludge plasmid pool Visp-2009 (Newbler) (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 1 (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 2 (meta-genome)
NoYes   Atta cephalotes fungus garden (ACEF) (meta-genome)
NoYes   Combined (meta-genome)
NoYes   Cyphomyrmex longiscapus fungus garden (meta-genome)
NoYes   Dendroctonus ponderosae beetle community (MPB hybrid beetle) (Lodgepole pine) (meta-genome)
NoYes   Dendroctonus ponderosae fungus gallery (Hybrid pine) (MPB hybrid gallery) (meta-genome)
NoYes   Dump bottom (Dump bottom) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #1 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #2 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #3 (meta-genome)
NoYes   Freshwater propionate enrichment of Brocadia fulgida (meta-genome)
NoYes   Fungus garden combined (combined) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden bottom (Fungus garden bottom) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden top (meta-genome)
NoYes   Groundwater dechlorinating community (KB-1) from synthetic mineral medium in Toronto, ON, sample from Site contaminated with chlorinated ethenes
NoYes   Guerrero Negro salt ponds hypersaline mat 01(G) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 02(H) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 03(I) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 04(N) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 05(O) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 06(P) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 07(S) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 08(T) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 09(Y) (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP8 from OSP Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP11 from Octopus Springs (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP15 from Mushroom Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP16 from Fairy Spring Red Layer (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP17 from Obsidian Pool Prime (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP18 from Washburn Springs #1 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP20 from Bath Lake Vista Annex - Purple-Sulfur Mats (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP5 from Bath Lake Vista Annex (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP7 from Chocolate Pots (meta-genome)
NoYes   Human Gut Community Subject 7 (meta-genome)
NoYes   Human Gut Community Subject 8 (meta-genome)
NoYes   Macropus eugenii forestomach microbiome from Canberra, Australia, sample Macropus_eugenii_combined (meta-genome)
NoYes   Maize field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing corn (Zea may (meta-genome)
NoYes   Maize rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Soil sample from rhizosphere of corn (Zea mays))< (meta-genome)
NoYes   Marine anammox bioreactor enriched for Scalindua species (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formaldehyde enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formate enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methane enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methanol enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methylamine enrichment (meta-genome)
NoYes   Miscanthus field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing Miscanthu (meta-genome)
NoYes   Miscanthus rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample of Miscanthus x giga (meta-genome)
NoYes   Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine (MPB hybrid beetle) (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   Olavius algarvensis endosymbiont metagenome Delta1 (meta-genome)
NoYes   Olavius algarvensis endosymbiont metagenome Delta4 (meta-genome)
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   simHC - Simulated High Complexity Metagenome (meta-genome)
NoYes   simLC - Simulated Low Complexity Metagenome (meta-genome)
NoYes   simMC - Simulated Medium Complexity Metagenome (meta-genome)
NoYes   Sludge/Australian, Phrap Assembly (meta-genome)
NoYes   Sludge/US, Jazz Assembly (meta-genome)
NoYes   Sludge/US, Phrap Assembly (meta-genome)
NoYes   Soil microbial communities from Minnesota Farm (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- (Maryland Estuary ambient) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 4 Nevada Test Site Crust CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+ (Oak Ridge elevated CO2) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- (Oak Ridge ambient) (meta-genome)
NoYes   Soil microbial community from bioreactor at Alameda Naval Air Station, CA, contaminated with Chloroethene, Sample 196 (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing switchgr (meta-genome)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Switchgrass soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample from switchgrass (Panicum virg (meta-genome)
NoYes   Termite Protist Endosymbiont Community (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Uranium Contaminated Groundwater FW106 (meta-genome)
NoYes   Wastewater Terephthalate-degrading communities from Bioreactor (meta-genome)
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   NCBI viral sequences (Viral)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   UniProt viral sequences (Viral)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]