SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Calponin-homology domain, CH-domain alignments in Takifugu rubripes 69_4

These alignments are sequences aligned to the 0042512 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                             10        20        30        40        50        60   
                                              |         |         |         |         |         |   
d1pxya_               ..............s-EKGPFVQHINRYLGDDPFLKQFLPLDPHSNQLYELVKDGVLLCKLINVAVPGTIDERAINTK
ENSTRUP00000035696  ............fseEERFAFVNWINTALEKDPDCQHVLPMDPNTDSLFKAVGDGIVLCKMINLSVPDTIDERTINKK
ENSTRUP00000035893  ............ysdEEKVAFVNWINKALVKDPECQHLLPMNPNDESLFTSVRDGILLCKMINLSQPDTIDERVINTK
ENSTRUP00000025762  .....itqqyshint---------------------------------------------------------------
ENSTRUP00000042730  ..qyndinnrwdlaa---------------------------------------------------------------
ENSTRUP00000030656  ..qyssidtvnnrwd---------------------------------------------------------------
ENSTRUP00000030008  ............rwd---------------------------------------------------------------
ENSTRUP00000010095  gfwetectssklfec---------------------------------------------------------------
ENSTRUP00000011270  ............eew---------------------------------------------------------------
ENSTRUP00000024799  .............wd---------------------------------------------------------------
ENSTRUP00000013924  ..............d---------------------------------------------------------------
ENSTRUP00000028024  ..............d---------------------------------------------------------------
ENSTRUP00000008717  ...............---------------------------------------------------------------
ENSTRUP00000039658  ......lqayedvle---------------------------------------------------------------
ENSTRUP00000013131  ...............---------------------------------------------------------------
ENSTRUP00000004371  ...........ivtc---------------------------------------------------------------
ENSTRUP00000043448  ..............t---------------------------------------------------------------
ENSTRUP00000012084  .............la---------------------------------------------------------------
ENSTRUP00000016429  ........ianvmqk---------------------------------------------------------------
ENSTRUP00000046695  ............sye---------------------------------------------------------------
ENSTRUP00000046505  ...............---------------------------------------------------------------
ENSTRUP00000014890  ..............v---------------------------------------------------------------
ENSTRUP00000035684  ............yseEEKVAFVNWINKALEKDGDCKHVLPMDPANNDLFTAMGDGIVLCKMINLSVADTIDERTINKK
ENSTRUP00000031038  .............vr---------------------------------------------------------------
ENSTRUP00000006363  ............rra---------ACQLFTSDAMVKAIQRLELEVEAKRLLVRKDRHLWKDIGE------------RK
ENSTRUP00000014209  ..............e---------------------------------------------------------------
ENSTRUP00000008835  ..............l---------------------------------------------------------------
ENSTRUP00000015270  ............pss------------------------PKSPTPKSPSSRKKDDSFLGKLGGTLA---------RRK
ENSTRUP00000042384  .........ttsanm---------------------------------HRMKKDESFLGKLGGTLV---------RKK
ENSTRUP00000043381  ...............---------------------------------------------------------------
ENSTRUP00000023374  ..mavnvyatsvsvd---------------------------------------------------------------
ENSTRUP00000012594  .malnvfstsmtien---------------------------------------------------------------
ENSTRUP00000019118  ......mavnvysts---------------------------------------------------------------
ENSTRUP00000024584  ...............---------------------------------------------------------------
ENSTRUP00000013241  ...malnvfstsmtt---------------------------------------------------------------
ENSTRUP00000025142  ............hfr---------------------------------------------------------------
ENSTRUP00000004604  ..............s---------------------------------------------------------------
ENSTRUP00000004605  ..............s---------------------------------------------------------------
ENSTRUP00000004542  ..............v---------------------------------------------------------------
ENSTRUP00000030785  ...............EYWRQCAMWLISCNVLPKNHRVVAD-RAQVFDLAQTLRDGVLLCQLLNNLRPHTINLKEINLR
ENSTRUP00000019057  ...............---------------------------------------------------------------
ENSTRUP00000034885  ...............ELWRQCAAWLIECRVLPDNHRVTWE-NAQVCDLAQALRDGVLLCQLLNNLLPQAVNLREINLR
ENSTRUP00000019101  ............nll-----------VALVGDSLLEPFWPMGTGIARGFLAAMDSGWMVR------------------
ENSTRUP00000034912  ..qqnmayeylchle---------------------------------------------------------------
ENSTRUP00000012578  ..rqniayeylchle---------------------------------------------------------------
ENSTRUP00000010581  .......svqksppa---------------------------------------------------------------
ENSTRUP00000011154  .....vayqylcrle---------------------------------------------------------------
ENSTRUP00000027452  .............gh--------QLLVTLVGDSLLEPFWPMGTGIARGFLAALDSAWMVR------------------
ENSTRUP00000013071  ..............k--------KLLTALVGDCLVEPFWPLGTGIARGFLASFDTAWMVRSWGLGVPHL---------
ENSTRUP00000040442  ..............a---------------------------------------------------------------
ENSTRUP00000027304  ..........rsqsf---------------------------------------------------------------
ENSTRUP00000004552  ...............---------------------------------------------------------------
ENSTRUP00000016124  .............hq---------LVVALVGDSLLEPFWPMGTGCARGFLAAFDTAWMVR------------------
ENSTRUP00000040427  ...............---------------------------------------------------------------
ENSTRUP00000039399  .............gs---------------------------------------------------------------
ENSTRUP00000024074  ...............---------------------------------------------------------------
ENSTRUP00000034507  ..............a---------------------------------------------------------------
ENSTRUP00000044828  ..............r-----FGHQLLVALVGDSLLEPFWPMGTGCARGFLAAFDTAWMVN------------------
ENSTRUP00000026384  ..............k---------------------------------------------------------------
ENSTRUP00000030647  .....srheasllpm---------------------------------------------------------------
ENSTRUP00000030455  ..........sqsfg---------------------------------------------------------------
ENSTRUP00000002718  ............ggs---------------------------------------------------------------
ENSTRUP00000012966  ..............h---------------------------------------------------------------
ENSTRUP00000011569  .....rheatlvpmq---------------------------------------------------------------
ENSTRUP00000022599  .............is---------------------------------------------------------------
ENSTRUP00000012006  .............ss---------------------------------------------------------------
ENSTRUP00000044262  .....crhdasllpm---------------------------------------------------------------
ENSTRUP00000022658  .............ts---------------------------------------------------------------
ENSTRUP00000006183  ........edaelve---------------------------------------------------------------
ENSTRUP00000033505  .........fkssee---------------------------------------------------------------
ENSTRUP00000042891  ............eel---------------------------------------------------------------
ENSTRUP00000042426  ......lkdpnfekl---------------------------------------------------------------
ENSTRUP00000007438  .........eelalm---------------------------------------------------------------
ENSTRUP00000004081  ..........pkeer---------------------------------------------------------------
ENSTRUP00000039254  ............acq---------------------------------------------------------------
ENSTRUP00000044157  ..........fknys---------------------------------------------------------------
ENSTRUP00000043673  .............ql---------------------------------------------------------------
ENSTRUP00000026830  ............tfg---------------------------------------------------------------
ENSTRUP00000042409  sgrqlpffrvledlm---------------------------------------------------------------
ENSTRUP00000018397  ..............t---------------------------------------------------------------
ENSTRUP00000046423  ...lqhfplledllr---------------------------------------------------------------
ENSTRUP00000025795  ............ppv------------------------------DNLLKDSTDGSALAVLLHFYCPQLLQLSDVCLK
ENSTRUP00000037515  ........plvenll----------------------------------KDNTDGCALTTLLHFYCSTVIRLEDICLK
ENSTRUP00000036137  ...........eeel---------------------------------------------------------------
ENSTRUP00000040733  ..............v---------------------------------------------------------------
ENSTRUP00000044413  .............lp---------------------------------------------------------------
ENSTRUP00000012214  .............cq---------------------------------------------------------------
ENSTRUP00000008491  ....qkpffpvvnkv---------------------------------------------------------------
ENSTRUP00000006687  ..............v---------------------------------------------------------------
ENSTRUP00000036975  ..............q---------------------------------------------------------------


                           70        80          90       100       110       120       130        1
                            |         |           |         |         |         |         |         
d1pxya_               RVLNPWERNENHTLCLNSAKAVGCS..VVNIGTQDLAEGRPHLVLGLISQLIKIQLLADLNLKKTPQLVELLE.DSDD
ENSTRUP00000035696  N-KTTFTIQENLNLALNSASAIGCH..VVNIDASDLMEGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLR.EGET
ENSTRUP00000035893  K-LTTFKMTENLVLALNSASAIGCT..VVSMDAHDMMAGKPHLVLGLLWQIIKVGLFADIELSRNEGLISLLL.DGET
ENSTRUP00000025762  -------------------------..------------------------RFNLLDEELDNDNSSARLFERS.RIKA
ENSTRUP00000042730  -------------------------..-----------------------------ETDWDNENSSARLFERS.RIKA
ENSTRUP00000030656  -------------------------..------------------------------DDWDNENSSARLFERS.RIKA
ENSTRUP00000030008  -------------------------..-----------------------------TDDWDNENSSARLFERS.RIKA
ENSTRUP00000010095  -------------------------..---------------------------------------------S.RIKA
ENSTRUP00000011270  -------------------------..---------------------------------------------D.RDML
ENSTRUP00000024799  -------------------------..----------------------------------------------.RDLL
ENSTRUP00000013924  -------------------------..----------------------------------------------.RDLL
ENSTRUP00000028024  -------------------------..----------------------------------------------.RDLL
ENSTRUP00000008717  -------------------------..----------------------------------------------.----
ENSTRUP00000039658  -------------------------..----------------------------------------------.---K
ENSTRUP00000013131  -------------------------..----------------------------------------------.----
ENSTRUP00000004371  -------------------------..----------------------------------------------.----
ENSTRUP00000043448  -------------------------..---------------------------------------------E.KDLA
ENSTRUP00000012084  -------------------------..----------------------------------------------.----
ENSTRUP00000016429  -------------------------..----------------------------------------------.----
ENSTRUP00000046695  -------------------------..----------------------------------------------.----
ENSTRUP00000046505  -------------------------..----------------------------------------------.----
ENSTRUP00000014890  -------------------------..----------------------------------------------.----
ENSTRUP00000035684  K-LTPFTIQENLNLALNSASAIGCH..VVNIGAEDLKEGRQHLVLGLLWQVIKIGLFADIELSKNEGLFPLVGfKAQT
ENSTRUP00000031038  -------------------------..----------------------------------------------.---E
ENSTRUP00000006363  KVLNWLLSYNPLWLRIGLETIYGEL..ISLESNSDVLGLAMFILQRLLWN-------PDIAAEFRHTKVPHLY.KDGH
ENSTRUP00000014209  -------------------------..----------------------------------------------.----
ENSTRUP00000008835  -------------------------..----------------------------------------------.----
ENSTRUP00000015270  KAKEVSELQEEGINAINL-------..-------------------PLSPTHYELDPEDTMLEENEVRTMVDP.NSKN
ENSTRUP00000042384  RSKEVSDLHEEGKNAINA-------..-------------------PLLPTGAEIHPEDTLLEENAERVMLDP.TSRD
ENSTRUP00000043381  -------------------------..----------------------------------------------.----
ENSTRUP00000023374  -------------------------..----------------------------------------------.----
ENSTRUP00000012594  -------------------------..----------------------------------------------.----
ENSTRUP00000019118  -------------------------..----------------------------------------------.----
ENSTRUP00000024584  -------------------------..----------------------------------------------.----
ENSTRUP00000013241  -------------------------..----------------------------------------------.----
ENSTRUP00000025142  -------------------------..----------------------------------------------.----
ENSTRUP00000004604  -------------------------..----------------------------------------------.----
ENSTRUP00000004605  -------------------------..----------------------------------------------.----
ENSTRUP00000004542  -------------------------..----------------------------------------------.----
ENSTRUP00000030785  PQMSQFLCLKNIRTFLTSCNVAFAMkkIDLFDAFDLFDVRDFGKVMDTLSRLS---HTVIAQQGGSKPFPTEE.S---
ENSTRUP00000019057  -------------------------..----------------------------------------------.----
ENSTRUP00000034885  PQMSQFLCLKNIRTFLGVCLAKFYLkkSDLFEAFDLFDVRDFGKVIDTLSILS---HSHVATQRGLQSFPIEG.SNL-
ENSTRUP00000019101  -------------------------..-------SWAQGKTPLEVLAERESIYRLLPQTTPENVNKNFSQYSL.DPIT
ENSTRUP00000034912  -------------------------..----------------------------------------------.----
ENSTRUP00000012578  -------------------------..----------------------------------------------.----
ENSTRUP00000010581  -------------------------..----------------------------------------------.----
ENSTRUP00000011154  -------------------------..----------------------------------------------.----
ENSTRUP00000027452  -------------------------..-------RWSEGRAPLDILAERESLYRLLPQTTPENLQKNFGLYVD.PTT-
ENSTRUP00000013071  -------------------------..----------------KVLAERESIYQILSQTTPENTSKNYGSYTI.NPRT
ENSTRUP00000040442  -------------------------..----------------------------------------------.----
ENSTRUP00000027304  -------------------------..----------------------------------------------.----
ENSTRUP00000004552  -------------------------..----------------------------------------------.----
ENSTRUP00000016124  -------------------------..-------GWAQGRKPLEILAERESIYRLLPQTTPENISKHFEQYSI.DPVT
ENSTRUP00000040427  -------------------------..----------------------------------------------.----
ENSTRUP00000039399  -------------------------..----------------------------------------------.----
ENSTRUP00000024074  -------------------------..----------------------------------------------.----
ENSTRUP00000034507  -------------------------..----------------------------------------------.----
ENSTRUP00000044828  -------------------------..-------SWAQGHTVLDVLAERESIYRLLPQTTAENIAKNFEQYTI.DPGT
ENSTRUP00000026384  -------------------------..----------------------------------------------.----
ENSTRUP00000030647  -------------------------..----------------------------------------------.----
ENSTRUP00000030455  -------------------------..----------------------------------------------.----
ENSTRUP00000002718  -------------------------..----------------------------------------------.----
ENSTRUP00000012966  -------------------------..----------------------------------------------.----
ENSTRUP00000011569  -------------------------..----------------------------------------------.----
ENSTRUP00000022599  -------------------------..----------------------------------------------.----
ENSTRUP00000012006  -------------------------..----------------------------------------------.----
ENSTRUP00000044262  -------------------------..----------------------------------------------.----
ENSTRUP00000022658  -------------------------..----------------------------------------------.----
ENSTRUP00000006183  -------------------------..----------------------------------------------.----
ENSTRUP00000033505  -------------------------..----------------------------------------------.----
ENSTRUP00000042891  -------------------------..----------------------------------------------.----
ENSTRUP00000042426  -------------------------..----------------------------------------------.----
ENSTRUP00000007438  -------------------------..----------------------------------------------.----
ENSTRUP00000004081  -------------------------..----------------------------------------------.----
ENSTRUP00000039254  -------------------------..----------------------------------------------.----
ENSTRUP00000044157  -------------------------..----------------------------------------------.----
ENSTRUP00000043673  -------------------------..----------------------------------------------.----
ENSTRUP00000026830  -------------------------..----------------------------------------------.----
ENSTRUP00000042409  -------------------------..----------------------------------------------.----
ENSTRUP00000018397  ----QFLCLKNIRTFLMACTEVFGMrkSELFESFDLFDVRDFGKVVDTLSKLS---HTAIAQQTGIRSFPSEE.S---
ENSTRUP00000046423  -------------------------..----------------------------------------------.----
ENSTRUP00000025795  ENMTLADRLYNLQLIQEFCKDNLND..CCHFTLEDMLYASSTIKNN---------------------------.----
ENSTRUP00000037515  ETMSLADSLYNLQLVQEFCKNNLNH..CCHFTLEDMLYAH---------------------------------.----
ENSTRUP00000036137  -------------------------..----------------------------------------------.----
ENSTRUP00000040733  -------------------------..----------------------------------------------.----
ENSTRUP00000044413  -------------------------..----------------------------------------------.----
ENSTRUP00000012214  -------------------------..----------------------------------------------.----
ENSTRUP00000008491  -------------------------..----------------------------------------------.----
ENSTRUP00000006687  -------------------------..----------------------------------------------.----
ENSTRUP00000036975  -------------------------..----------------------------------------------.----


                      40       150       160                    170       180       190             
                       |         |         |                      |         |         |             
d1pxya_               VEELLRLPPEKVLLKWMNFHLKK.............GGYKKTVSNFSADLKDAQAYAFLLNVLAP...........EH
ENSTRUP00000035696  LADLMKLSPEELLLRWANFHLEN.............AGCQ-PIRNFSGDIKDSKAYFHLLNQISPkgteedqpr..ID
ENSTRUP00000035893  LDHLMSLSPEELLLRWVNYHLQN.............AGTK-TIRNFSEDIKDSRAYFYLLDQIAQyeetaykss..VR
ENSTRUP00000025762  LADEREAVQKKTFTKWVNSILSR.............VGCR-------------------------...........--
ENSTRUP00000042730  LADEREAVQKKTFTKWVNSHLGR.............VTCR-------------------------...........--
ENSTRUP00000030656  LADEREAVQKKTFTKWVNSHLSR.............VSCR-------------------------...........--
ENSTRUP00000030008  LADEREAVQKKTFTKWVNSHLSR.............VSCR-------------------------...........--
ENSTRUP00000010095  LADERDAVQKKTFTKWVNSHLSR.............VSCR-------------------------...........--
ENSTRUP00000011270  LDPAWEQQQRKTFTAWCNSHLRK.............AGTQ-------------------------...........--
ENSTRUP00000024799  LDPAWEKQQRKTFTAWCNSHLRK.............AGTQ-------------------------...........--
ENSTRUP00000013924  LDPAWEKQQRKTFTAWCNSHLRK.............AGTQ-------------------------...........--
ENSTRUP00000028024  LDPAWEKQQRKTFTAWCNSHLRK.............AGTQ-------------------------...........--
ENSTRUP00000008717  --DERDRVQKKTFTKWVNKHLIK.............ADRR-------------------------...........--
ENSTRUP00000039658  YKDERDRVQKKTFTKWINQHLMK.............VRKH-------------------------...........--
ENSTRUP00000013131  --DERDRVQKKTFTKWVNKHLIK.............VRKH-------------------------...........--
ENSTRUP00000004371  --DEREDVQKKTFTKWVNSQLTK.............TGKPP------------------------...........--
ENSTRUP00000043448  EDAPWKKIQQNTFTRWCNEHLKC.............VNKT-------------------------...........--
ENSTRUP00000012084  EDAPWKKIQQNTFTRWINEHLKC.............VNKR-------------------------...........--
ENSTRUP00000016429  LQGEQEAVQKRTFTKWINSHLAK.............CKPPLE-----------------------...........--
ENSTRUP00000046695  ----HDSVQKKTFTKWINAQFSK.............TGKTP------------------------...........--
ENSTRUP00000046505  --DEQEAVQKRTFTKWINSHLAK.............RVPPLI-----------------------...........--
ENSTRUP00000014890  ---EREVVQKRTFTRWINLHLEK.............CAPPIE-----------------------...........--
ENSTRUP00000035684  --------------------LLKlgalppplslshtHTHTHTHTHTHTGFKDSKAYYNLLNQVAPkgdedgvppiaID
ENSTRUP00000031038  LQEQRMLVQKKTFTKWMNSIFFN.............SGEKME-----------------------...........--
ENSTRUP00000006363  EEALSRFTLKKLLL---------.............-----------------------------...........--
ENSTRUP00000014209  ----QEQIQKKTFTNWVNAQLAK.............RRPPCM-----------------------...........--
ENSTRUP00000008835  -TDERDRVQKKTFTKWVNKHLVK.............AQRH-------------------------...........--
ENSTRUP00000015270  DRKLQELM--KVLIDWINDVLVG.............E----------------------------...........--
ENSTRUP00000042384  NLKFKDLL--KVLIDWINSELEE.............E----------------------------...........--
ENSTRUP00000043381  -----------------------.............-----------------------------...........--
ENSTRUP00000023374  -----------------------.............-----------------------------...........--
ENSTRUP00000012594  -----------------------.............-----------------------------...........--
ENSTRUP00000019118  -----------------------.............-----------------------------...........--
ENSTRUP00000024584  -----------------------.............-----------------------------...........--
ENSTRUP00000013241  -----------------------.............-----------------------------...........--
ENSTRUP00000025142  -----------------------.............-----------------------------...........--
ENSTRUP00000004604  -----------------------.............-----------------------------...........--
ENSTRUP00000004605  -----------------------.............-----------------------------...........--
ENSTRUP00000004542  -----------------------.............-----------------------------...........--
ENSTRUP00000030785  -----------------------.............-------------LKDEDIYNNLEDLID-...........--
ENSTRUP00000019057  -----------------------.............-----------------------------...........--
ENSTRUP00000034885  -----------------------.............---------------DEEIYSGLSDYID-...........--
ENSTRUP00000019101  -----------------------.............-----RYPNVSLHFLKPSQLRHLYDTGES...........RE
ENSTRUP00000034912  -----------------------.............-----------------------------...........--
ENSTRUP00000012578  -----------------------.............-----------------------------...........--
ENSTRUP00000010581  -----------------------.............-----------------------------...........--
ENSTRUP00000011154  -----------------------.............-----------------------------...........--
ENSTRUP00000027452  -----------------------.............-----RYVNVNQLYVTPAQMRHLVDTGQD...........AG
ENSTRUP00000013071  -----------------------.............-----------------------------...........--
ENSTRUP00000040442  -----------------------.............-----------------------------...........--
ENSTRUP00000027304  -----------------------.............-----------------------------...........--
ENSTRUP00000004552  ----------QIYTDWANHYLAK.............SGCPRL-----------------------...........--
ENSTRUP00000016124  -----------------------.............-----RYPNLNVNYIRPHQVRHLFINGHL...........A-
ENSTRUP00000040427  ----------QIYTDWANHYLAK.............SGHKRL-----------------------...........--
ENSTRUP00000039399  -----------------------.............-----------------------------...........--
ENSTRUP00000024074  -----------------------.............-----------------------------...........--
ENSTRUP00000034507  -----------------------.............-----------------------------...........--
ENSTRUP00000044828  -----------------------.............-----RYPNLNCCNVRPHQVRHLY-----...........--
ENSTRUP00000026384  -----------------------.............-----------------------------...........--
ENSTRUP00000030647  -----------------------.............-----------------------------...........--
ENSTRUP00000030455  -----------------------.............-----------------------------...........--
ENSTRUP00000002718  -----------------------.............-----------------------------...........--
ENSTRUP00000012966  -----------------------.............-----------------------------...........--
ENSTRUP00000011569  -----------------------.............-----------------------------...........--
ENSTRUP00000022599  -----------------------.............-----------------------------...........--
ENSTRUP00000012006  -----------------------.............-----------------------------...........--
ENSTRUP00000044262  -----------------------.............-----------------------------...........--
ENSTRUP00000022658  -----------------------.............-----------------------------...........--
ENSTRUP00000006183  -----------------------.............-----------------------------...........--
ENSTRUP00000033505  -----------------------.............-----------------------------...........--
ENSTRUP00000042891  -----------------------.............-----------------------------...........--
ENSTRUP00000042426  ---------KEMLVQWINSTLKP.............KHIV-------------------------...........--
ENSTRUP00000007438  -----------------------.............-----------------------------...........--
ENSTRUP00000004081  -----------------------.............-----------------------------...........--
ENSTRUP00000039254  -----------------------.............-----------------------------...........--
ENSTRUP00000044157  -----------------------.............-----------------------------...........--
ENSTRUP00000043673  ----------AAYVSWVNSQLKR.............K----------------------------...........--
ENSTRUP00000026830  -----------------------.............-----------------------------...........--
ENSTRUP00000042409  -----------------------.............-----------------------------...........--
ENSTRUP00000018397  -----------------------.............-----------------------------...........--
ENSTRUP00000046423  -----------------------.............-----------------------------...........--
ENSTRUP00000025795  -----------------------.............-----------------------------...........--
ENSTRUP00000037515  -----------------------.............-----------------------------...........--
ENSTRUP00000036137  -----------------------.............-----------------------------...........--
ENSTRUP00000040733  -----------------------.............-----------------------------...........--
ENSTRUP00000044413  -----------------------.............-----------------------------...........--
ENSTRUP00000012214  -----------------------.............-----------------------------...........--
ENSTRUP00000008491  -----------------------.............-----------------------------...........--
ENSTRUP00000006687  -----------------------.............-----------------------------...........--
ENSTRUP00000036975  -----------------------.............-----------------------------...........--


                           200       210       220       230        240       250       260         
                             |         |         |         |          |         |         |         
d1pxya_               CDPATLDAKDPLERAELVLSHAERMNCKRYLTAEEIVE.GSSTLNLAFVAQIFHERNGLNKDGKYAFAEMMTEDVETC
ENSTRUP00000035696  INMSGLSELDDRNRAEAMLVQADRLGCRQFVTPADVVS.GNPKLNLAFVANLFNKYPALTKPENEDVDWQMLEEET--
ENSTRUP00000035893  IDMSGLNEEDLERRAELMLRQAARLDCRQFVSPHDVTS.GNSKLNLAFVANLFNMHPAVEKTDLNGMETAHIEGET--
ENSTRUP00000025762  --------------------------------------.---------------------------------------
ENSTRUP00000042730  --------------------------------------.---------------------------------------
ENSTRUP00000030656  --------------------------------------.---------------------------------------
ENSTRUP00000030008  --------------------------------------.---------------------------------------
ENSTRUP00000010095  --------------------------------------.---------------------------------------
ENSTRUP00000011270  --------------------------------------.---------------------------------------
ENSTRUP00000024799  --------------------------------------.---------------------------------------
ENSTRUP00000013924  --------------------------------------.---------------------------------------
ENSTRUP00000028024  --------------------------------------.---------------------------------------
ENSTRUP00000008717  --------------------------------------.---------------------------------------
ENSTRUP00000039658  --------------------------------------.---------------------------------------
ENSTRUP00000013131  --------------------------------------.---------------------------------------
ENSTRUP00000004371  --------------------------------------.---------------------------------------
ENSTRUP00000043448  --------------------------------------.---------------------------------------
ENSTRUP00000012084  --------------------------------------.---------------------------------------
ENSTRUP00000016429  --------------------------------------.---------------------------------------
ENSTRUP00000046695  --------------------------------------.---------------------------------------
ENSTRUP00000046505  --------------------------------------.---------------------------------------
ENSTRUP00000014890  --------------------------------------.---------------------------------------
ENSTRUP00000035684  MVNDLNQEKDDLRRAECMLDQAERLGCRQFVMATDVVR.GNPKLNLAFVANLFNKYPALKKPENQDIDWSAIEGET--
ENSTRUP00000031038  --------------------------------------.---------------------------------------
ENSTRUP00000006363  --------LVCFLDRAKESRLIEHNPCLFCLDAE--FK.ATKDLLLAFSRDFLS--GEGILPRHLGYLGLPVSHVQTP
ENSTRUP00000014209  --------------------------------------.---------------------------------------
ENSTRUP00000008835  --------------------------------------.---------------------------------------
ENSTRUP00000015270  --------------------------------------.---------------------------------------
ENSTRUP00000042384  --------------------------------------.---------------------------------------
ENSTRUP00000043381  --------------------------------------.---------------------------------------
ENSTRUP00000023374  --------------------------------------.---------------------------------------
ENSTRUP00000012594  --------------------------------------.---------------------------------------
ENSTRUP00000019118  --------------------------------------.---------------------------------------
ENSTRUP00000024584  --------------------------------------.----------------FNKGPAYGLSAEVKNKIAQKYDL
ENSTRUP00000013241  --------------------------------------.---------------------------------------
ENSTRUP00000025142  --------------------------------------.------------------SGPAFGLSAEVKSKLAAKYDS
ENSTRUP00000004604  --------------------------------------.---------------------------------------
ENSTRUP00000004605  --------------------------------------.---------------------------------------
ENSTRUP00000004542  --------------------------------------.--------------GMANKGPSYGLSRQVQDKIDSKYDP
ENSTRUP00000030785  ----------------------------------ENAP.EDEDDLYAAVYGMDDNCTGGKIYEDLMRAEQPPPLVLTQ
ENSTRUP00000019057  --------------------------------------.-------------------------------KIEQKYDP
ENSTRUP00000034885  ----------------------------------ETLD.EDDDLYDFVEDE---EDKGDEIYEDLMKIEEPPERQKCG
ENSTRUP00000019101  IRMEIENVI-----------------------------.---------------------------------------
ENSTRUP00000034912  --------------------------------------.---------------------------------------
ENSTRUP00000012578  --------------------------------------.---------------------------------------
ENSTRUP00000010581  --------------------------------------.---------------------------------------
ENSTRUP00000011154  --------------------------------------.---------------------------------------
ENSTRUP00000027452  LHC-----------------------------------.---------SED---------------------------
ENSTRUP00000013071  ----------RY--VTVNLS--------------SIHTnQVRT-----------------------------------
ENSTRUP00000040442  --------------------------------------.---------------------------------------
ENSTRUP00000027304  --------------------------------------.---------------------------------------
ENSTRUP00000004552  --------------------------------------.---------------------------------------
ENSTRUP00000016124  --------------------------------------.---------------------------------------
ENSTRUP00000040427  --------------------------------------.---------------------------------------
ENSTRUP00000039399  --------------------------------------.---------------------------------------
ENSTRUP00000024074  --------------------------------------.---------------------------------------
ENSTRUP00000034507  --------------------------------------.---------------------------------------
ENSTRUP00000044828  --------------------------------------.---------------------------------------
ENSTRUP00000026384  --------------------------------------.---------------------------------------
ENSTRUP00000030647  --------------------------------------.---------------------------------------
ENSTRUP00000030455  --------------------------------------.---------------------------------------
ENSTRUP00000002718  --------------------------------------.---------------------------------------
ENSTRUP00000012966  --------------------------------------.---------------------------------------
ENSTRUP00000011569  --------------------------------------.---------------------------------------
ENSTRUP00000022599  --------------------------------------.---------------------------------------
ENSTRUP00000012006  --------------------------------------.---------------------------------------
ENSTRUP00000044262  --------------------------------------.---------------------------------------
ENSTRUP00000022658  --------------------------------------.---------------------------------------
ENSTRUP00000006183  --------------------------------------.---------------------------------------
ENSTRUP00000033505  --------------------------------------.------------------------------------YLY
ENSTRUP00000042891  --------------------------------------.---------------------------------------
ENSTRUP00000042426  --------------------------------------.---------------------------------------
ENSTRUP00000007438  --------------------------------------.---------------------------------------
ENSTRUP00000004081  --------------------------------------.---------------------------------------
ENSTRUP00000039254  --------------------------------------.---------------------------------------
ENSTRUP00000044157  --------------------------------------.---------------------------------------
ENSTRUP00000043673  --------------------------------------.-----------------PGLKP-----------------
ENSTRUP00000026830  --------------------------------------.---------------------------------------
ENSTRUP00000042409  --------------------------------------.---------------------------------------
ENSTRUP00000018397  --------------------------------------.---------------------------------------
ENSTRUP00000046423  --------------------------------------.---------------------------------------
ENSTRUP00000025795  --------------------------------------.---------------------------------------
ENSTRUP00000037515  --------------------------------------.---------------------------------------
ENSTRUP00000036137  --------------------------------------.---------------------------------------
ENSTRUP00000040733  --------------------------------------.---------------------------------------
ENSTRUP00000044413  --------------------------------------.---------------------------------------
ENSTRUP00000012214  --------------------------------------.---------------------------------------
ENSTRUP00000008491  --------------------------------------.---------------------------------------
ENSTRUP00000006687  --------------------------------------.---------------------------------------
ENSTRUP00000036975  --------------------------------------.---------------------------------------


                      270       280             290       300                            310        
                        |         |               |         |                              |        
d1pxya_               ..RDERCYRLWINSLGIDSY......VNNVFEDVRNGWILLEVLDKVS.....................P...SSVNW
ENSTRUP00000035696  ..REERTFRNWMNSLGVNPH......VNHLYSDLQDSIVIFQLYDKIKvpvd.................W...NKVN-
ENSTRUP00000035893  ..REEKTYRNWMNSLGVSPH......VNHLYCDLCDGLVILQLLEKVRvpvn.................W...KRVN-
ENSTRUP00000025762  ..------------------......ISDLYLDLRDGRMLIKLLEVLS.....................G...ERL--
ENSTRUP00000042730  ..------------------......IGDLYTDLRDGRMLIRLLEVLS.....................G...EQL--
ENSTRUP00000030656  ..------------------......ITDLYMDLRDGRMLIKLLEVLS.....................G...ERL--
ENSTRUP00000030008  ..------------------......ITDLYMDLRDGRMLIKLLEVLS.....................G...EKL--
ENSTRUP00000010095  ..------------------......ISDLYNDLRDGYMLTRLLEVLS.....................G...ELL--
ENSTRUP00000011270  ..------------------......IENIEEDFRNGLKLMLLLEVIS.....................G...ERL--
ENSTRUP00000024799  ..------------------......IENIEEDFRDGLKLMLLLEVIS.....................G...ERL--
ENSTRUP00000013924  ..------------------......IENIEEDFRNGLKLMLLLEVIS.....................G...ERL--
ENSTRUP00000028024  ..------------------......IENIEEDFRDGLKLMLLLEVIS.....................G...ERL--
ENSTRUP00000008717  ..------------------......VDDLYEDLRDGHNLISLLEVLS.....................G...EKLP-
ENSTRUP00000039658  ..------------------......INDLYEDLRDGHNLISLLEVLS.....................G...DTLP-
ENSTRUP00000013131  ..------------------......ITDLYEDLRDGHNLISLLEVLS.....................G...VTLP-
ENSTRUP00000004371  ..------------------......VEDLFSDLCDGRRLLQLLEGLV.....................G...HQL--
ENSTRUP00000043448  ..------------------......ITDLQREFTDGLKLISLLEVLS.....................Q...KKMY-
ENSTRUP00000012084  ..------------------......IVDLQLDLGDGLRLIALLEVLS.....................H...KKMY-
ENSTRUP00000016429  ..------------------......VNDLFEDIKDGVKLLALLEVLS.....................G...QKLP-
ENSTRUP00000046695  ..------------------......IKDMFTDLKDGRKLLDLLEGLT.....................G...ATLT-
ENSTRUP00000046505  ..------------------......VTDLYEDLKDGVMLLALLEVLS.....................G...QKLP-
ENSTRUP00000014890  ..------------------......VEDLFQDIQDGYILMALLEELS.....................G...SKLL-
ENSTRUP00000035684  ..REERTFRNWMNSLGVNPR......VNHLYT----------------.....................-...-----
ENSTRUP00000031038  ..------------------......LTDVYTELKTGVALIRLLELIS.....................R...ETL--
ENSTRUP00000006363  ..LDEFNFA-----------......VKSLAVDLKCGIRLVRVMELLM.....................Q...DWS-F
ENSTRUP00000014209  ..------------------......ILDLFQDFRDGSRLLDLLEVMS.....................G...QRLS-
ENSTRUP00000008835  ..------------------......VTDLYEDLRDGHNLISLLEVLS.....................G...ETLP-
ENSTRUP00000015270  ..---------------RII......VKDLAEDLYDGQVLQKLFEKLE.....................G...EKLNV
ENSTRUP00000042384  ..---------------RII......VKDLEEDCYDGQVLQKLFEKLS.....................G...RKLNV
ENSTRUP00000043381  ..------------------......----------------------.....................-...-----
ENSTRUP00000023374  ..------------------......----------------------.....................-...-----
ENSTRUP00000012594  ..------------------......----------------------.....................-...-----
ENSTRUP00000019118  ..------------------......----------------------.....................-...-----
ENSTRUP00000024584  ..QKEEELRLWIQDVTGHPI......GADFQKEMKSGVVLCELINHLA.....................P...GSVT-
ENSTRUP00000013241  ..------------------......----------------------.....................-...-----
ENSTRUP00000025142  ..QKEEELRLWIEDVTSKRI......GDNFMDSLKDGVILCELINVLQ.....................P...GSI--
ENSTRUP00000004604  ..------------------......----------------------.....................-...-----
ENSTRUP00000004605  ..------------------......----------------------.....................-...-----
ENSTRUP00000004542  ..ELEQILVEWISRQCGADVgrpepgKLGFQAWLKDGCILCQLVNSLFv....................G...DKPV-
ENSTRUP00000030785  aeLDVRTCCLSEIKQTEEKY......TETL------------------.....................-...ESIE-
ENSTRUP00000019057  ..DLEQRLVDWILVQCGGDLerpqpgKDDFQKWLMDGTILCRLINSLY.....................PkgeEPI--
ENSTRUP00000034885  ..VDKRECCLQEIRQTEEKY......SETL------------------.....................-...ESVM-
ENSTRUP00000019101  ..------------------......----------------------.....................-...-----
ENSTRUP00000034912  ..----EAKRWMEACLDEELpp....TTELEEGLRNGVYLAKLGNFFA.....................P...RTVSL
ENSTRUP00000012578  ..----EAKQWMEACLEEELpp....TTELEEGLRNGVYLGKLATFFA.....................P...KMVSE
ENSTRUP00000010581  ..------------------......----------------------.....................-...-----
ENSTRUP00000011154  ..----EAKRWIEACLGEELpa....PTELEEVLRNGVILAKLGHRFA.....................P...NAVGL
ENSTRUP00000027452  ..------------------......----------------------.....................-...-----
ENSTRUP00000013071  ..------------------......----------------------.....................-...-----
ENSTRUP00000040442  ..------------------......----------------------.....................-...-----
ENSTRUP00000027304  ..------------------......----------------------.....................-...-----
ENSTRUP00000004552  ..------------------......IKDLSQDVTDGVLLAQIIQIIA.....................N...EKVE-
ENSTRUP00000016124  ..------------------......----------------------.....................S...C----
ENSTRUP00000040427  ..------------------......IKDLQTDVTDGVLLAEIIQVVA.....................N...EKID-
ENSTRUP00000039399  ..------------------......----------------------.....................-...-----
ENSTRUP00000024074  ..------------------......----------------------.....................-...-----
ENSTRUP00000034507  ..------------------......----------------------.....................-...-----
ENSTRUP00000044828  ..------------------......----------------------.....................-...-----
ENSTRUP00000026384  ..------------------......----------------------.....................-...-----
ENSTRUP00000030647  ..--KEDLALWLTNILGLEIt.....SETFMERLDNGFLLCQLAETLQerfrqnngskvwtesvp....Y...RRIP-
ENSTRUP00000030455  ..------------------......----------------------.....................-...-----
ENSTRUP00000002718  ..------------------......----------------------.....................-...-----
ENSTRUP00000012966  ..------------------......----------------------.....................-...-----
ENSTRUP00000011569  ..---EDLAIWLSGMLGEEVr.....AEFFMEELDNGVKLCKLVGVLQtkvaqscpvsqagqlf.....Pv..RKVT-
ENSTRUP00000022599  ..------------------......----------------------.....................-...-----
ENSTRUP00000012006  ..------------------......----------------------.....................-...-----
ENSTRUP00000044262  ..--KEDLVSWLNNLMGVHLt.....ADSLMDGLDNGVLLCQLAQLLQ.....................E...KMIH-
ENSTRUP00000022658  ..------------------......----------------------.....................-...-----
ENSTRUP00000006183  ..----QLRKNIEARLKVS-......CPDLGAALTDGVVLCHLANHVR.....................P...RSVPS
ENSTRUP00000033505  ..AMKEDLAEWLNTLYDLDIt.....ADTFMDALETGCALCRHANNVNraaqdfqleypeaahamkvpsK...DVVF-
ENSTRUP00000042891  ..EQIGLLRQNIESRLKVLL......PDDVGAALMDGVVLCHLANNIS.....................P...RSVAS
ENSTRUP00000042426  ..------------------......VQSLEEDLYDGLVLHHLLSRLA.....................G...VHV--
ENSTRUP00000007438  ..---EQLRHSIESRLKLIL......PEDLGPFLMDGVVLCHLANHLH.....................P...CSVAG
ENSTRUP00000004081  ..PEITQLRKTLESHLKITL......PEDLGEALSNGTVLCQLVNHIR.....................P...RSVSI
ENSTRUP00000039254  ..----EAQKWIEAVTGKSFg.....DKDFRSGLENGILLCELLSAIK.....................P...GLV--
ENSTRUP00000044157  ..------------------......CNDFRAALENGVLLCDLINKLK.....................P...GII--
ENSTRUP00000043673  ..------------------......VRDLRHDLQDGVVLVQLIEIVG.....................K...YSIA-
ENSTRUP00000026830  ..------------------......SDDFRSALENGILLCDLINKIK.....................P...GTI--
ENSTRUP00000042409  ..------------------......----------------------.....................-...-----
ENSTRUP00000018397  ..------------------......----------------------.....................-...-----
ENSTRUP00000046423  ..------------------......----------------------.....................-...-----
ENSTRUP00000025795  ..------------------......----------------------.....................-...-----
ENSTRUP00000037515  ..------------------......----------------------.....................-...-----
ENSTRUP00000036137  ..------------------......----------------------.....................-...-----
ENSTRUP00000040733  ..------------------......----------------------.....................-...-----
ENSTRUP00000044413  ..------------------......----------------------.....................-...-----
ENSTRUP00000012214  ..------------------......----------------------.....................-...-----
ENSTRUP00000008491  ..------------------......----------------------.....................-...-----
ENSTRUP00000006687  ..------------------......----------------------.....................-...-----
ENSTRUP00000036975  ..------------------......----------------------.....................-...-----


                              320                                               330       340       
                                |                                                 |         |       
d1pxya_               K......HASKP..PIKMP.................................FR.....KVENCNQVIKIGKQ.LKFS
ENSTRUP00000035696  -......KPPYP..KLGTN.................................MK.....KLENCNYAVDLGKS.ANFS
ENSTRUP00000035893  -......NPPYP..FLGGN.................................MK.....KLENCNYAVDLGRDiARFS
ENSTRUP00000025762  -......-PKPT..KGRMR.................................IH.....CLENVDKALQFLKE.QRVH
ENSTRUP00000042730  -......-PRPT..KGRMR.................................IH.....CLENVDKALQFLKE.QKVH
ENSTRUP00000030656  -......-PKPT..KGRMR.................................IH.....CLENVDKALQFLKE.QRVH
ENSTRUP00000030008  -......-PKPT..KGRMR.................................IH.....CLENVDKALQFLKE.QRVH
ENSTRUP00000010095  -......-PRPT..RGRMR.................................IH.....CLENVDKALQFLKE.QRVH
ENSTRUP00000011270  -......-PKPD..RGKMR.................................FH.....KIANVNKALEFISS.KGVK
ENSTRUP00000024799  -......-PKPE..RGKMR.................................VH.....KINNVNKALDFIAS.KGVK
ENSTRUP00000013924  -......-PKPD..KGKMR.................................FH.....KIANVNKALDFICS.KGVK
ENSTRUP00000028024  -......-AKPE..RGKMR.................................VH.....KISNVNKALDFIAS.KGVK
ENSTRUP00000008717  -......---RE..KGHMR.................................FH.....KLQNVQIALDFLKH.RQVK
ENSTRUP00000039658  -......---RE..RGRMR.................................FH.....RLQNVQIALDYLKR.RQVK
ENSTRUP00000013131  -......---RE..KGRMR.................................FH.....RLQNVQIALDFLKQ.RQVK
ENSTRUP00000004371  -......-VRLE..RGLTR.................................VH.....SLNNVNRALQILQK.NNVE
ENSTRUP00000043448  -......RKYHT..RPNFR.................................QM.....KLENVSVALEFLER.ERIK
ENSTRUP00000012084  -......RKYHP..RPNFG.................................QM.....KLENVSVALEFLDK.ENIK
ENSTRUP00000016429  -......-REQG..RQLKR.................................IH.....WVSNIGTALKFLEG.RKIK
ENSTRUP00000046695  -......---KE..RGSTR.................................VH.....ALNNVNKVLQVLHQ.NNVD
ENSTRUP00000046505  -......-CEQG..KKLKR.................................IH.....WVANIGTALNFLEG.RKIK
ENSTRUP00000014890  -......-HGFK..KSSHR.................................IF.....RLNNIAKVLSFLEE.RNVK
ENSTRUP00000035684  -......-----..-----.................................--.....--------------.----
ENSTRUP00000031038  -......-PSPS..RRKLR.................................VH.....CLENNSIAINFLKTkIRVD
ENSTRUP00000006363  S......AKLRL..PAISR.................................LQ.....KIHNVDVALQVLKD.KGVD
ENSTRUP00000014209  -......---RE..RGRGM.................................FQ.....HRSNIEKALSFLKA.KSIK
ENSTRUP00000008835  -......---RE..KGRMR.................................FH.....KLQE----------.----
ENSTRUP00000015270  A......EVTQS..EIAQK.................................QKlqt..VLERINDSLKLSSRnIRWN
ENSTRUP00000042384  A......EVTQS..EIGQK.................................QKlqt..VLEAVNELLRPHGWtIEWS
ENSTRUP00000043381  -......-----..-----.................................--.....-LENCNYAIELGKSeAKFS
ENSTRUP00000023374  -......-----..-----.................................--.....--------------.----
ENSTRUP00000012594  -......-----..-----.................................--.....--------------.----
ENSTRUP00000019118  -......-----..-----.................................--.....--------------.----
ENSTRUP00000024584  -......-KINT..KSTLN.................................WH.....QLENLANFIKAITA.YGLK
ENSTRUP00000013241  -......-----..-----.................................--.....--------------.----
ENSTRUP00000025142  -......-KKIN..NPSQN.................................WH.....QLENIGNFVRAITD.YGLK
ENSTRUP00000004604  -......-----..-----.................................--.....--------------.----
ENSTRUP00000004605  -......-----..-----.................................--.....--------------.----
ENSTRUP00000004542  -......-KKIQ..NSTMA.................................FK.....QMEQISQFLKGAEA.YGVN
ENSTRUP00000030785  -......-KYFL..NPLKK.................................F-.....--------------.----
ENSTRUP00000019057  -......-KKIP..ETQMA.................................FK.....QMEKISQFLRAAEA.YGVI
ENSTRUP00000034885  -......-QHFR..KPLER.................................FL.....QPQ-----------.----
ENSTRUP00000019101  -......-----..-----.................................--.....--------------.----
ENSTRUP00000034912  K......-KIYD..REQTR.................................YKvelyrHTDNVIQWLNAMAE.KGLP
ENSTRUP00000012578  KriydrdQSRYK..SSGLH.................................FR.....HTDNTVQWLRAMES.VGLP
ENSTRUP00000010581  -......-----..-----.................................--.....--------------.----
ENSTRUP00000011154  K......-KIFD..PEQQRyqavglh..........................FR.....HTDNINQWRNALIA.VGLP
ENSTRUP00000027452  -......-IIRL..PSSH-.................................--.....--------------.----
ENSTRUP00000013071  -......-----..-----.................................--.....--------LYFEFS.LNVK
ENSTRUP00000040442  -......-----..-----.................................--.....--------------.----
ENSTRUP00000027304  -......-----..-----.................................--.....--------------.----
ENSTRUP00000004552  -......-DING..SPRSQ.................................SQ.....MIENVDACLSFLDA.RGVN
ENSTRUP00000016124  -......-----..-----.................................--.....--------------.----
ENSTRUP00000040427  -......-DING..CPKSR.................................SQ.....MIENIDACLTFLAA.KGIN
ENSTRUP00000039399  -......-----..-----.................................--.....--------------.----
ENSTRUP00000024074  -......-----..-----.................................--.....--------------.----
ENSTRUP00000034507  -......-----..-----.................................--.....--------------.----
ENSTRUP00000044828  -......-----..-----.................................--.....--------------.----
ENSTRUP00000026384  -......-----..-----.................................--.....--------------.----
ENSTRUP00000030647  -......-CRQS..APSGS.................................FF.....ARDNTANFLAWCRK.VGVG
ENSTRUP00000030455  -......-----..-----.................................--.....--------------.----
ENSTRUP00000002718  -......-----..-----.................................--.....--------------.----
ENSTRUP00000012966  -......-----..-----.................................--.....--------------.----
ENSTRUP00000011569  -......-CKRD..ASPGS.................................FF.....ARDNTANFLSWCRH.IGVE
ENSTRUP00000022599  -......-----..-----.................................--.....--------------.----
ENSTRUP00000012006  -......-----..-----.................................--.....--------------.----
ENSTRUP00000044262  -......TNKVS..QPFMRraihwradaasgt....................FF.....ARDNVANFLYWCRK.IGVD
ENSTRUP00000022658  -......-----..-----.................................--.....--------------.----
ENSTRUP00000006183  I......HVPSPavPKLTM.................................AK.....CRRNVENFLEACRR.IGVP
ENSTRUP00000033505  -......-QSRN..VVSGS.................................FL.....ARDNVSNFISWCRQeLWIK
ENSTRUP00000042891  I......HVPSPavPKLSM.................................AK.....CRRNVENFLDACKK.IGVP
ENSTRUP00000042426  -......-SVEE..IAVSS.................................TA.....QIHKLEVILEELDKrLGQE
ENSTRUP00000007438  I......HVPSPaaPKLGM.................................AK.....CRRNVENFLEACRK.QGVP
ENSTRUP00000004081  I......HVPSPavPKLST.................................AK.....SRVNVESFLGACRK.LGLP
ENSTRUP00000039254  -......-KKIN..RLPTP.................................IA.....GLDNLSVFLRGCEE.LGLK
ENSTRUP00000044157  -......-KKVN..RRSTP.................................IA.....GLDNVNVFLKACGK.LGLN
ENSTRUP00000043673  -......-QKYK..FSILYakflfllchslqsffksaagevldgvhitpqnkEE.....SRKNVDQVLQFISS.RHIR
ENSTRUP00000026830  -......-KRIN..RLPTP.................................IA.....GLDNLNVFLRACGK.LGLK
ENSTRUP00000042409  -......-----..-----.................................--.....--------------.----
ENSTRUP00000018397  -......-----..-----.................................--.....--------------.----
ENSTRUP00000046423  -......-----..-----.................................--.....--------------.----
ENSTRUP00000025795  -......-----..-----.................................--.....--------------.----
ENSTRUP00000037515  -......-----..-----.................................--.....--------------.----
ENSTRUP00000036137  -......-----..-----.................................--.....--------------.----
ENSTRUP00000040733  -......-----..-----.................................--.....--------------.----
ENSTRUP00000044413  -......-----..EPRSD.................................NE.....CQRNITEFINGCGA.FGVE
ENSTRUP00000012214  -......-----..EPRTE.................................SD.....CISNIREFLRGCSS.LKVE
ENSTRUP00000008491  -......-----..-----.................................--.....--------------.----
ENSTRUP00000006687  -......-----..-----.................................--.....--------------.----
ENSTRUP00000036975  -......-----..EPKND.................................GE.....CLYNIKEFLKGCTS.FRVE


                            350           360       370       380                                   
                              |             |         |         |                                   
d1pxya_               LVN.....VA.GN.DIVQ.G.NKKLILGLLWQLMRFHMLQLLKSLRSRTL............................
ENSTRUP00000035696  IVG.....IG.GH.DLNT.G.VPTLTLGLVWQLMRRYTLNVL----EELG............................
ENSTRUP00000035893  LVG.....IG.GE.NLNE.G.SSMHTLALLWQLMRRYTVLVLSKL---GD............................
ENSTRUP00000025762  LEN.....MG.SH.DIVD.G.NHRLILGLIWTIILRFQIQDIIVETGQAD............................
ENSTRUP00000042730  LEN.....MG.SH.DIVD.G.NHRLTLGLIWTIILRFQIQDISVETEDNK............................
ENSTRUP00000030656  LEN.....MG.SH.DIVD.G.NHRLTLGLIWTIILRFQIQDISVETEDNK............................
ENSTRUP00000030008  LEN.....MG.SH.DIVD.G.NHRLTLGLIWTIILRFQIQDISVETEDNK............................
ENSTRUP00000010095  LEN.....VG.SH.DIVD.G.NHRLTLGLIWTIILRFQIQVIKIETEDNR............................
ENSTRUP00000011270  LVS.....IG.AE.EIVD.G.NVKMTLGMIWTIILRFAIQDISVE-----............................
ENSTRUP00000024799  LVS.....IG.AE.EIVD.G.NAKMTLGMIWTIILRFAIQDISVE-----............................
ENSTRUP00000013924  LVS.....IG.AE.EIVD.G.NVKMTLGMIWTIILRFAIQDISVE-----............................
ENSTRUP00000028024  LVS.....IG.AE.EIVD.G.NAKMTLGMIWTIILRFAIQDISVE-----............................
ENSTRUP00000008717  LVN.....IR.ND.DIAD.G.NPKLILGLIWTIILHFQISDIQVN--GQS............................
ENSTRUP00000039658  LVN.....IR.ND.DITD.G.NPKLTLGLIWTIILHFQISEIHVT--GES............................
ENSTRUP00000013131  LVN.....IR.ND.DITD.G.NPKLTLGLIWTIILHFQISEIYVS--GES............................
ENSTRUP00000004371  LVN.....IG.AA.DIVD.G.NHKLILGLIWSIILHWQVKDVMKDVMAGL............................
ENSTRUP00000043448  LVS.....ID.SK.AIVD.G.NLKLILGLIWTLILHYSISMPMWDDEDDE............................
ENSTRUP00000012084  LVS.....ID.SK.AIVD.G.NLKLILGLIWTLILHYSISMPAWEGEDEEiqa.........................
ENSTRUP00000016429  LVN.....IH.AT.DVAD.G.RPSIVLGLLWTVILYFQIEELTSNLPALQalsnsnssvesiassetgsppmkrkvin
ENSTRUP00000046695  LVN.....IG.GT.DIVD.G.NHKLTLGLIWSIILHWQVKDIMKDVMANL............................
ENSTRUP00000046505  LVN.....IN.ST.DIVD.G.RPAIVLGLIWTIILYFQIEELTINLPAIQalsssnssldsstsstdttsspikrnpp
ENSTRUP00000014890  LVS.....ID.AA.NVAD.G.NASIILGLIWNIILFFQIKELTGNIRSQFpsscslssiptsaesetsccstasderr
ENSTRUP00000035684  ---.....--.--.----.-.-----------------------------............................
ENSTRUP00000031038  LI-.....-G.PE.NVVD.G.DRTLILGLLWIIILRFQIGPINLDEAGGG............................
ENSTRUP00000006363  LKDdqgniIN.SR.DIVD.G.HREKTLNLLWKIIFAFQVDVMLDENQLREeisflrrtlrtkqrlalmranqnlqlss
ENSTRUP00000014209  LVN.....IN.IP.DIID.G.KPSIILGLIWTIILQYHIEELASSLSFSSrqssmeslasldsrstlssrsassspvp
ENSTRUP00000008835  ---.....--.--.----.-.----------------------------Efacemmscavthhhrtddnrtddrtglg
ENSTRUP00000015270  VDS.....VH.AK.SIV-.-.---AILHLLVALSQHFRAPIRLPDHVSIQvvvvqkregilqsrqieeeitgnteals
ENSTRUP00000042384  VDS.....IH.SK.NLV-.-.---AIVYLLVALAMHFQAPIRLPEHVSVKvvvvkqkregilqtalvtkeltsttemm
ENSTRUP00000043381  LVG.....IA.GQ.DLNA.G.NRKLTLALLWQLMRRYTLNILEEL---GD............................
ENSTRUP00000023374  ---.....--.--.----.-.-----------------------------............................
ENSTRUP00000012594  ---.....--.--.----.-.-----------------------------............................
ENSTRUP00000019118  ---.....--.--.----.-.---------------------------IT............................
ENSTRUP00000024584  PHD.....IFeAN.DLFEsG.N--------------------------MT............................
ENSTRUP00000013241  ---.....--.--.----.-.-----------------------------............................
ENSTRUP00000025142  PHD.....LFeAN.DLFE.NmNHTQVQSTLIAL-----------------............................
ENSTRUP00000004604  ---.....--.-K.AIVD.G.NLKLILGLIWTLILHYSISMPMWGDEDDE............................
ENSTRUP00000004605  ---.....--.-K.AIVD.G.NLKLILGLIWTLILHYSISMPMWGDEDDE............................
ENSTRUP00000004542  KTD.....MF.QTvDLWEaK.DLAAVQRTLSALGSLA-----------VT............................
ENSTRUP00000030785  ---.....--.--.----.-.-----------------------------............................
ENSTRUP00000019057  TTD.....IF.QTvDLWE.GkDMATVQRTLMALG----------------............................
ENSTRUP00000034885  ---.....--.--.----.-.-----------------------------............................
ENSTRUP00000019101  ---.....--.--.----.-.---------------------------NS............................
ENSTRUP00000034912  KIF.....YP.ETtDIYDrK.NMPRCIYCIHALSLYL-------------............................
ENSTRUP00000012578  KIF.....YP.ETtDVYDrK.NMPKVVYCIHALSLYL----------YKL............................
ENSTRUP00000010581  ---.....--.--.----.-.--------------------------AVP............................
ENSTRUP00000011154  AIF.....HP.ETtDIYDkK.NMPRAIYCVHALSIYMYRQGLAPQIQD--............................
ENSTRUP00000027452  ---.....--.--.----.-.-----------------------------............................
ENSTRUP00000013071  PLK.....CG.SS.LLA-.-.---------------------------SS............................
ENSTRUP00000040442  ---.....--.--.----.-.-----------------------------............................
ENSTRUP00000027304  ---.....--.--.----.-.--------------------------GVS............................
ENSTRUP00000004552  VQG.....LS.AE.EIRN.G.NLKSILGLFFILSRYKQQQQQ--------............................
ENSTRUP00000016124  ---.....--.--.----.-.----------------HLERKFSNRLRFI............................
ENSTRUP00000040427  TQG.....LS.AE.EIRN.G.NLKAILGLFFSLSRFKQQQQ---------............................
ENSTRUP00000039399  ---.....--.--.----.-.-----------------------------............................
ENSTRUP00000024074  ---.....--.--.----.-.-----------------------------............................
ENSTRUP00000034507  ---.....--.--.----.-.-----------------------------............................
ENSTRUP00000044828  ---.....--.--.----.-.----IRGELSACSLERAATIRRPVNLSRR............................
ENSTRUP00000026384  ---.....--.--.----.-.-------------------VQRSTSFGVP............................
ENSTRUP00000030647  EMC.....LFeSE.DLV-.-.---------------------------LH............................
ENSTRUP00000030455  ---.....--.--.----.-.---------------------------VS............................
ENSTRUP00000002718  ---.....--.--.----.-.-----------------------------............................
ENSTRUP00000012966  ---.....--.--.----.-.-----------------------------............................
ENSTRUP00000011569  ETY.....LFeSE.GLV-.-.---------------------------LH............................
ENSTRUP00000022599  ---.....--.--.----.-.-----------------------------............................
ENSTRUP00000012006  ---.....--.--.----.-.-----------------------------............................
ENSTRUP00000044262  EAY.....LFeSE.DLGK.-.--------------------------VLH............................
ENSTRUP00000022658  ---.....--.--.----.-.-----------------------------............................
ENSTRUP00000006183  QS-.....--.--.----.-.--------------HLCLPLHILEERGLP............................
ENSTRUP00000033505  DVL.....MF.ETnDLVE.RcNEKNFVLCL--------------------............................
ENSTRUP00000042891  QD-.....--.--.----.-.--------------KLCLPHHILEERGLV............................
ENSTRUP00000042426  DAGglk..WN.VK.LIHN.K.DLLATIHLLVAMVKRFQPELELPPDVKVEvvvvevsgrgiksstevevltedrntsa
ENSTRUP00000007438  ESS.....LC.SPyDII-.-.-----------------------------............................
ENSTRUP00000004081  EKAv....CT.CS.DVLL.S.NLSPVLDCVTAL-----------------............................
ENSTRUP00000039254  GAQ.....LF.DPgDLQD.T.S--------------IRANLKDSDCTRKL............................
ENSTRUP00000044157  VSQ.....LF.DPgDLQDlS.T---------------RVTLRHNESKRRL............................
ENSTRUP00000043673  MPH.....IS.AR.DIVD.G.NLKSVMRIILALAAHF-------------............................
ENSTRUP00000026830  DAQ.....LF.HPgDLQDlS.S---------------RVTVKDQETNRRL............................
ENSTRUP00000042409  ---.....--.--.----.-.-----------------------------............................
ENSTRUP00000018397  ---.....--.--.----.-.-----------------------------............................
ENSTRUP00000046423  ---.....--.--.----.-.-----------------------------............................
ENSTRUP00000025795  ---.....--.--.----.-.-----------------------------............................
ENSTRUP00000037515  ---.....--.--.----.-.-----------------------------............................
ENSTRUP00000036137  ---.....--.--.----.-.-----------------------------............................
ENSTRUP00000040733  ---.....--.--.----.-.-----------------------------............................
ENSTRUP00000044413  TF-.....-E.VS.DLLQ.GlNFSKVLNALVAL-----------------............................
ENSTRUP00000012214  GF-.....--.--.----.-.-----------------------------............................
ENSTRUP00000008491  ---.....--.--.----.-.-----------------------------............................
ENSTRUP00000006687  ---.....--.--.----.-.-----------------------------............................
ENSTRUP00000036975  PF-.....-E.AS.DLLL.GlNFSKVLSSLVAL-----------------............................


                                                     390       400       410              420       
                                                       |         |         |                |       
d1pxya_               ............................G...KEMTDADILSWANRKVRTMGRKLQIE.......SFKDKSLSSGLFF
ENSTRUP00000035696  ............................G...GDKSDGIIVNWVNKTLAEAGKSTKIS.......SFKDKEISTSLAV
ENSTRUP00000035893  ............................G...EKVADQIILNWVNTTLSQKNKETQIS.......SFKDQTISTSLPV
ENSTRUP00000025762  ............................Qke.TRSAKDALLLWCQMKTAGY-PNVNIT.......NFT-TSWKDGMAF
ENSTRUP00000042730  ............................E...KKSAKDALLLWCQMKTAGY-PNVNIH.......NFT-TSWRDGLAF
ENSTRUP00000030656  ............................E...KRSAKDALLLWCQMKTAGY-PNVNIH.......NFT-TSWRDGMAF
ENSTRUP00000030008  ............................E...KKSAKDALLLWCQMKTAGYS-NVNIH.......NFT-TSWRDGMAF
ENSTRUP00000010095  ............................E...TRSAKDALLLWCQMKTAGYS-EVNIQ.......NFT-TCWRDGLAF
ENSTRUP00000011270  ............................-...ETSAKEGLLLWCQRKTAPYR-NVNVQ.......NFH-VSWKDGLAF
ENSTRUP00000024799  ............................-...ETSAKEGLLLWCQRKTAPYK-NVNVQ.......NFH-ISWKDGLAF
ENSTRUP00000013924  ............................-...ETSAKEGLLLWCQRKTAPYR-NVNVQ.......NFH-ISWKDGLAL
ENSTRUP00000028024  ............................-...ETSAKEGLLLWCQRKTAPYK-NVNIQ.......NFH-ISWKDGLGF
ENSTRUP00000008717  ............................E...DMSAKEKLLLWSQRISDGYQ-NIRCE.......NFS-TSWRDGKLF
ENSTRUP00000039658  ............................E...DMTAKERLLLWSKQLSDGY-VGVRCE.......NFT-TSWRDGRLF
ENSTRUP00000013131  ............................S...DLSAKEKLLIWSQQATEGY-PGLRCA.......NFT-SCWSDGRMF
ENSTRUP00000004371  ............................Q...QTNSEKILLSWVRQNTRQY-PQVNVV.......NFS-SSWNDGLAF
ENSTRUP00000043448  ............................Etk.KLTPKQRLLGWIQNKV----PQLPIN.......NFN-RDWQDGKAL
ENSTRUP00000012084  ............................E...SKTPKQRLLGWIQNKV----PDLPIT.......NFS-RDWSNGKAL
ENSTRUP00000016429  ...........................kF...QGNAKKALLRWVQSTSAKHH-GIEVK.......DFG-PSWRDGVAF
ENSTRUP00000046695  ............................Q...QTNSEKILLSWVRQCTGPY-PEVNVL.......NFT-TSWADGLAL
ENSTRUP00000046505  ............................R...QGGARKALLRWVQHTAAKR-LGIEVK.......DFG-PSWRTGLAF
ENSTRUP00000014890  .....................aasaamrE...HNKAIKKLLQWVQKQTRRFG--VAVQ.......DFG-KSWMSGLAF
ENSTRUP00000035684  ............................-...--------------------------.......-------------
ENSTRUP00000031038  ............................AsvaHRSAMEALLIWCQRKTAGYS-GVDVK.......DFS-SSWKDGRAF
ENSTRUP00000006363  ....................rptsrpheH...SSVKISLLMDWVRAVCDFYK--VKVE.......NFT-VSFSDGRVL
ENSTRUP00000014209  ...................prgsplhrrF...RVSAKKALLLWVREQCHNR-LHVKRE.......GFK-TSWRSGVVF
ENSTRUP00000008835  lgklflmlywgldhispqisdiqvngqsD...DMTAKEKLLLWSQRMVEGNQ-GLRCD.......NFT-NSWRDGRLF
ENSTRUP00000015270  ...........grherdafdtlfdhapdK...LNVVKKTLITFVNKHLNKLN--LEVT.......ELD-TQFADGVYL
ENSTRUP00000042384  ..........mgrferdafdtlldhapdK...LNVVKTSLITFVNKHLNKLN--LEVT.......ELE-TQFADGVYL
ENSTRUP00000043381  ............................G...QKVTDETIVTWVNETLRQGG-KNTIT.......SFKDPSISSSMPV
ENSTRUP00000023374  ............................-...-NLSRHDMLAWVNDSLHL-----TYT.......KI--EQLCSGAAY
ENSTRUP00000012594  ............................-...--LSRHDMLAWVNDSL-----QLTYT.......KI--EQMCSGTAY
ENSTRUP00000019118  ............................Q...ETMSRHDITAWVNDIL-----CLNYT.......KV--EQLSSGAAY
ENSTRUP00000024584  ............................Q...VQTTLLALASMAKTKGCQTQVDIGVKyadkqerSFDEEKMKAGQCV
ENSTRUP00000013241  ............................-...ENLSRHDMLAWVNDTL-----QLTYT.......KI--EQMCSGTAY
ENSTRUP00000025142  ............................-...--------AGMAKSKGFHSNYDIGVKyaekqqrHFPPEKLREGRNI
ENSTRUP00000004604  ............................Dak.KLTPKQRLLGWIQNKV----PQLPIS.......NFH-RDWRDGKAL
ENSTRUP00000004605  ............................Dak.KLTPKQRLLGWIQNKV----PQLPIS.......NFH-RDWRDGKAL
ENSTRUP00000004542  ............................K...DEGTYQGDPNWFFKKA-----QENKR.......EFSDEQLKAGKNV
ENSTRUP00000030785  ............................-...--------------------------.......-------------
ENSTRUP00000019057  ............................-...--------------------------.......-------------
ENSTRUP00000034885  ............................-...--------------------------.......-------------
ENSTRUP00000019101  ............................S...TPKLASKLLSWCQRQTEGYR-NVRVT.......DLT-MSWKSGLAL
ENSTRUP00000034912  ............................-...--------------------------.......-------------
ENSTRUP00000012578  ............................G...VAPQIQDLLGK---------------.......-------------
ENSTRUP00000010581  ............................N...AKNVKQMLLDWCRAKTEPYE-GVNIQ.......NFS-SSWKDGIAF
ENSTRUP00000011154  ............................-...-------LYGKVNF------------.......-------------
ENSTRUP00000027452  ............................-...RFSQSNQLLRWCQEQTCGYH-GVTVS.......DLT-TSWKSGLAL
ENSTRUP00000013071  ............................D...SASGIKELLAWCQKNTAGYN-KVNVN.......DFS-QSWRSGLAL
ENSTRUP00000040442  ............................-...----VKALQQWCRVQVQGYR-DVSIT.......NMT-TSFRDGLAF
ENSTRUP00000027304  ............................S...ASSIKQILLEWCRSKTVGYQ-NIDIQ.......NFS-SSWSDGMAF
ENSTRUP00000004552  ............................-...QQQYYQSLVE----------------.......-------------
ENSTRUP00000016124  ............................Q...SDVHPGRLLSWCQKQTRGYR-GVVIT.......DLT-SSWRNGLAL
ENSTRUP00000040427  ............................-...--------------------------.......-------------
ENSTRUP00000039399  ............................-...---KRNALLKWCQKKTEGYQ-NIDIT.......NFS-SSWNDGLAF
ENSTRUP00000024074  ............................-...-----KALQEWCRIQCEDYN-DVHIK.......DMS-RSFRDGLAF
ENSTRUP00000034507  ............................-...---AIKALEQWCRAHCDGYR-DVTIT.......NMT-TSFRSGLAF
ENSTRUP00000044828  ............................E...SDVRPSRLLTWCQKQTEGYR-NVSIT.......DLT-SSWISGLAL
ENSTRUP00000026384  ............................N...ANSIKQMLLDWCRAKTRSYE-HVDIQ.......NFS-SSWSNGMAF
ENSTRUP00000030647  ............................K...QPREVCLCLLELGRIASRYN------.......-------------
ENSTRUP00000030455  ............................S...ASGIKQILLEWCRSKTIGYQ-NIDIQ.......NFS-SSWSDGMAF
ENSTRUP00000002718  ............................-...---KRNAPLKWCQKKTEGY-PNIDVT.......NFS-SSWSDGLAF
ENSTRUP00000012966  ............................-...-------LVNWVNNLL-----KTDFK.......DV--QQFGSGACH
ENSTRUP00000011569  ............................K...EPRQVCLCLLELGRIVSRYGVEP---.......-------------
ENSTRUP00000022599  ............................-...----SQSLLEWCQGITDSY-PGVKVT.......NFS-TSWRNGLAF
ENSTRUP00000012006  ............................-...-----QSLLEWCQEVTQGHK-GLKIT.......NFS-TSWRNGLAF
ENSTRUP00000044262  ............................K...QPREVCLCLMELGRTAARYG------.......-------------
ENSTRUP00000022658  ............................-...----LTALRDWCRDACAGY-PDVEIK.......NMS-ASFRDGLAF
ENSTRUP00000006183  ............................Q...VAATVSALLD----------------.......-------------
ENSTRUP00000033505  ............................-...--------------------------.......-------------
ENSTRUP00000042891  ............................K...VGVTVQALL-----------------.......-------------
ENSTRUP00000042426  ............qpeedpidqllkleahK...VNTVKQAILHFINQKVSNLG--LHVV.......DMD-TQFADGVIL
ENSTRUP00000007438  ............................-...--------------------------.......-------------
ENSTRUP00000004081  ............................-...--------------------------.......-------------
ENSTRUP00000039254  ............................Kn..VLNTVFWLGKAASSCTSYSGPALNLK.......-------------
ENSTRUP00000044157  ............................Kn..VLITIYWLG-----------------.......-------------
ENSTRUP00000043673  ............................-...--------------------------.......-------------
ENSTRUP00000026830  ............................Kn..VLITIYWLGR----------------.......-------------
ENSTRUP00000042409  ............................-...--------------------------.......----RDICDGAAL
ENSTRUP00000018397  ............................-...--------------------------.......-------------
ENSTRUP00000046423  ............................-...--------------------------.......-----DVCDGTAL
ENSTRUP00000025795  ............................-...--------------------------.......-------------
ENSTRUP00000037515  ............................-...--------------------------.......-------------
ENSTRUP00000036137  ............................-...-----QDLYAWLDKIP----LSRPKR.......HIT-RDFSDGVLA
ENSTRUP00000040733  ............................-...--------------------------.......----KDLSNGCAI
ENSTRUP00000044413  ............................-...--------------------------.......-------------
ENSTRUP00000012214  ............................-...--------------------------.......-------------
ENSTRUP00000008491  ............................-...--------------------------.......----KDLSSGCAI
ENSTRUP00000006687  ............................-...--------------------------.......----KDLSNGCAI
ENSTRUP00000036975  ............................-...--------------------------.......-------------


                      430       440                                                     450         
                        |         |                                                       |         
d1pxya_               LNLLWAVEPRVVN...WNLVT...........................................KGETD....DEKRL
ENSTRUP00000035696  LELIDAIQPNSIN...YDLVK...........................................TGALSe...DEKLE
ENSTRUP00000035893  IDLIDVIAPGSVK...WDMVK...........................................KTERGflkeDDKIS
ENSTRUP00000025762  NALIHKHRPDLVD...YSSLK...........................................R----....SNPTH
ENSTRUP00000042730  NAIVHKHRPDLID...FENLK...........................................R----....SNAHY
ENSTRUP00000030656  NALIHKHRPDLVD...FDKLK...........................................K----....SNAHY
ENSTRUP00000030008  NALIHKHRPDLID...FDKLK...........................................K----....SNAHY
ENSTRUP00000010095  NALIHRHRPDLIE...FHKLT...........................................R----....SNATH
ENSTRUP00000011270  CALIHRHRPDLLD...YSKLN...........................................K----....DDPLG
ENSTRUP00000024799  NALIHRHRPDLID...YDSLR...........................................K----....DDPVT
ENSTRUP00000013924  CALIHRHRPDLID...YSKLR...........................................K----....DDPIG
ENSTRUP00000028024  CALIHRHRPELID...YGKLR...........................................K----....DDPMT
ENSTRUP00000008717  NAVIHKHYPRLID...MGRVY...........................................H----....QTNLE
ENSTRUP00000039658  NAIIHKYRPDMVD...MTRVS...........................................A----....QTNRS
ENSTRUP00000013131  NALLHRYRPDLID...MEIVS...........................................Q----....QSNQE
ENSTRUP00000004371  NALIHSHRPELFD...WSTVE...........................................RK---....TSVID
ENSTRUP00000043448  GALVDNCAPGLCPd..WADWD...........................................P----....NEPVQ
ENSTRUP00000012084  GALVDSCAPGLCPd..WETWD...........................................P----....VKPVE
ENSTRUP00000016429  QSVVHAIRPDLVD...MDVVR...........................................R----....RSNRE
ENSTRUP00000046695  NSILHHFRPGSFS...WQQVL...........................................R----....MSPVE
ENSTRUP00000046505  FAVIHALRPSLVD...MERVC...........................................R----....RPNRE
ENSTRUP00000014890  LAVIKSIDPSLVD...MRKAL...........................................L----....RSPRE
ENSTRUP00000035684  -------------...-----...........................................-----....-----
ENSTRUP00000031038  NALIHAHRPDLFD...YHRTC...........................................R----....DDSRA
ENSTRUP00000006363  CYLIHHYHPSLLS...DKAVSllttqtvecslrgrleldcsasesdnsfdslpaglngtrqsveFKELL....ENEKS
ENSTRUP00000014209  LTILYALRPDVVD...LSKAR...........................................T----....RSNRQ
ENSTRUP00000008835  NAIIHKLRPNLID...MGLVY...........................................R----....QSNQE
ENSTRUP00000015270  VLLMGLLEGYFVPl..YNFFL...........................................TPENF....DQKVH
ENSTRUP00000042384  VLLMGLLEDYFVPl..YNFFL...........................................TPESF....EQKVH
ENSTRUP00000043381  LDLIDSIQPGSIR...YDLLK...........................................TEDLTe...EEKLN
ENSTRUP00000023374  CQFMDMLFPGCIL...LKKVK...........................................FQAKLe...HEYIH
ENSTRUP00000012594  CQFMDMLFPGCIM...MKKVK...........................................FNAKLe...HEYIH
ENSTRUP00000019118  CQFMDLLFPGCIS...LKKVK...........................................FQAKLe...HEYFH
ENSTRUP00000024584  IGLQMGTNKCASQ...AGMSA...........................................YGTRR....-----
ENSTRUP00000013241  CQFMDMLFPGCIM...MKKVK...........................................FNAKLe...HEYIY
ENSTRUP00000025142  IGLQMGTNKLASQ...KGMTS...........................................YGTRR....-----
ENSTRUP00000004604  GALVDNCAPGLCPd..WETWD...........................................P----....SQPVE
ENSTRUP00000004605  GALVDNCAPGLCPd..WETWD...........................................P----....SQPVE
ENSTRUP00000004542  IGLQMGSNKGASQ...EGMSY...........................................G----....-----
ENSTRUP00000030785  -------------...-----...........................................-----....-----
ENSTRUP00000019057  -------------...-----...........................................-----....-----
ENSTRUP00000034885  -------------...-----...........................................-----....-----
ENSTRUP00000019101  CALIDRYRPDLID...FESLD...........................................E----....KDYEQ
ENSTRUP00000034912  -------------...-----...........................................-----....-----
ENSTRUP00000012578  -------------...-----...........................................-----....-----
ENSTRUP00000010581  CALVHRFFPDAFE...YSTLN...........................................P----....SKPRD
ENSTRUP00000011154  -------------...-----...........................................-----....-----
ENSTRUP00000027452  CALIHRYRPHLMD...FDSLD...........................................P----....MSVED
ENSTRUP00000013071  CALVHRFRPHLID...MSSLD...........................................E----....SNAVY
ENSTRUP00000040442  CALIHKHRPDLIN...FDSLK...........................................K----....ENVYE
ENSTRUP00000027304  CALVHSFFPTEFD...YDSLS...........................................P----....ANRKH
ENSTRUP00000004552  -------------...-----...........................................-----....-----
ENSTRUP00000016124  CALIHHQRPELID...FDSLE...........................................E----....EDVAE
ENSTRUP00000040427  -------------...-----...........................................-----....-----
ENSTRUP00000039399  CAVLHTYLPAHIP...YQELT...........................................S----....QEKRR
ENSTRUP00000024074  CAIIHRFRPELID...FASLS...........................................K----....ENVYE
ENSTRUP00000034507  CALIHNYRPDLID...YDSLR...........................................K----....EDVFE
ENSTRUP00000044828  CALIHRFKPQLID...FDSLH...........................................G----....EDHAA
ENSTRUP00000026384  CALVHNFFPDAFD...YSSLS...........................................P----....SNRRQ
ENSTRUP00000030647  -------------...-----...........................................-----....-----
ENSTRUP00000030455  CALVHSFFPLEFD...YNTLD...........................................A----....RKRKQ
ENSTRUP00000002718  CALLHTYLPAHIP...YQELI...........................................S----....QDKMR
ENSTRUP00000012966  CQIMDWVIPGSVD...MSKVK...........................................FDAQCk...DDYRH
ENSTRUP00000011569  -------------...-----...........................................-----....-----
ENSTRUP00000022599  CAILHHFHPEKID...FETLE...........................................A----....HDIKL
ENSTRUP00000012006  CAILHHFHPKKIN...FEMLD...........................................P----....YDIQH
ENSTRUP00000044262  -------------...-----...........................................-----....-----
ENSTRUP00000022658  CAIIHKHRPDLID...FSALS...........................................K----....DNSYQ
ENSTRUP00000006183  -------------...-----...........................................-----....-----
ENSTRUP00000033505  -------------...-----...........................................-----....-----
ENSTRUP00000042891  -------------...-----...........................................-----....-----
ENSTRUP00000042426  LLLIGQLEGFFIPl..HDFIL...........................................TPCQS....SERLH
ENSTRUP00000007438  -------------...-----...........................................-----....-----
ENSTRUP00000004081  -------------...-----...........................................-----....-----
ENSTRUP00000039254  -------------...-----...........................................-----....-----
ENSTRUP00000044157  -------------...-----...........................................-----....-----
ENSTRUP00000043673  -------------...-----...........................................-----....-----
ENSTRUP00000026830  -------------...-----...........................................-----....-----
ENSTRUP00000042409  LTLVHCYCPDLMK...LEDIC...........................................LKEVPsi..ADSLY
ENSTRUP00000018397  -------------...-----...........................................-----....-----
ENSTRUP00000046423  LAVIHFYCPDLIK...IEDIC...........................................LKEVPsi..SDSVY
ENSTRUP00000025795  -------------...-----...........................................-----....-----
ENSTRUP00000037515  -------------...-----...........................................-----....-----
ENSTRUP00000036137  AEVVKHFLPKLVD...LHNYT...........................................PANST....QQKLT
ENSTRUP00000040733  ASVLHYYCPVLLP...LEDVC...........................................LKDTMsv..ADSVY
ENSTRUP00000044413  -------------...-----...........................................-----....-----
ENSTRUP00000012214  -------------...-----...........................................-----....-----
ENSTRUP00000008491  AAVIHYYCPGLLRleeDVCMK...........................................ESVSV....EDSLY
ENSTRUP00000006687  ASVLHYYCPVLLP...LEDVC...........................................LKDTMsv..ADSVY
ENSTRUP00000036975  -------------...-----...........................................-----....-----


                          460        470              480       490       500                       
                            |          |                |         |         |                       
d1pxya_               N..ATYIVSVARK.LGCS.VFLLPEDIV......EVNQKMILILTASIMYWSL--qr.....................
ENSTRUP00000035696  N..AKYAISMARK.IGAR.VYALPEDLV......EVNQKMVMTVFACLM------.......................
ENSTRUP00000035893  N..AKYAVSLARK.IGAR.VYALPDDLV......EVNPKMVLTLFACLM------.......................
ENSTRUP00000025762  N..LQNAFNAAEQnLGVT.KLLDPEDVFte....NPDEKSIITYVVAFYHY----.......................
ENSTRUP00000042730  N..LQNAFNVAEKeLGLT.KLLDPEDVNvd....QPDEKSIITYVATYYHY----.......................
ENSTRUP00000030656  N..LQNAFNLAEQhLGLT.KLLDPEDISvd....HPDEKSVITYVVTYYHY----.......................
ENSTRUP00000030008  N..LQNAFNLAEQhLGLT.KLLDPEDISvd....HPDEKSIITYVVTYYHYFS--k......................
ENSTRUP00000010095  N..LQLAFNVAEQhLGLT.KLLDPEDVNte....NPDEKSIITYVVSYYHYFS--k......................
ENSTRUP00000011270  N..LNLAFDIAEKhLDIP.KMLDAEDIIntp...KPDERAIMTYVSCFYHAF---.......................
ENSTRUP00000024799  N..LNNAFEVAEKhLDIP.KMLDAEDIVnta...RPDEKAIMTYVSSFYHAF---.......................
ENSTRUP00000013924  N..LNTAFEVAEKfLDIP.KMLDAEDIVntp...KPDEKAIMTYVSCFYHAF---.......................
ENSTRUP00000028024  N..LNTAFDVAEKyLDIP.KMLDAEDIVgta...RPDEKAIMTYVSSFYHAF---.......................
ENSTRUP00000008717  N..LEQAFDVAERdLGVT.RLLDPEDVDvp....HPDEKSIITYVSSLY------.......................
ENSTRUP00000039658  N..LEHAFCAAEQ.LGVP.RLLDPEDVDvq....SPDEKSVITYVSTLY------.......................
ENSTRUP00000013131  N..LEQAFEIAES.LGVT.RLLDAEDVDvp....SPDEKSVITYVSSIY------.......................
ENSTRUP00000004371  K..LEHAFNTAEQhLGID.RLLDPEDLAvp....HPDKKSVIMYVTSLF------.......................
ENSTRUP00000043448  N..AREAMQQADDwLGVP.QVIAPEEIVdp....DVDEHSVMTYLSQF-------.......................
ENSTRUP00000012084  N..ATEAMQLADDwLGIP.QVIAPEEIIdp....SVDEQSVMTYLSQF-------.......................
ENSTRUP00000016429  N..LEEAFALAENeLGIP.RLLDPEDVDvd....KPDEKSIMTYVAQF-------l......................
ENSTRUP00000046695  R..LEHAFTVAKDqLAIE.RLLDPEDVAvq....LPDKKSILMYVTSLF------.......................
ENSTRUP00000046505  N..LKEAFFLAEQeLGVP.QLLDPDDVDvd....KPDEKSIMTYVAQF-------l......................
ENSTRUP00000014890  N..LEEAFRTAHYsLGIP.RLLEPEDVMid....APDEQSIITYVSQFLEHFP--.......................
ENSTRUP00000035684  -..----------.----.---------......---------------------.......................
ENSTRUP00000031038  N..LEHAFSLAEReFGIM.QLLEVDDMAvp....RPDEKSIMTYVSLYYHY----.......................
ENSTRUP00000006363  N..FRLINTAVSFlGGVP.AMINPSDMSnt....IPNEKVVVLYLSFLCARLL--n......................
ENSTRUP00000014209  N..LEEAFRVAESeLRIP.KLLDPDDVDvr....DPDEKSIMTYVAQF-------l......................
ENSTRUP00000008835  N..LEQAFTVAEReLGVT.RLLDPEDVDvp....HPDEKSIITYVSSLY------d......................
ENSTRUP00000015270  N..VSFAFELMQD.GGLErPKPRPEDIV......NCDLKSTLRVLYNLFSRYR--n......................
ENSTRUP00000042384  N..VAFAFELMQD.GGLKkPKARPEDVV......NLNLKSTLRVLYNLFTNYK--n......................
ENSTRUP00000043381  N..AKYAISMARK.IGAR.VYALPEDLV......EVKPKMVMTVFACLM------.......................
ENSTRUP00000023374  N..FKVLQAAFKR.MNVD.KIIPVEKLVkgk...FQ-------------------dnfefvqwfkkffdanydgkeyd
ENSTRUP00000012594  N..FKVLQSSFKK.MDVD.KIVPVERLVkgk...FQDNFEFLQWF----------kkffsanydgkdydpvltr....
ENSTRUP00000019118  N..FKLLQASFKR.MNVD.KIIPVEKLVkgr...FQDNLDFIQWFKKFF------danydgkeydpvaar........
ENSTRUP00000024584  -..----------.----.---------......---------------------.......................
ENSTRUP00000013241  N..FKILQLSFKK.MDVD.KIVPVERLV......---------------------kgkfqdnfeflqwfkkffdanwd
ENSTRUP00000025142  -..----------.----.---------......---------------------.......................
ENSTRUP00000004604  N..AREAMQQADDwLGVP.QVIAPEEIVdp....NVDEHSVMTYLSQFPKAKL--k......................
ENSTRUP00000004605  N..AREAMQQADDwLGVP.QVIAPEEIVdp....NVDEHSVMTYLSQFPKAKL--k......................
ENSTRUP00000004542  -..----------.----.---------......---------------------.......................
ENSTRUP00000030785  -..----------.----.---------......---------------------.......................
ENSTRUP00000019057  -..----------.----.---------......---------------------slavtkddghyrgdhewfhr...
ENSTRUP00000034885  -..----------.----.---------......---------------------diesi..................
ENSTRUP00000019101  N..NQLAFDVAEReFGIS.PCMTGKEMSsvv...EPDKLSMVMYLSQFYEMFKD-.......................
ENSTRUP00000034912  -..----------.----.---------......---------------------fklglapqiqdlygkvdfteeei
ENSTRUP00000012578  -..----------.----.---------......---------------------vafteeeisnmrselekygiqmp
ENSTRUP00000010581  N..FQLAFSTAERlAGCP.PLLDPDDLVrms...EPDWKCVYTYIQEFY------r......................
ENSTRUP00000011154  -..----------.----.---------......---------------------teeeinnmkleldkygihlpafn
ENSTRUP00000027452  N..TQLAFDVAEQeFGIP.PLISVEEMSsag...EPDSLSMVMYLSQFYQLFKD-.......................
ENSTRUP00000013071  N..NQTAFSILEKeLGIP.PVMSARDMAsns...QIDNLSMVFYLTQIQEAF---.......................
ENSTRUP00000040442  N..NKLAFGVAEEeLGIP.ALLDAEDMValq...IPDRLSILTYVSQYYNYF---h......................
ENSTRUP00000027304  N..FELAFGTAEAkAGCD.RLIEVDDMMimgr..KPDPMCVFTYVQSLYNHLR--k......................
ENSTRUP00000004552  -..----------.----.---------......---------------------lsqqts.................
ENSTRUP00000016124  N..NQLAFDIAEReFGIQ.PVIRGEEMAaaa...EPDQLLMVLYLSKFQEAF---r......................
ENSTRUP00000040427  -..----------.----.---------......---------------------q......................
ENSTRUP00000039399  N..FTLAFQAAES.VGIK.CTLDINDMVhte...RPDWQSVMTYVTAIYKYF---.......................
ENSTRUP00000024074  N..NHLAFDVAETqLGIP.ALLDPEDMVsmk...VPDRLSIITYVSQYYNFF---.......................
ENSTRUP00000034507  NnrLTKAFQVAEEkLGIP.ALLDAEDMValk...IPDRLSILTYVSQYYNYF---.......................
ENSTRUP00000044828  N..LQLAFDVSEReFGFR.PFTSVEELHggq...ELDKTKMITYLSKFYELF---r......................
ENSTRUP00000026384  N..FEVAFSAAEKlVDCP.QLLDVDDMVkmr...EPDWK----------------t......................
ENSTRUP00000030647  -..----------.----.---------......---------------------veppgliklekeieqeer.....
ENSTRUP00000030455  N..LELAFSTAEKqADCL.RLIEVDDMLemgd..KPDPMCVFTYVQALYNHLKK-.......................
ENSTRUP00000002718  N..LTLAFQAAES.IGIR.PSLDMEELMrtd...RPDWQSVMLYVK---------iy.....................
ENSTRUP00000012966  N..FSLLCDAFRN.NSIT.RTVPVENLI......IGDFQSNLDLLRWL-------ksfyttnvrdeeydpvkar....
ENSTRUP00000011569  -..----------.----.---------......---------------------pvlvklekeieleesr.......
ENSTRUP00000022599  N..NKKAFDGFEA.LGIS.RLLEPSDLVlls...VPDRLIVMTYISQIRSHF---.......................
ENSTRUP00000012006  N..NKKAFDGFAE.LGIS.RLMEPSDMVmpp...VPDRLIVMTYLNQIRTHF---.......................
ENSTRUP00000044262  -..----------.----.---------......---------------------veppglvklereeagksplsp..
ENSTRUP00000022658  N..NQLAFETAEK.LGIP.ALLHPKELAcse...VPDSLGVITYLFWYFCFF---.......................
ENSTRUP00000006183  -..----------.----.---------......---------------------la.....................
ENSTRUP00000033505  -..----------.----.---------......---------------------levarrgskfgmlapmliqleee
ENSTRUP00000042891  -..----------.----.---------......---------------------.......................
ENSTRUP00000042426  N..MTLAFDLLHD.TDLHvASISPQDIV......SQDITAT--------------lkilyalf...............
ENSTRUP00000007438  -..----------.----.---------......---------------------qcrlqpvcttvqvlvs.......
ENSTRUP00000004081  -..----------.----.---------......---------------------l......................
ENSTRUP00000039254  -..----------.----.---------......---------------------e......................
ENSTRUP00000044157  -..----------.----.---------......---------------------rkahldafysgp...........
ENSTRUP00000043673  -..----------.----.---------......---------------------.......................
ENSTRUP00000026830  -..----------.----.---------......---------------------raqcdqlydgpyln.........
ENSTRUP00000042409  N..IQLLREFANEyLNKS.FYLTIEDMLysp...LVLKHNIMVFIAELFWWFET-vkpefvq................
ENSTRUP00000018397  -..----------.----.---------......---------------------v......................
ENSTRUP00000046423  N..IHLLKEFSNEyLNKC.FHLKPEDMLysp...PVLKNNVMVFIAELFWWFE--svkpefvq...............
ENSTRUP00000025795  -..----------.----.---------......---------------------flvfmaelfwwfe..........
ENSTRUP00000037515  -..----------.----.---------......---------------------asiksnylvfmaelfwwfe....
ENSTRUP00000036137  N..WD--------.----.---------......---------------------v......................
ENSTRUP00000040733  N..LQLIREFCESsLQSC.CPLAVEDLLyap...PPLHLNIMSFISELLHWFE--vkkpdf.................
ENSTRUP00000044413  -..----------.----.---------......---------------------nkateglg...............
ENSTRUP00000012214  -..----------.----.---------......---------------------epdwlytgenfgkvlttllavnf
ENSTRUP00000008491  N..LQFIREFCDScLKNC.CHLALEDMLyipqelQINWLSFLAEL----------lcwfe..................
ENSTRUP00000006687  N..LQLIREFCESsLQSC.CPLAVED--......---------------------lly....................
ENSTRUP00000036975  -..----------.----.---------......---------------------nkvtadisvg.............


                                        
                                        
d1pxya_               ..................
ENSTRUP00000035696  ..................
ENSTRUP00000035893  ..................
ENSTRUP00000025762  ..................
ENSTRUP00000042730  ..................
ENSTRUP00000030656  ..................
ENSTRUP00000030008  ..................
ENSTRUP00000010095  ..................
ENSTRUP00000011270  ..................
ENSTRUP00000024799  ..................
ENSTRUP00000013924  ..................
ENSTRUP00000028024  ..................
ENSTRUP00000008717  ..................
ENSTRUP00000039658  ..................
ENSTRUP00000013131  ..................
ENSTRUP00000004371  ..................
ENSTRUP00000043448  ..................
ENSTRUP00000012084  ..................
ENSTRUP00000016429  ..................
ENSTRUP00000046695  ..................
ENSTRUP00000046505  ..................
ENSTRUP00000014890  ..................
ENSTRUP00000035684  ..................
ENSTRUP00000031038  ..................
ENSTRUP00000006363  ..................
ENSTRUP00000014209  ..................
ENSTRUP00000008835  ..................
ENSTRUP00000015270  ..................
ENSTRUP00000042384  ..................
ENSTRUP00000043381  ..................
ENSTRUP00000023374  pllar.............
ENSTRUP00000012594  ..................
ENSTRUP00000019118  ..................
ENSTRUP00000024584  ..................
ENSTRUP00000013241  gkdydpvltr........
ENSTRUP00000025142  ..................
ENSTRUP00000004604  ..................
ENSTRUP00000004605  ..................
ENSTRUP00000004542  ..................
ENSTRUP00000030785  ..................
ENSTRUP00000019057  ..................
ENSTRUP00000034885  ..................
ENSTRUP00000019101  ..................
ENSTRUP00000034912  nnmkselekygiqmpafs
ENSTRUP00000012578  afs...............
ENSTRUP00000010581  ..................
ENSTRUP00000011154  ..................
ENSTRUP00000027452  ..................
ENSTRUP00000013071  ..................
ENSTRUP00000040442  ..................
ENSTRUP00000027304  ..................
ENSTRUP00000004552  ..................
ENSTRUP00000016124  ..................
ENSTRUP00000040427  ..................
ENSTRUP00000039399  ..................
ENSTRUP00000024074  ..................
ENSTRUP00000034507  ..................
ENSTRUP00000044828  ..................
ENSTRUP00000026384  ..................
ENSTRUP00000030647  ..................
ENSTRUP00000030455  ..................
ENSTRUP00000002718  ..................
ENSTRUP00000012966  ..................
ENSTRUP00000011569  ..................
ENSTRUP00000022599  ..................
ENSTRUP00000012006  ..................
ENSTRUP00000044262  ..................
ENSTRUP00000022658  ..................
ENSTRUP00000006183  ..................
ENSTRUP00000033505  ieee..............
ENSTRUP00000042891  ..................
ENSTRUP00000042426  ..................
ENSTRUP00000007438  ..................
ENSTRUP00000004081  ..................
ENSTRUP00000039254  ..................
ENSTRUP00000044157  ..................
ENSTRUP00000043673  ..................
ENSTRUP00000026830  ..................
ENSTRUP00000042409  ..................
ENSTRUP00000018397  ..................
ENSTRUP00000046423  ..................
ENSTRUP00000025795  ..................
ENSTRUP00000037515  ..................
ENSTRUP00000036137  ..................
ENSTRUP00000040733  ..................
ENSTRUP00000044413  ..................
ENSTRUP00000012214  atqgktfar.........
ENSTRUP00000008491  ..................
ENSTRUP00000006687  ..................
ENSTRUP00000036975  ..................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0042512 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Caenorhabditis elegans 57 (pseudogenes) - Roundworm
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Bathycoccus prasinos
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Cyanidioschyzon merolae strain 10D 22
NoYes   Cyanidioschyzon merolae
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Giardia lamblia 2.3
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Ichthyophthirius multifiliis strain G5
NoYes   Cryptosporidium hominis
NoYes   Cryptosporidium muris
NoYes   Cryptosporidium parvum Iowa II
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Babesia bovis T2Bo
NoYes   Theileria parva
NoYes   Theileria annulata
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Plasmodium yoelii ssp. yoelii 1
NoYes   Plasmodium chabaudi
NoYes   Plasmodium berghei ANKA
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Methanococcus vannielii SB
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Cryptococcus neoformans var. grubii H99
NoYes   Cryptococcus neoformans B-3501A
NoYes   Cryptococcus neoformans JEC21
NoYes   Paracoccidioides brasiliensis Pb01
NoYes   Paracoccidioides brasiliensis Pb03
NoYes   Coccidioides posadasii str. Silveira
NoYes   Coccidioides immitis RMSCC 3703
NoYes   Coccidioides immitis RMSCC 2394
NoYes   Coccidioides immitis H538.4
NoYes   Ajellomyces dermatitidis ER-3
NoYes   Histoplasma capsulatum H143
NoYes   Histoplasma capsulatum H88
NoYes   Histoplasma capsulatum G186AR
NoYes   Aspergillus fumigatus A1163
NoYes   Candida albicans WO-1
NoYes   Saccharomyces cerevisiae UC5
NoYes   Saccharomyces cerevisiae PW5
NoYes   Saccharomyces cerevisiae FL100
NoYes   Saccharomyces cerevisiae CLIB382
NoYes   Saccharomyces cerevisiae CLIB324
NoYes   Saccharomyces cerevisiae CBS7960
NoYes   Saccharomyces cerevisiae YJM269
NoYes   Saccharomyces cerevisiae T7
NoYes   Saccharomyces cerevisiae FostersB
NoYes   Saccharomyces cerevisiae FostersO
NoYes   Saccharomyces cerevisiae VL3
NoYes   Saccharomyces cerevisiae Vin13
NoYes   Saccharomyces cerevisiae LalvinQA23
NoYes   Saccharomyces cerevisiae AWRI796
NoYes   Saccharomyces cerevisiae Sigma1278b
NoYes   Saccharomyces cerevisiae W303
NoYes   Saccharomyces cerevisiae JAY291
NoYes   Saccharomyces cerevisiae AWRI1631
NoYes   Saccharomyces cerevisiae YPS163
NoYes   Saccharomyces cerevisiae M22
NoYes   Saccharomyces cerevisiae T73
NoYes   Saccharomyces cerevisiae CLIB215
NoYes   Saccharomyces cerevisiae Y10
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae SGD - Baker's yeast
NoYes   Schizosaccharomyces pombe 972h-
NoYes   Batrachochytrium dendrobatidis JEL423
NoYes   Batrachochytrium dendrobatidis JAM81
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Trypanosoma brucei Lister 427 v4.1
NoYes   Neospora caninum Nc-Liverpool 6.2
NoYes   Plasmodium falciparum HB3
NoYes   Plasmodium falciparum Dd2
NoYes   Staphylococcus pasteuri SP1
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Caenorhabditis elegans 69_215 - Roundworm
NoYes   Saccharomyces cerevisiae 69_4 - Baker's yeast
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Heliconius numata
NoYes   Loa loa v3.3 - Eye worm
NoYes   Wuchereria bancrofti v1.0 - Agent of lymphatic filariasis
NoYes   Brugia malayi v1.0 - Agent of lymphatic filariasis
NoYes   Moniliophthora perniciosa FA553
NoYes   Encephalitozoon intestinalis
NoYes   Encephalitozoon cuniculi
NoYes   Picea sitchensis - Sitka spruce
NoYes   Lotus japonicus
NoYes   Malus x domestica - Apple
NoYes   Ricinus communis - Castor bean
NoYes   Nicotiana benthamiana 0.4.4
NoYes   Solanum pimpinellifolium A-1.0 - Currant tomato
NoYes   Solanum lycopersicum v2.3 - Tomato
NoYes   Phoenix dactylifera - Date palm
NoYes   1_Upper_euphotic (meta-genome)
NoYes   6_Upper_euphotic (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 1 (meta-genome)
NoYes   Atta cephalotes fungus garden (ACEF) (meta-genome)
NoYes   Dendroctonus ponderosae beetle community (MPB hybrid beetle) (Lodgepole pine) (meta-genome)
NoYes   Dump bottom (Dump bottom) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP16 from Fairy Spring Red Layer (meta-genome)
NoYes   Maize field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing corn (Zea may (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 4 Nevada Test Site Crust CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+ (Oak Ridge elevated CO2) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- (Oak Ridge ambient) (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Uniprot 2018_03 genome
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]