SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from Please contact us if you experience any problems.

DEATH domain alignments in Nomascus leucogenys 76_1.0

These alignments are sequences aligned to the 0045697 model.

Sophisticated options are available for refining alignments:

Jump to [ Top of page · Refine alignments · Add alignments from genomes ]


The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

d1a1za_               ..............................................................................
ENSNLEP00000021784  mnkpitpstyvrclnvglirklsdfidpqegwkklavaikkpsgddrynqfhirrfeallqtgk..............
ENSNLEP00000014908  etvainlsdvdlskyittiagvmtlsqvkgfvrkngvneakideikndnvqdtaeqkvq...................
ENSNLEP00000016374  ..............................................................................
ENSNLEP00000012731  ..............................................................................
ENSNLEP00000008474  ..............................................................................
ENSNLEP00000013011  sffsdfglmwyleelkkeefrkfkehlkqmtlhlelkqipwtevkkas..............................
ENSNLEP00000003904  ncgargalsahtllfdlppallgelcavldscdgalgwrglterlssswldvrhiekyvdqgksgtrellwswaq...
ENSNLEP00000012932  sffsdfgllwylk.................................................................
ENSNLEP00000012931  sffsdfgllwylk.................................................................
ENSNLEP00000021218  sffpdfglll....................................................................
ENSNLEP00000006463  gagsaapvsstsslplaalnmrvrrrlslflnvrtqvaadwtalaeemdfeyleirqlethadptgrlldawqgrpga
ENSNLEP00000014849  pqspcertdirmaivadhlglswtelarel................................................
ENSNLEP00000004404  dtddpatlyavvenvpplrwkefvrrlglsdheidrlelqngrclreaqysmlaawrrrtpr................
ENSNLEP00000009264  mdeadrrllrrcrlrlveelqvdqlwdallsrelfrphmiediqragsgsrrd.........................
ENSNLEP00000008472  ..............................................................................
ENSNLEP00000019830  qerieerlayiadhlgfswtelareldftee...............................................
ENSNLEP00000013044  tfssyglqwcly..................................................................
ENSNLEP00000005171  mast..........................................................................
ENSNLEP00000008783  dkvlkekrklfirsmgegtin.........................................................
ENSNLEP00000011730  maktpsdhllstl.................................................................
ENSNLEP00000013466  nttsltdehldpirenlgkhwkncarklgftqsqideidhdyerdglkekvyqmlqkwv...................
ENSNLEP00000007362  mdakarncllqhrealekdiktsyimdhmisdgfltiseeekvrneptqqqraamlikmilkk...............
ENSNLEP00000006922  meardkqvlrslrlelgaevlveglv....................................................
ENSNLEP00000024416  meardkqvlrslrlelgaevlveglv....................................................
ENSNLEP00000024076  atlnrlrepllrrlserldqapegrgwrrlaelagsrgrlrlscldleqcslkvlepegspslcllklmgekgc....
ENSNLEP00000010142  atlnrlrepllrrlserldqapegrgwrrlaelagsrgrlrlscldleqcslkvlepegspslcllklmgekgc....
ENSNLEP00000008328  espdvrrdkpvtgeqievfanklgeqwkilapylemkdseirqiecdsedmkmrakqllvawqdqegvhatpen....
ENSNLEP00000019741  mgrardaildal..................................................................
ENSNLEP00000007510  rlstyleeleavelkkfklylgtvtelgegkipwgrmetagplemaqllithfgpeeaw...................
ENSNLEP00000003849  mhphhqetlkknrvvlakqlllsellehllekd.............................................
ENSNLEP00000008469  ..............................................................................
ENSNLEP00000019756  afkiplsirqkicnsldapnsrgndwrmlaqklsmdrylnyfatkasptgvil.........................
ENSNLEP00000015448  tdqpemkm......................................................................
ENSNLEP00000008730  qddlslirknrmalfqq.............................................................
ENSNLEP00000012957  pmgfn.........................................................................
ENSNLEP00000011124  maggawgrlacyle................................................................
ENSNLEP00000008729  sndlllirknrkalfqhltcv.........................................................
ENSNLEP00000012221  ltevkkdalenlrvylcekiiaerhfdhlr................................................
ENSNLEP00000017996  edalweriegvrhrlaral...........................................................
ENSNLEP00000012902  edalwenvecnrhmlsr.............................................................
ENSNLEP00000023519  edalwenvecnrhmlsr.............................................................
ENSNLEP00000019750  mgtkr.........................................................................
ENSNLEP00000019277  adptetlmlffdkfanivpfdswdqlmrqldltkneidvvragtagpgdalyamlmkwvnk.................
ENSNLEP00000010515  aetgfltqsnllsvagrlgpdwpavalhlgmsyrelqrirhefrddldgqi...........................
ENSNLEP00000006922  ilnsspsdrqinqlaqrlgpewepvvlslglsqtdiyrckanhp..................................
ENSNLEP00000024416  ilnsspsdrqinqlaqrlgpewepvvlslglsqtdiyrckanhp..................................
ENSNLEP00000015259  afkipflirqkiissldppcsrgadwrtlaqklhldshlsffaakp................................
ENSNLEP00000013019  qgllpylmaldqyqleefklcleprqlmdfwsapqghfpcipwa..................................
ENSNLEP00000019081  nfikdnsraliqrmgmtvikqitddlfvwnvlyceevniicc....................................
ENSNLEP00000010361  pqlydvmdavparrwkefvrtlglreaeieaveveigrfrdqq...................................
ENSNLEP00000013036  cengvmlymr....................................................................
ENSNLEP00000020027  estpseiiererkklleilqhdpd......................................................
ENSNLEP00000009959  decwsvlegfrvtltsvidpsri.......................................................
ENSNLEP00000012963  dstdfdll......................................................................
ENSNLEP00000006142  pcnrlppelfeq..................................................................
ENSNLEP00000008474  ..............................................................................
ENSNLEP00000014726  afkipysirqricatfdtpnakgkdwqmlaqknsinrnlsyfat..................................
ENSNLEP00000019253  ptetlrqcfddfavivpfdsweplmrklglmdneikvakaeaaghrdtlytmlikwvnktgrd...............
ENSNLEP00000015252  rqetqqlrsvlwrlasrylqprewkklayswefteahvyaieqqwtg...............................
ENSNLEP00000021250  arnpr.........................................................................
ENSNLEP00000018394  hphiqllksnrellvthirntqclvdnllkndyfs...........................................
ENSNLEP00000023706  hphiqllksnrellvthirntqclvdnllkndyfs...........................................
ENSNLEP00000018960  etlwemmeshrhrivrcvcpsr........................................................
ENSNLEP00000006433  asdlnlltrrklsrlldppdplgkdwcllamnlglpdlvakyntnngapkdflpsp......................
ENSNLEP00000019741  kpdlhfidqhraaliarvtnveclldalygkvlmeeqyqav.....................................
ENSNLEP00000015970  ykeillltgl....................................................................
ENSNLEP00000002409  qqwiqskredivnqmteaclnqsldallsrdlimked.........................................
ENSNLEP00000011124  prllhfvdqyreqliarvtsvevvldklhgqvlsqeqyervlaedtrpsqmrk.........................
ENSNLEP00000008777  gnhrkkplkmleslgkdfltgvldnlveqnvl..............................................
ENSNLEP00000016247  mkqlaedvklqlyklleipdpdknwatlaqklglgilnnafrlspapsktl...........................
ENSNLEP00000008472  ..............................................................................
ENSNLEP00000023448  tfarsvglkwrkvgrslqrgcralrdpaldslayeyereglyeqafqllrrfvqaegr....................
ENSNLEP00000005236  tfarsvglkwrkvgrslqrgcralrdpaldslayeyereglyeqafqllrrfvqaegr....................
ENSNLEP00000020646  lw............................................................................
ENSNLEP00000020648  lw............................................................................
ENSNLEP00000005921  frfavptkftpnwlsvlvdnlpgtkvnaesverikrr.........................................
ENSNLEP00000017056  s.............................................................................
ENSNLEP00000005196  afvgsqwkdiyqflcnaserevaafsngytadherayaalqhwtirgpe.............................
ENSNLEP00000012889  ls............................................................................
ENSNLEP00000023198  ls............................................................................
ENSNLEP00000016705  livrdqtelrlcersgqrtasvlwpwinrn................................................
ENSNLEP00000018358  slgdtalqnleqlldgpeaqgswaelaerlglrslvdtyrqtaspsg...............................
ENSNLEP00000008781  mlkylgkdvl....................................................................
ENSNLEP00000006370  spetrhirtllwdlayhq............................................................
ENSNLEP00000008469  v.............................................................................
ENSNLEP00000012745  mepqrrellaqcqqslaqamt.........................................................
ENSNLEP00000005921  eqlrslmeslpgkkvgaediek........................................................
ENSNLEP00000003928  kldpchptvknwrnfaskwgmsydelcfleqrpqsptlefllrn..................................
ENSNLEP00000017135  afsiplpirqklcssldapqtrgh......................................................
ENSNLEP00000012731  dlcaafnvicdnvgkdwrrlarqlkvsdtkidniedryprnltervres.............................
ENSNLEP00000013766  evleelivlldpepgpgggmahgttrhlaaryglpaawstfayslrpsrsplraliemvvarepsa............
ENSNLEP00000024220  evleelivlldpepgpgggmahgttrhlaaryglpaawstfayslrpsrsplraliemvvarepsa............

                               10          20        30                       40        50          
                                |           |         |                        |         |          
ENSNLEP00000021784  .-----------------S..--------------..---.......----......-----------------..--
ENSNLEP00000014908  .------------------..--------------..---.......----......--------LLRNWHQLHgkKD
ENSNLEP00000013011  .------------------..--------------..---.......----......--REELANLLIK-HYEE..QQ
ENSNLEP00000003904  .------------------..--------------..---.......--KN......KTVGDLLQVLQEM----..--
ENSNLEP00000021218  .--------Y--LEELNKE..ELNTFKLFLKETME..PEH.......----......-----------------..--
ENSNLEP00000006463  s------------------..--------------..---.......----......-----------------..--
ENSNLEP00000014849  .------------------..------NFSVDEIN..QIR.......VENP......NSLISQSFMLLKKWVTR..DG
ENSNLEP00000004404  .------------------..--------------..---.......----......-----------------..--
ENSNLEP00000009264  .------------------..--------------..---.......----......-Q---------------..--
ENSNLEP00000019830  .------------------..-----------QIH..QIR.......IENP......NSLQDQSHALLKYWLER..DG
ENSNLEP00000013044  .-------------ELDKE..EFQTFKELLKKKSS..EST.......TC--......-----------------..--
ENSNLEP00000008783  .------------------..--------------..---.......----......----GLLDELLQTRVLN..QE
ENSNLEP00000011730  .------------EELVPY..DFEKFKFKLQNTSV..EKE.......HSR-......-----------------..--
ENSNLEP00000013466  .------------------..--------------..---.......----......-----------MREGIK..GA
ENSNLEP00000007362  .------------------..--------------..---.......----......----------------D..--
ENSNLEP00000006922  .------------------..--------------..---.......----......------LQYLYQEGILT..EN
ENSNLEP00000024416  .------------------..--------------..---.......----......------LQYLYQEGILT..EN
ENSNLEP00000024076  .------------------..--------------..---.......--TV......TELSDFLQAMEHTE---..--
ENSNLEP00000010142  .------------------..--------------..---.......--TV......TELSDFLQAMEHTE---..--
ENSNLEP00000008328  .------------------..--------------..---.......----......-----------------..--
ENSNLEP00000019741  .------------ENLTAE..ELKKFKLKLLSVPL..REG.......YG--......-----------------..--
ENSNLEP00000007510  .------------------..--------------..---.......----......-----------------..--
ENSNLEP00000003849  .------------------..----IITLEMRELI..QAK.......VGSF......SQNVELLNLLPKR----..--
ENSNLEP00000019756  .------------------..--------------..---.......----......--------DLWEALQQD..DG
ENSNLEP00000008730  .------------------..--------------..---.......---L......TCVLPILDNLLKANVIN..KQ
ENSNLEP00000012957  .-------LPALLEQLSQD..ELSKFKSLITTVSL..ANE.......LQKI......-----------PHKEVD..KA
ENSNLEP00000011124  .-------------FLKKE..ELKEFQLLLANKAH..SRS.......----......-----------------..--
ENSNLEP00000008729  .------------------..--------------..---.......----......---IPILDSLLTARIIN..EQ
ENSNLEP00000012221  .------------------..--------------..---.......----......-----------AKKILS..RE
ENSNLEP00000017996  .------------------..--------------..---.......----......-NPAKLTPYLRQCRVID..EQ
ENSNLEP00000012902  .------------------..--------------..---.......---Y......INPAKLTPYLRQCKVID..EQ
ENSNLEP00000023519  .------------------..--------------..---.......---Y......INPAKLTPYLRQCKVID..EQ
ENSNLEP00000019750  .-----EAILKVLENLTPE..ELKKFKMKLGTVPL..REG.......FERI......PR---------------..--
ENSNLEP00000019277  .------------------..--------------..TGR.......NASI......HTLLDALERLEER----..--
ENSNLEP00000010515  .------------------..--------------..---.......----......---RHMLFSWAERQAGQ..PG
ENSNLEP00000006922  .------------------..--------------..H--.......----......-----------------..--
ENSNLEP00000024416  .------------------..--------------..H--.......----......-----------------..--
ENSNLEP00000015259  .------------------..--------------..---.......----......-SPTAMILNLWEARHFP..NG
ENSNLEP00000013019  .-------------NLRAA..DPLNLSFLLDEHFP..KGQ.......AW--......KVVLGIFQTM-------..--
ENSNLEP00000019081  .------------------..--------------..-E-.......----......-----------------..--
ENSNLEP00000010361  .------------------..---------Y----..---.......----......-----------------..--
ENSNLEP00000013036  .-------------NVSNE..DLQWFKQFLLNELS..AGT.......----......-----------------..--
ENSNLEP00000020027  .------------------..--------------..---.......----......----SILDTLTSRRLIS..EE
ENSNLEP00000009959  .------------------..--------------..---.......----......------TPYLRQCKVLN..PD
ENSNLEP00000006142  .------------------..--------------..---.......----......------LRMLLEPNSIT..GN
ENSNLEP00000014726  .------------------..--------------..---.......---Q......SSPSAVILNLWEARHQH..DG
ENSNLEP00000019253  .------------------..--------------..---.......----......A----------------..--
ENSNLEP00000015252  .------------------..--------------..-TR.......SYQE......HGHRMLLIWLHGVATAD..EN
ENSNLEP00000021250  .-----EALLWALSDLEEN..DFKKLKFYLRDMTL..---.......----......-----------------..--
ENSNLEP00000018394  .------------------..--------------..---.......----......-----------------..A-
ENSNLEP00000023706  .------------------..--------------..---.......----......-----------------..A-
ENSNLEP00000018960  .------------------..--------------..---.......LTPY......LRQAKVLCQLDEEEVLH..SP
ENSNLEP00000006433  .------------------..--------------..---.......----......-----LHALLREWTTYP..ES
ENSNLEP00000019741  .------------------..--------------..---.......----......--------------R--..--
ENSNLEP00000015970  .------------DNITDE..ELDRFKFFLSDEFNiaTGK.......LH--......-----------------..--
ENSNLEP00000002409  .------------------..--------------..---.......----......-----------------..--
ENSNLEP00000011124  .-------LF---------..--------------..---.......----......-----------------..--
ENSNLEP00000008777  .------------------..--------------..---.......----......----------------N..--
ENSNLEP00000016247  .------------------..--------------..---.......----......----------MDNYEVS..GG
ENSNLEP00000023448  .----RATLQRLVEALEEN..ELTSL---------..---.......----......-----------------..--
ENSNLEP00000005236  .----RATLQRLVEALEEN..ELTSL---------..---.......----......-----------------..--
ENSNLEP00000005921  .------------------..--------------..---.......----......HSSQEQTFQLLKLWKHQ..NK
ENSNLEP00000005196  .------------------..--------------..---.......----......-----------------..-A
ENSNLEP00000016705  .------------------..--------------..---.......----......ARVADLVHILTHLQLLR..AR
ENSNLEP00000018358  .------------------..--------------..---.......----......--------S--------..--
ENSNLEP00000008781  .------------------..--------------..---.......----......---HGVFNYLAKHDVLT..--
ENSNLEP00000006370  .--------------L---..--------------..---.......----......-----------------..--
ENSNLEP00000012745  .------------------..--------------..---.......----......-EVEAVLGLLEAAGALS..PG
ENSNLEP00000005921  .------------------..--------------..---.......TTKA......CKSSDQILKLLSLWRIK..NG
ENSNLEP00000003928  .------------------..--------------..---.......----......----------------S..QR
ENSNLEP00000017135  .------------------..--------------..---.......----......-----------------..--
ENSNLEP00000012731  .------------------..--------------..---.......----......---L-------------..--
ENSNLEP00000013766  .------------------..--------------..---.......----......-----------------..--
ENSNLEP00000024220  .------------------..--------------..---.......----......-----------------..--

                         60        70        80                                                     
                          |         |         |                                                     
d1a1za_               H...TELLRELLASLRRHDLLRRVDDFE..................................................
ENSNLEP00000021784  -...------------------------ptsellfdwgttnctvgdlvdlliqneffapaslllpdavpktantlps.
ENSNLEP00000014908  A...YDTLIKGLKKANLCTLAEKI----qtiilkditsdsensnfgneiqsl..........................
ENSNLEP00000016374  N...LSYIEHIFEISRRPDLLTMVVDYRtrvlkiseedeldtkltripsakkykdiirqpseeeiiklap........
ENSNLEP00000012731  R...TELLRELLASLRRHDLLRRVDDFEagaaagaapgeedlcaafnvicdnvgkdwrrlarqlkvsdtkidniedry
ENSNLEP00000008474  N...LSFLKELLFRINRLDLLIAYL---ntrkeemerelqtpgraqisayrvmlyqiseevs................
ENSNLEP00000013011  A...WNITLRIFQKLDRKDLCMKV----mrert.............................................
ENSNLEP00000003904  -...------------------------ghrraihlitnyg.....................................
ENSNLEP00000012932  A...WEVTLNLFLQINRKDLWTK-----aqeemrn...........................................
ENSNLEP00000012931  A...WEVTLNLFLQINRKDLWTK-----aqeemrn...........................................
ENSNLEP00000021218  -...------------------------gltpwtevkkarredlanlmkkyypgekawsvslkifgkmnlkdlcerak
ENSNLEP00000006463  -...VGRLLELLTKLGRDDVL-------lelgpsieedcqkyilkqqq..............................
ENSNLEP00000014849  KnatTDALTSVLTKINRIDIVTLLE---gpifdygnisgtrsfadennvf............................
ENSNLEP00000004404  R...------------------------eatlellgrvlrdmdllgcledieealcgp....................
ENSNLEP00000009264  -...------------------------arqliidletrgsqalplfiscledtgqdmlasflrtn............
ENSNLEP00000008472  D...PFFLAELLYIIRQKKLLQHLS---ctkeeverllptrqrvslfrnllyelseg.....................
ENSNLEP00000019830  KhatDTNLVECLTKINRMDIVHLME---tnteplqerishsyaeieqtitld..........................
ENSNLEP00000013044  -...------------------------sipqfeienanveclalllheyygaslawatsisifenmnlrtlsekard
ENSNLEP00000005171  A...WAMAVWIFAAINRRDLYE------kakrd.............................................
ENSNLEP00000008783  E...M-----------------------ekvkrenatvmdktralidsvtpkgaqacqicityiceedkylaqtlgl.
ENSNLEP00000011730  -...------------------------iprsqiqrarpvkmatllvtyygeeyavqltlqvlrainqrllaeelhra
ENSNLEP00000013466  T...VGKLAQALHQCSRIDLLNNL----i.................................................
ENSNLEP00000007362  -...------------------------ndsyvsfynallhegykdlaallhdgip......................
ENSNLEP00000006922  H...VQE---------------------inaqttglrktmllldilpsrgpkafdafldslqefpwvreklkkar...
ENSNLEP00000024416  H...VQE---------------------inaqttglrktmllldilpsrgpkafdafldslqefpwvreklkkar...
ENSNLEP00000024076  -...------------------------vlqllsppgikitinpeskav.............................
ENSNLEP00000010142  -...------------------------vlqllsppgikitinpeskav.............................
ENSNLEP00000008328  -...---L--------------------inalnksglsdlaesltn................................
ENSNLEP00000019741  -...------------------------riprgallsmdaldltdklvsfyleaygaeltanvlrdmglqemagqlqa
ENSNLEP00000007510  -...-RLALSTFERMNRKDL--------wergqre...........................................
ENSNLEP00000003849  -...------------------------gpqafdafcealretkqghledvlltt.......................
ENSNLEP00000008469  Q...LDLLEKCLKNIHRIDLKTKIQKYKqsvqgagtsyknvlqaaiqkslkd..........................
ENSNLEP00000019756  D...LNSLASALEEM-------------gksemlv...........................................
ENSNLEP00000015448  Q...NAKMENLCTALQSID---------rgeivnmle.........................................
ENSNLEP00000008730  E...HDIIKQ------------------ktqiplqarelidtilvkgnaaanifknclkeidstlyknlfvdknmkyi
ENSNLEP00000012957  D...RKQLAEILT---------------shchsywvematiqvfekmhrmdlsesakdelr.................
ENSNLEP00000011124  -...------------------------ssgetptqpektsgmevasylvaqygeqrawdlalhtweqmglrslcaqa
ENSNLEP00000008729  E...HDVIK-------------------qktqtslqarelidtilvkgniaatvfrnslqeadavlyehlfvqqdiky
ENSNLEP00000012221  D...------------------------teeiscrtssrkragklldylqenpkgldtlvesirrektqnfliqkitd
ENSNLEP00000017996  D...EEEVL-------------------styrfpcrvnrtgrlmdilrcrgkrgyeaflealefyypehftlltgqep
ENSNLEP00000012902  D...EDE---------------------vlnapmlpskinragrlldilhtkgqrgyvvfleslefyypelyklvtgk
ENSNLEP00000023519  D...EDE---------------------vlnapmlpskinragrlldilhtkgqrgyvvfleslefyypelyklvtgk
ENSNLEP00000019750  -...------------------------galrqldtvdltdklvasnygdyaaelvvavlrdmrmleeaarlrra...
ENSNLEP00000019277  -...------------------------hakekiqdllvdsgkfiy................................
ENSNLEP00000010515  A...VGLLVQALEQSDRQDVAEEV----ravlelgrrkyq......................................
ENSNLEP00000006922  -...------------------------nvqsqvvealvrwrqrfgkqatfqslhnglqavevdp.............
ENSNLEP00000024416  -...------------------------nvqsqvvealvrwrqrfgkqatfqslhnglqavevdp.............
ENSNLEP00000015259  N...LSQLAAAV----------------aglgqpda..........................................
ENSNLEP00000013019  -...------------------------nltslcekvtakmke...................................
ENSNLEP00000019081  -...------------------------kveqdatrgiihmilkkgseacnlflksleewnyplfqdln.........
ENSNLEP00000010361  -...------------------------emlkrwrqqqpaglgavyaalermgldgcaedlrsrlq............
ENSNLEP00000013036  -...------------------------mpitwdqvetaswaevvhllierfpgrrawdvtsnifaimkcdkmcvlvh
ENSNLEP00000020027  E...YETLENVT------DL--------lkksrkllilvqkkgeatcqhflkclfstfpqsaaicglrhe........
ENSNLEP00000009959  D...EEQ---------------------vlsdpnlvirkrkvgvlldilqrtghkgyvafleslelyypqlykkvtgk
ENSNLEP00000012963  GqyiWNMLYSIFLMMRKEDLCRKIIR--rrn...............................................
ENSNLEP00000006142  D...WRRLASHLGLC-------------gmkirflscqrspaaailelfeeqngslqelhyfmtvmerldcasaiqny
ENSNLEP00000008474  K...LDILKRVCAQIN-KSLLKIINDYE..................................................
ENSNLEP00000014726  D...LDSLACALEEIGR-----------t.................................................
ENSNLEP00000019253  -...------------------------svhtlldaletlgerlakqkiedqllssgkfmy.................
ENSNLEP00000015252  P...SKALFEGLVAIGRRDLAENIR---k.................................................
ENSNLEP00000021250  -...------------------------segqpplargelgglipvdlaelliskygekeavkvvlkglkvmnllelv
ENSNLEP00000018394  -...------------------------edaeivcacptqpdkvrkildlvqskgeevsefflyllqql.........
ENSNLEP00000023706  -...------------------------edaeivcacptqpdkvrkildlvqskgeevsefflyllqql.........
ENSNLEP00000018960  R...L-----------------------tnsamraghlldllktrgkngaiafleslkfhnpdvytlvtglqpdvdfs
ENSNLEP00000006433  T...VGTLMSKLRELGRRD---------aadfl.............................................
ENSNLEP00000019741  -...------------------------aeptnpskmrklfsftpawnwtckdlllqalresqsylvedle.......
ENSNLEP00000015970  -...------------------------tanriqvanlmiqnagavsavmktihifqklnymllanrlqeek......
ENSNLEP00000002409  -...Y-----------------------elvstkptrtskvrqlldttdiqgeefakvivqklkdnkqmglqpy....
ENSNLEP00000011124  -...------------------------slsqswdrrckdglyqalkethpylimelwek..................
ENSNLEP00000008777  -...------------------------wkeeekkkyydaktedkvrvmadsiqekqrmagqmllqtffnidqispn.
ENSNLEP00000016247  T...VRELVEALRQ--------------mgyteaidviq.......................................
ENSNLEP00000008472  D...LTCLEDLCKTVV-PKLLRNIEKYK..................................................
ENSNLEP00000023448  -...------------------------aedllglt..........................................
ENSNLEP00000005236  -...------------------------aedllglt..........................................
ENSNLEP00000020646  K...YRLLARHLRKIGRSDLAEEL----kfkwenkvftepq.....................................
ENSNLEP00000020648  K...YRLLARHLRKIGRSDLAEEL----kfkwenkvftep......................................
ENSNLEP00000005921  D...QDIVKKII----------------qdidlcensvqrhigh..................................
ENSNLEP00000017056  N...FRQVLQLLRIITRHDLLPYV----..................................................
ENSNLEP00000005196  S...LAQLISALRQHRRNDVVEKI----r.................................................
ENSNLEP00000012889  N...LRLLGQLLRVLARHDLLPHL----ar................................................
ENSNLEP00000023198  N...LRLLGQLLRVLARHDLLPHL----ar................................................
ENSNLEP00000016705  -...------------------------diitawhppaplpspsttap..............................
ENSNLEP00000018358  -...------------------------llrsyelaggdlagllealsdmgleegvrllr..................
ENSNLEP00000008781  -...------------------------lkeeekkkyydakiedkalilvdsvrknrvahqmftqtllnmdqkits..
ENSNLEP00000006370  -...------------------------kanewqrlarswnftddqiraieeqwsekt....................
ENSNLEP00000008469  -...VGDLAELLYRVRRFDLLKRILK--m.................................................
ENSNLEP00000012745  E...RRQLDE------------------eaggakaelllklllakerdhfqdlraalektqphllpilyln.......
ENSNLEP00000005921  D...QDTLKGLMHALK------------hsktyhfpktvtqslkktirf.............................
ENSNLEP00000003928  T...VGQLMELCRLYHRADVEKVLR---rwvdeewpk.........................................
ENSNLEP00000017135  D...------------------------wrmlahklnldrw.....................................
ENSNLEP00000012731  -...------------------------riwkntekenatvahlvgalracqmnlvadlvqevqqaral.........
ENSNLEP00000013766  S...LGQLGTHLAQLGRADA--------lrvlsk............................................
ENSNLEP00000024220  S...LGQLGTHLAQLGRADA--------lrvlsk............................................

d1a1za_               ........
ENSNLEP00000021784  ........
ENSNLEP00000014908  ........
ENSNLEP00000016374  ........
ENSNLEP00000012731  ........
ENSNLEP00000008474  ........
ENSNLEP00000013011  ........
ENSNLEP00000003904  ........
ENSNLEP00000012932  ........
ENSNLEP00000012931  ........
ENSNLEP00000021218  aeinw...
ENSNLEP00000006463  ........
ENSNLEP00000014849  ........
ENSNLEP00000004404  ........
ENSNLEP00000009264  ........
ENSNLEP00000008472  ........
ENSNLEP00000019830  ........
ENSNLEP00000013044  dmk.....
ENSNLEP00000005171  ........
ENSNLEP00000008783  ........
ENSNLEP00000011730  ai......
ENSNLEP00000013466  ........
ENSNLEP00000007362  ........
ENSNLEP00000006922  ........
ENSNLEP00000024416  ........
ENSNLEP00000024076  ........
ENSNLEP00000010142  ........
ENSNLEP00000008328  ........
ENSNLEP00000019741  ath.....
ENSNLEP00000007510  ........
ENSNLEP00000003849  ........
ENSNLEP00000008469  ........
ENSNLEP00000019756  ........
ENSNLEP00000015448  ........
ENSNLEP00000008730  pte.....
ENSNLEP00000012957  ........
ENSNLEP00000011124  qegag...
ENSNLEP00000008729  ipte....
ENSNLEP00000012221  ev......
ENSNLEP00000017996  aqrcsm..
ENSNLEP00000012902  eptrrfst
ENSNLEP00000023519  eptrrfst
ENSNLEP00000019750  ........
ENSNLEP00000019277  ........
ENSNLEP00000010515  ........
ENSNLEP00000006922  ........
ENSNLEP00000024416  ........
ENSNLEP00000015259  ........
ENSNLEP00000013019  ........
ENSNLEP00000019081  ........
ENSNLEP00000010361  ........
ENSNLEP00000013036  rein....
ENSNLEP00000020027  ........
ENSNLEP00000009959  eparvfsm
ENSNLEP00000012963  ........
ENSNLEP00000006142  ........
ENSNLEP00000008474  ........
ENSNLEP00000014726  ........
ENSNLEP00000019253  ........
ENSNLEP00000015252  ........
ENSNLEP00000021250  dql.....
ENSNLEP00000018394  ........
ENSNLEP00000023706  ........
ENSNLEP00000018960  n.......
ENSNLEP00000006433  ........
ENSNLEP00000019741  ........
ENSNLEP00000015970  ........
ENSNLEP00000002409  ........
ENSNLEP00000011124  ........
ENSNLEP00000008777  ........
ENSNLEP00000016247  ........
ENSNLEP00000008472  ........
ENSNLEP00000023448  ........
ENSNLEP00000005236  ........
ENSNLEP00000020646  ........
ENSNLEP00000020648  ........
ENSNLEP00000005921  ........
ENSNLEP00000017056  ........
ENSNLEP00000005196  ........
ENSNLEP00000012889  ........
ENSNLEP00000023198  ........
ENSNLEP00000016705  ........
ENSNLEP00000018358  ........
ENSNLEP00000008781  ........
ENSNLEP00000006370  ........
ENSNLEP00000008469  ........
ENSNLEP00000012745  ........
ENSNLEP00000005921  ........
ENSNLEP00000003928  ........
ENSNLEP00000017135  ........
ENSNLEP00000012731  ........
ENSNLEP00000013766  ........
ENSNLEP00000024220  ........

Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:

Model: 0045697 (list models)
Initial SAMT99 seed:

Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues

Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.

Select to display   Genome
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Eubacterium eligens ATCC 27750
NoYes   Nitrosococcus halophilus Nc4
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Caenorhabditis elegans 69_215 - Roundworm
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Heliconius numata
NoYes   Loa loa v3.3 - Eye worm
NoYes   Wuchereria bancrofti v1.0 - Agent of lymphatic filariasis
NoYes   Brugia malayi v1.0 - Agent of lymphatic filariasis
NoYes   Air microbial communities Singapore indoor air filters 2 (meta-genome)
NoYes   Combined (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden bottom (Fungus garden bottom) (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- (Oak Ridge ambient) (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing switchgr (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   NCBI viral sequences (Viral)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   UniProt viral sequences (Viral)
NoYes   ALL (only advised for small superfamilies)

Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]