SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from Please contact us if you experience any problems.

DEATH domain alignments in Sus scrofa 76_10.2

These alignments are sequences aligned to the 0045697 model.

Sophisticated options are available for refining alignments:

Jump to [ Top of page · Refine alignments · Add alignments from genomes ]


The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

d1a1za_               ..............................................................................
ENSSSCP00000000849  mnkpitastyvrclnvglirklsdfidpqegwkklavaikkpsgddrynqfhirrfeallq.................
ENSSSCP00000006812  ..............................................................................
ENSSSCP00000011136  ikdvdlg.......................................................................
ENSSSCP00000027110  ..............................................................................
ENSSSCP00000017064  ..............................................................................
ENSSSCP00000023811  sggargalsahtllfdmpptllgefcavldscdgalgwrglaerlssswldvrhiekyvdqgksgtrellwswaqk..
ENSSSCP00000029997  ggargalsahtllfdmpptllgefcavldscdgalgwrglaerlssswldvrhiekyvdqgksgtrellwswaqkn..
ENSSSCP00000030483  dlraafdiicdnvgkdwrrlarqlkvsdakidaieekyprnlteqvreslrvwkns......................
ENSSSCP00000011996  gaesapptpsmsslplaalnvrvrhrlslflnvrtqvaadwtglaeemnfeyleirrlethpdptrsllddwqgrpga
ENSSSCP00000028331  ffpdfgllwylk..................................................................
ENSSSCP00000003586  ffpdfgllwylk..................................................................
ENSSSCP00000029073  gmspqspcertdirmaivadhlglswtelarel.............................................
ENSSSCP00000029426  gmspqspcertdirmaivadhlglswtelarel.............................................
ENSSSCP00000028637  gmspqspcertdirmaivadhlglswtelarel.............................................
ENSSSCP00000027871  afsipppirqklcssldapqtrghdwrmlahklnldrylnyfat..................................
ENSSSCP00000020615  mdeadrqvlrhcrvrlvrelqvaslwdallnrelftpdmiediqragsgsrrdqarqlitdle...............
ENSSSCP00000003758  mdeadrqvlrhcrvrlvrelqvaslwdallnrelftpdmiediqragsgsrrdqarqlitdle...............
ENSSSCP00000030962  pqspcertdirmaivadhlglswtelarel................................................
ENSSSCP00000010888  pqspcertdirmaivadhlglswtelarel................................................
ENSSSCP00000009731  deqerieerlayiadhlgfswtelareldftee.............................................
ENSSSCP00000029512  pqspcertdirmaivadhlglswtelarel................................................
ENSSSCP00000026681  ..............................................................................
ENSSSCP00000001079  nttsltdkhldpvrenlgknwkicarklgltesqideidhdyerdglkekvyqmlqkwlmregskga...........
ENSSSCP00000030525  pfkngvmlyliy..................................................................
ENSSSCP00000003594  pfkngvmlyliy..................................................................
ENSSSCP00000014820  mas...........................................................................
ENSSSCP00000026110  maktpsdhllysl.................................................................
ENSSSCP00000020712  maktpsdhllysl.................................................................
ENSSSCP00000000755  atlyavvdgvpptrwkefvrrlglseheierlelqngrcl......................................
ENSSSCP00000008503  maktpsdhllysl.................................................................
ENSSSCP00000029859  maktpsdhllysl.................................................................
ENSSSCP00000017059  ..............................................................................
ENSSSCP00000013604  gpgpgdpavpgaqhflyevppwvmcrfykvmdalepadwcqfaalivrdqtelrlcersgqrtasvlwpwinrn....
ENSSSCP00000023919  dkilkekrrlfvrsvamg............................................................
ENSSSCP00000020932  ndlslirknrmalfqhltcvlpildslliarviseqe.........................................
ENSSSCP00000000974  meardkqvlrslrlelgaevlveglv....................................................
ENSSSCP00000026780  meardkqvlrslrlelgaevlveglv....................................................
ENSSSCP00000022290  espdvrrdkpvtgdqievfanklgeqwkilapylemkdseirqiecdsedmkmrakqllvawqdqegv..........
ENSSSCP00000031027  slstyglqwcf...................................................................
ENSSSCP00000000947  mdakarncllqhrealerdiktsyimdhmisngvltlseeekvkneptqcqraal.......................
ENSSSCP00000030780  mdakarncllqhrealerdiktsyimdhmisngvltlseeekvkneptqcqraal.......................
ENSSSCP00000003595  slstyglqwcf...................................................................
ENSSSCP00000007484  maviaehlglswaelarelq..........................................................
ENSSSCP00000008286  mgctrdaildal..................................................................
ENSSSCP00000030156  mgctrdaildal..................................................................
ENSSSCP00000022080  ptpsmsxnvrvrhrlslflnvrtqvaadwtglaeemnfeyleirrlethpdptrsllddwqgrpga............
ENSSSCP00000010956  afkiplsirqkicnsldapnsrgndwrllaqklsmdrylnyfatkasptgvil.........................
ENSSSCP00000017446  mhpdhqealkknrvvlakqlllsellehllekdiitlemreh....................................
ENSSSCP00000025604  edalweriegvrhrltra............................................................
ENSSSCP00000023381  eddlslirrnrmalfqqltc..........................................................
ENSSSCP00000007404  ltevkkdalenlrvylcekiiaerhfdhlr................................................
ENSSSCP00000007407  ltevkkdalenlrvylcekiiaerhfdhlr................................................
ENSSSCP00000028277  ..............................................................................
ENSSSCP00000013653  aetgfltqsnllnvagrlgpdwpavalhlgvpyrqlqrirhefrddldgqirhmlfswaerq................
ENSSSCP00000030708  aetgfltqsnllnvagrlgpdwpavalhlgvpyrqlqrirhefrddldgqirhmlfswaerq................
ENSSSCP00000003526  rlcayleeleavelkkfklylgmatemgkhkipwgrmep.......................................
ENSSSCP00000010287  tvclrqcfddfsnivpcdcwdklmrkmglnqneilqsrdrarntgdalyemletwvrrkg..................
ENSSSCP00000014938  afkipflirqkiitsldppcsrgadwrtlaqklhldshlsffask.................................
ENSSSCP00000003659  pgpqlydvmdavparrwkefvrtlglreaeieavevevgrfrdqqy................................
ENSSSCP00000003665  pgpqlydvmdavparrwkefvrtlglreaeieavevevgrfrdqqy................................
ENSSSCP00000012086  lhippqqrqeveqlleasgepdkgwqglagylgyqaeavetmarsqvpaytllrdwairegsga..............
ENSSSCP00000027703  pcnrlppelferlqmllepnsitgndwrrlashlglcgmkirfl..................................
ENSSSCP00000011676  asdlnlltrrklsrlldppdpmgkdwcllamnlglpdlvakyntnngapkeflpspvh....................
ENSSSCP00000016776  afkipysirqricatfdtpnakgkdwqmlaqknsinrnlsyfat..................................
ENSSSCP00000030156  kpalhfvdqhraalisrvtdvdglldalygkvlteeqyqavra...................................
ENSSSCP00000010284  ptvclrqffddfsnivpcdcwdklmrkmdltqneilqsrdraqntgdalyemletwv.....................
ENSSSCP00000028599  qqwiqskredivnqmteaclnqsldallsrdlimked.........................................
ENSSSCP00000018176  emlwemvedhrcrivrsvcpsrltpylrqakvldqldeeevlhsprftntam..........................
ENSSSCP00000015491  aaa...........................................................................
ENSSSCP00000014976  hsqetrhirsvlwdlayrhlkanewqrlarswnftdtqiraieeqwsgee............................
ENSSSCP00000010288  dpteclrqffddfstivpydcwdklmrkmgltqneilqsrdrarstgdalyemletwvr...................
ENSSSCP00000023640  dpteclrqffddfstivpydcwdklmrkmgltqneilqsrdrarntgdalyemle.......................
ENSSSCP00000022084  qqwiqskredivnqmteaclnqsldallsrdlimked.........................................
ENSSSCP00000004900  emqqlrsvlwrlasrylrphewkklayhwefteahvya........................................
ENSSSCP00000020271  qerpsetidrerkrlvetlqadsgllldallargvltgpey.....................................
ENSSSCP00000003593  spdfdllwyleklnkkefmslknhlkqecleiglpeipgtakpdlg................................
ENSSSCP00000017668  hsyikl........................................................................
ENSSSCP00000030045  hsyikl........................................................................
ENSSSCP00000026681  ..............................................................................
ENSSSCP00000015922  kknplkilesmgkelitgvlddlvekdvlkleeee...........................................
ENSSSCP00000026086  tfarsvglkwrkvgrslqrgcralrdpaldslayeyereglyeqafqllrrfvqaegr....................
ENSSSCP00000006413  frfavptkltpnwlsvlvdnlpgtklnaesverikr..........................................
ENSSSCP00000006414  frfavptkltpnwlsvlvdnlpgtklnaesverikr..........................................
ENSSSCP00000006783  s.............................................................................
ENSSSCP00000010286  eclrqffddfstivpydcwdklmrkmgltqneilqsrdrarstgdalyemletcvrrr....................
ENSSSCP00000027946  tlltdtqlfdlaeklgkewmkiaianlklkmsdida..........................................
ENSSSCP00000030485  aalivrdqtelrlcersgqrtasvlwpwinrna.............................................
ENSSSCP00000022806  ls............................................................................
ENSSSCP00000001732  pcnrlppel.....................................................................
ENSSSCP00000020840  lw............................................................................
ENSSSCP00000011271  ledtvlqnlehlldrpgaqgswaelaerlglrslvdtyrktaspsgs...............................
ENSSSCP00000024689  pirlqetldqlspqelrdfrtilknvdaeprvkelrleleggnasgl...............................
ENSSSCP00000027070  mepqrrellaqcqqslaqamt.........................................................
ENSSSCP00000030067  mepqrrellaqcqqslaqamt.........................................................
ENSSSCP00000017059  v.............................................................................
ENSSSCP00000017064  ..............................................................................
ENSSSCP00000022169  kldpchptvknwrnfaskwgmpydelcfleqrpqsptlefllrn..................................
ENSSSCP00000003558  aql...........................................................................
ENSSSCP00000008685  sptelpfdclektsrmlsatynsekavvktwrhlaesfglkrdeiggmtd............................
ENSSSCP00000006413  feqlrilmqslpgkkvptedieetvkmcksseqilk..........................................
ENSSSCP00000006414  feqlrilmqslpgkkvptedieetvkmcksseqilk..........................................

                               10        20        30                       40        50           6
                                |         |         |                        |         |            
ENSSSCP00000000849  .--------------------------------.---.......---.-......------------T-------...
ENSSSCP00000011136  .-----KYITRIAEQMKITEVKDFV--RKNGIE.---.......---.-......--------------------...
ENSSSCP00000023811  .--------------------------------.---.......---.N......KTIGDLLQVLQEM-------...
ENSSSCP00000029997  .--------------------------------.---.......---.-......KTIGDLLQVLQEM-------...
ENSSSCP00000030483  .--------------------------------.---.......---.-......--------------R-----...
ENSSSCP00000011996  s--------------------------------.---.......---.-......--------------------...
ENSSSCP00000029073  .------------------------NFSVDEIN.QIR.......VEN.P......NSLISQSFMLLKKWVTRDGKnat
ENSSSCP00000029426  .------------------------NFSVDEIN.QIR.......VEN.P......NSLISQSFMLLKKWVTRDGKnat
ENSSSCP00000028637  .------------------------NFSVDEIN.QIR.......VEN.P......NSLISQSFMLLKKWVTRDGKnat
ENSSSCP00000027871  .--------------------------------.---.......---.K......SSPTGVILDLWEAQNFPDGN...
ENSSSCP00000020615  .--------------------------------.---.......---.-......-----------T--------...
ENSSSCP00000003758  .--------------------------------.---.......---.-......-----------T--------...
ENSSSCP00000030962  .------------------------NFSVDEIN.QIR.......VEN.P......NSLISQSFMLLKKWVTRDGKnat
ENSSSCP00000010888  .------------------------NFSVDEIN.QIR.......VEN.P......NSLISQSFMLLKKWVTRDGKnat
ENSSSCP00000009731  .-----------------------------QIH.QIR.......IEN.P......NSLQDQSHALLKYWLERDGKhat
ENSSSCP00000029512  .------------------------NFSVDEIN.QIR.......VEN.P......NSLISQSFMLLKKWVTRDGKnat
ENSSSCP00000001079  .--------------------------------.---.......---.-......-------------------T...
ENSSSCP00000030525  .--------------LSKENLQRFKQLLLEEIP.RPG.......---.-......--------------------...
ENSSSCP00000003594  .--------------LSKENLQRFKQLLLEEIP.RPG.......---.-......--------------------...
ENSSSCP00000026110  .------------EELVPYDFEKFKFKLQNTSL.EKE.......HSR.I......P-------------------...
ENSSSCP00000020712  .------------EELVPYDFEKFKFKLQNTSL.EKE.......HSR.I......P-------------------...
ENSSSCP00000000755  .--------------------------------.---.......---.-......----------------REAQ...
ENSSSCP00000008503  .------------EELVPYDFEKFKFKLQNTSL.EKE.......HSR.I......P-------------------...
ENSSSCP00000029859  .------------EELVPYDFEKFKFKLQNTSL.EKE.......HSR.I......P-------------------...
ENSSSCP00000013604  .--------------------------------.---.......---.-......ARVADLVRILTHLQLL----...
ENSSSCP00000023919  .--------------------------------.---.......---.-......-TINGLLDELLETRVLNQEE...
ENSSSCP00000020932  .--------------------------------.---.......---.-......--------------------...
ENSSSCP00000000974  .--------------------------------.---.......---.-......------LQYLYQEGILTENH...
ENSSSCP00000026780  .--------------------------------.---.......---.-......------LQYLYQEGILTENH...
ENSSSCP00000022290  .--------------------------------.---.......---.-......----------------H---...
ENSSSCP00000031027  .------------KQLGKEEFETFKEWLKETTS.ELA.......T--.-......--------------------...
ENSSSCP00000000947  .--------------------------------.---.......---.-......--------------------...
ENSSSCP00000030780  .--------------------------------.---.......---.-......--------------------...
ENSSSCP00000003595  .------------KQLGKEEFETFKEWLKETTS.ELA.......T--.-......--------------------...
ENSSSCP00000007484  .-------------------------FSVEDIN.RIR.......VEN.P......NSLLEQSAALLNLWLTREGKdak
ENSSSCP00000008286  .------------ENLTADELKKFKMKLLSVPL.REG.......YGR.-......--------------------...
ENSSSCP00000030156  .------------ENLTADELKKFKMKLLSVPL.REG.......YGR.-......--------------------...
ENSSSCP00000022080  .--------------------------------.---.......---.-......-------------------S...
ENSSSCP00000010956  .--------------------------------.---.......---.-......--------DLWEALQQDDGD...
ENSSSCP00000017446  .-------------------------------I.QAK.......VGS.F......SQNVELLNLL----------...
ENSSSCP00000025604  .--------------------------------.---.......---.-......LNPAKLTPYLRQCRVIDEQD...
ENSSSCP00000023381  .--------------------------------.---.......---.-......--VLPILDSLLKASVINKQE...
ENSSSCP00000007404  .--------------------------------.---.......---.-......-----------AKKILSRED...
ENSSSCP00000007407  .--------------------------------.---.......---.-......-----------AKKILSRED...
ENSSSCP00000013653  .--------------------------------.---.......---.-......--------------AGQPGA...
ENSSSCP00000030708  .--------------------------------.---.......---.-......--------------AGQPGA...
ENSSSCP00000003526  .--------------------------------.---.......---.-......AGPLEMAQLLAAHCGIREAW...
ENSSSCP00000010287  .--------------------------------.---.......--R.-......--------------------...
ENSSSCP00000014938  .--------------------------------.---.......---.-......PSPTAMILNLWEARHFPNGN...
ENSSSCP00000003659  .----------------------------EMLK.RWR.......QQQ.P......AGLAAVYAALER--------...
ENSSSCP00000003665  .----------------------------EMLK.RWR.......QQQ.P......AGLAAVYAALER--------...
ENSSSCP00000012086  .--------------------------------.---.......---.-......-------------------T...
ENSSSCP00000027703  .--------------------------S-----.---.......---.-......--------------------...
ENSSSCP00000011676  .--------------------------------.---.......---.-......-------ALLREWTSYPNST...
ENSSSCP00000016776  .--------------------------------.---.......---.Q......SSPSAVILNLWEARHQHDGD...
ENSSSCP00000030156  .----------------------------E---.---.......---.-......--------------------...
ENSSSCP00000010284  .--------------------------------.---.......---.-......--------------------...
ENSSSCP00000028599  .--------------------------------.---.......---.-......--------------------...
ENSSSCP00000018176  .--------------------------------.---.......---.-......--------------------...
ENSSSCP00000015491  .----RELLLVALEDLSQEQLKRFCHKLRDAPL.DGR.......SI-.-......-----------PRGRLEGSD...
ENSSSCP00000014976  .--------------------------------.---.......S--.-......--------------------...
ENSSSCP00000010288  .--------------------------------.--R.......---.-......--------------------...
ENSSSCP00000023640  .--------------------------------.---.......---.-......--------------------...
ENSSSCP00000022084  .--------------------------------.---.......---.-......--------------------...
ENSSSCP00000004900  .--------------------------MEQQWT.GTK.......SYQ.E......HGHRMLLIWLHGVIMAGENS...
ENSSSCP00000020271  .--------------------------------.---.......---.-......--------------------...
ENSSSCP00000003593  .--------------------------------.---.......---.-......-NLLTTFYEAQH-------V...
ENSSSCP00000017668  .--------------------------------.---.......---.-......--------------------...
ENSSSCP00000030045  .--------------------------------.---.......---.-......--------------------...
ENSSSCP00000015922  .---------------------------K----.---.......---.-......--------------------...
ENSSSCP00000026086  .----RATLQRLVEALEENELTSL---------.---.......---.-......--------------------...
ENSSSCP00000006413  .--------------------------------.---.......---.R......HSSQEQTFQLLKLWKHQNKD...
ENSSSCP00000006414  .--------------------------------.---.......---.R......HSSQEQTFQLLKLWKHQNKD...
ENSSSCP00000010286  .--------------------------------.---.......-GR.E......ASVNDLLDALEALGRY----...
ENSSSCP00000027946  .--------------------------------.---.......---.-......--------ILEKKEDVTMNK...
ENSSSCP00000030485  .--------------------------------.---.......---.-......-RVADLVRILTHLQLLRA--...
ENSSSCP00000001732  .--------------------------------.---.......---.-......---FERLQMLLEPNSITGND...
ENSSSCP00000011271  .--------------------------------.---.......---.-......---------L----------...
ENSSSCP00000024689  .--------------------------------.---.......---.-......-------AQLLAKYYDSEAA...
ENSSSCP00000027070  .--------------------------------.---.......---.-......-EVEAVLGLLEAAGALSPGE...
ENSSSCP00000030067  .--------------------------------.---.......---.-......-EVEAVLGLLEAAGALSPGE...
ENSSSCP00000022169  .--------------------------------.---.......---.-......----------------SQRT...
ENSSSCP00000003558  .----HFHLQPLLEQLDQQELSKFKSLPKALSL.QEE.......LQH.-......--------------------...
ENSSSCP00000008685  .--------------------------------.---.......---.-......--GLQVFDRIS---------...
ENSSSCP00000006413  .------------------------LLSLWRIK.NGD.......QD-.-......-------------------T...
ENSSSCP00000006414  .------------------------LLSLWRIK.NGD.......QD-.-......-------------------T...

                      0        70        80                                                         
                      |         |         |                                                         
d1a1za_               TELLRELLASLRRHDLLRRVDDFE......................................................
ENSSSCP00000000849  ------------------------gksptcellfdwgttnctvgdlvdllvqneffapaslllpdavpkpintlp...
ENSSSCP00000006812  LSYIEHIFEISRRPDLLTMVVDYRtrvlkiseedeldtkltripsakkykdiirqpseeeiiklap............
ENSSSCP00000011136  ------------------------etkideimhdnpkdtaeqkvqllrnwylyhgkkdayctliqglrkaklsaladk
ENSSSCP00000027110  TALLRELLVSLRRQDLLRRLDAF-egaaggaapeerdlraafdiicdnvgkdwrrlarqlkvsdakidaieekyp...
ENSSSCP00000017064  LSFLKELLFRMNRLDLLIN-----yletneeemeselripgraqisayrvmlfqisenv...................
ENSSSCP00000023811  ------------------------ghhraihliany..........................................
ENSSSCP00000029997  ------------------------ghhraihlianygaalnpsewnhqg.............................
ENSSSCP00000030483  ------------------------redaavshlvdalracrlnlvadlveeeqqara.....................
ENSSSCP00000011996  VGRLLELLAKLGRDDVL-------velgpsieedcrkyilkqqqe.................................
ENSSSCP00000028331  WEVTLSLFLQINRKDLWTK-----aqeeirh...............................................
ENSSSCP00000003586  WEVTLSLFLQINRKDLWTK-----aqeeir................................................
ENSSSCP00000029073  TDALTSVLTKINRIDIVTLLE---gpifdygnisgtrsfadensvf................................
ENSSSCP00000029426  TDALTSVLTKINRIDIVTLLE---gpifdygnisgtrsfadensvf................................
ENSSSCP00000028637  TDALTSVLTKINRIDIVTLLE---gpifdygnisgtrsfadensvf................................
ENSSSCP00000027871  LSVLAAVLEEMGRHE---------tvvsl.................................................
ENSSSCP00000020615  ------------------------rgsqalpvfiscledtgqetlasllrtsrqatkrdlgairpldlh.........
ENSSSCP00000003758  ------------------------rgsqalpvfiscledtgqetlasllrtsrqatkrdlgairpldlh.........
ENSSSCP00000030962  TDALTSVLTKINRIDIVTLLE---gpifdygnisgtrsfadensvf................................
ENSSSCP00000010888  TDALTSVLTKINRIDIVTLLE---gpifdygnisgtrsfadensvf................................
ENSSSCP00000009731  DTNLIECLTKINRMDIVHLME---titeplqerishsyaeieqtitldhs............................
ENSSSCP00000029512  TDALTSVLTKINRIDIVTLLE---gpifdygnisgtrsfadensvf................................
ENSSSCP00000026681  TFFLAELLYTIKQNSLLRHLHYT-keqvacllptrrkvslfrnllyelse............................
ENSSSCP00000001079  VGKLARALYQCSRLDLLSCL----i.....................................................
ENSSSCP00000030525  ------------------------sipitwdqvqmarwaevahlltecfpgrlawdvthdifskmnqtelclrvqmel
ENSSSCP00000003594  ------------------------sipitwdqvqmarwaevahlltecfpgrlawdvthdifskmnqtelclrvqmel
ENSSSCP00000014820  WAMATWIFAAINRRDLYE------kakrd.................................................
ENSSSCP00000026110  ------------------------rgqlqtaqpvklamllvthygedyavqltlqvlrainqhllaeelhrai.....
ENSSSCP00000020712  ------------------------rgqlqtaqpvklamllvthygedyavqltlqvlrainqhllaeelhrai.....
ENSSSCP00000000755  YSMLAEWRRR--------------tsrreatlellgsvlrdmdllgcledieealrg.....................
ENSSSCP00000008503  ------------------------rgqlqtaqpvklamllvthygedyavqltlqvlrainqhllaeelhrai.....
ENSSSCP00000029859  ------------------------rgqlqtaqpvklamllvthygedyavqltlqvlrainqhllaeelhrai.....
ENSSSCP00000017059  LDLLEKCLRNIHRIDLKTKIQKYKqsaqgaetnyv...........................................
ENSSSCP00000013604  ------------------------rardiitawhpsapflppssttp...............................
ENSSSCP00000023919  VEIV--------------------rgenatvmdkaralidsvirkgpqacqicinhicgddphlagvlel........
ENSSSCP00000020932  H-----------------------dvikqktqtslqarelidiilvkgnyaatifknslqeidpmlykhlfvqqdiky
ENSSSCP00000000974  VQEIKA------------------qatglrktmllldilpsrgpkafdvfldslqefpwvreklek............
ENSSSCP00000026780  VQEIKA------------------qatglrktmllldilpsrgpkafdvfldslqefpwvreklek............
ENSSSCP00000022290  ------------------------atpenlisalnksglsdlaesltn..............................
ENSSSCP00000031027  ------------------------csfplaevddansehltsllhehykdsfawkisidifekmhlsalsevardemk
ENSSSCP00000000947  ----------------L-------ikmilkkdnyayisfynallhegykdlaallhgglp..................
ENSSSCP00000030780  ----------------L-------ikmilkkdnyayisfynallhegykdlaallhgglp..................
ENSSSCP00000003595  ------------------------csfplaevddansehltsllhehykdsfawkisidifekmhlsalsevardemk
ENSSSCP00000007484  MDNLYAALRNIERGEIVNMLEN--sg....................................................
ENSSSCP00000008286  ------------------------iprgtllpldaidltdklvnyyleeysaeltalvlrdigmkevaeqlqktl...
ENSSSCP00000030156  ------------------------iprgtllpldaidltdklvnyyleeysaeltalvlrdigmkevaeqlqktl...
ENSSSCP00000022080  VGRLLELLAKLGRDDVL-------velgpsi...............................................
ENSSSCP00000010956  LNSLASALEEM-------------gksemlv...............................................
ENSSSCP00000017446  ------------------------pkrgpqafdafcvalretkqdhleellletlsglqh..................
ENSSSCP00000025604  EEEVL-------------------styrfpcrvnrtgrlmdilrcrgkrgyeaflealefyypehftlltgqepaqrc
ENSSSCP00000023381  HDIIK-------------------qktqiplqarelidtilvkgnsaanifknclkeinstlyknlfveknmkyipte
ENSSSCP00000007404  ------------------------teeiscrtssrkragklldylqenpkgldtlvesirrektqnfliqkitdev..
ENSSSCP00000007407  ------------------------teeiscrtssrkragklldylqenpkgldtlvesirrektqnfliqkitdev..
ENSSSCP00000028277  LDLLEKCLRNIHRIDLKTKIQKYKqsaqgaetnyv...........................................
ENSSSCP00000013653  VGLLVQALEQSDRRDVAEEV----ravlelgrrkyqe.........................................
ENSSSCP00000030708  VGLLVQALEQSDRRDVAEEV----ravlelgrrkyqe.........................................
ENSSSCP00000003526  LLT-LSIFEQINRKDLWE------rgqre.................................................
ENSSSCP00000010287  ------------------------easvndlldalealgqrsakeeiedklvdsgkfvfk..................
ENSSSCP00000014938  LSQLAAAVA---------------glgqpda...............................................
ENSSSCP00000003659  ------------------------mgldgcaedlrsrlq.......................................
ENSSSCP00000003665  ------------------------mgldgcaedlrsrlq.......................................
ENSSSCP00000012086  LRVLADALAAMGREDVVQVL----dp....................................................
ENSSSCP00000027703  ------------------------cqrspaaailelfeeqngslqelhylmtimerldcasviqny............
ENSSSCP00000011676  VGVLMSKLRELGRRD---------aadfl.................................................
ENSSSCP00000016776  LDSLACALEEIGR-----------t.....................................................
ENSSSCP00000030156  ------------------------htnptkmrrlfsftpawnltckdlllqalkdtqpylvadleqs...........
ENSSSCP00000010284  ------------R-----------rkgreasvnnlldalealgqrsakeeiedklvdsgkfvfk..............
ENSSSCP00000028599  Y-----------------------elistkptrtskvrqlldttdiqgeefarvivqklkdnkqmglqpy........
ENSSSCP00000018176  --------R---------------vghlldllktrgkngaiafleslkfhnpdvytlvtglqpsvdft..........
ENSSSCP00000015491  AVDLAEQLIHFY------------gpelalevarktlkradvrdvaaqlkeqql........................
ENSSSCP00000014976  ------------------------vrehghralliwlhgalvtqampakhlyeelvragfpelagelq..........
ENSSSCP00000010288  ------------------------rgreasvndlldalealgqryakekiedtlvgsgkfif................
ENSSSCP00000023640  ---------T--------------wvrrrgreasvndllgalealgqryakeriedtlvgsgkfvfk...........
ENSSSCP00000022084  Y-----------------------elistkptrtskvrqlldttdiqgeefarvivqklkdnkqmglqpy........
ENSSSCP00000004900  SKALFEGLVAIGRRDLAESIRK--k.....................................................
ENSSSCP00000020271  -E----------------------aldalpdaerrvrrllllvqskgeaacrellncaqrtvhapdpawdwq......
ENSSSCP00000003593  WNMMLSIFKKIRRADLCEKIK---arr...................................................
ENSSSCP00000017668  --------LKVNREHLVTHIRNT-qclvdnllhndyfsaedaeivcagptqpdkvrrvldlvqskgeevseffvfvlq
ENSSSCP00000030045  --------LKVNREHLVTHIRNT-qclvdnllhndyfsaedaeivcagptqpdkvrrvldlvqskgeevseffvfvlq
ENSSSCP00000026681  LTLLEDVCKKIA-PNLMRKIEKYK......................................................
ENSSSCP00000015922  ------------------------kniydaklqdkarilmdsvlqkrheasqvfvktflnmdknst............
ENSSSCP00000026086  ------------------------aegllglanpd...........................................
ENSSSCP00000006413  QDMVKKII----------------qgidlcensvqkhigh......................................
ENSSSCP00000006414  QDMVKKII----------------qgidlcensvqkhigh......................................
ENSSSCP00000006783  FRQVLQLLRIITRHDLLPYV----......................................................
ENSSSCP00000010286  ------------------------akekiedtlvgsgkf.......................................
ENSSSCP00000027946  FRMLKK------------------wqekeksnataqnlcnclknvdsvevqdvlkgflqeslevel............
ENSSSCP00000030485  ------------------------rdiitawhpsapflppssttp.................................
ENSSSCP00000022806  LRLLGQLLRVLARHDLLPHL----ar....................................................
ENSSSCP00000001732  WRRLASHLGLC-------------gmkiryislktkrixaailelfeeqngslqelhylmtime..............
ENSSSCP00000020840  LRLLARHLRKIGRSDLSGEL----kfkwenkvf.............................................
ENSSSCP00000011271  ------------------------lrsyklaggdlaglldalsdmgleegvrllr.......................
ENSSSCP00000024689  RRVMVQVLQQLPRADLLP------rwrs..................................................
ENSSSCP00000027070  RRQLDE------------------eaggakaelllklllakerdhfqdlraalektqphllpilyln...........
ENSSSCP00000030067  RRQLDE------------------eaggakaelllklllakerdhfqdlraalektqphllpilyln...........
ENSSSCP00000017059  LVSLAELLYRVRRFDLLKRILK--m.....................................................
ENSSSCP00000017064  ------------------------rli...................................................
ENSSSCP00000022169  VGQLMELCRLYHRADVEKVLR---rwvdeewpkrsred........................................
ENSSSCP00000003558  ------------------------vpqmaldkasgrilseplfscslskrnsrlavfrslnas...............
ENSSSCP00000008685  ------------------------tagysvpelltklvqierldaveslc............................
ENSSSCP00000006413  RKGLMHALKHLK------------tyhfpktvtqslk.........................................
ENSSSCP00000006414  RKGLMHALKHLK------------tyhfpktvtqslk.........................................

d1a1za_               .........................
ENSSSCP00000000849  .........................
ENSSSCP00000006812  .........................
ENSSSCP00000011136  indivqkdvtseqenansqnenesl
ENSSSCP00000027110  .........................
ENSSSCP00000017064  .........................
ENSSSCP00000023811  .........................
ENSSSCP00000029997  .........................
ENSSSCP00000030483  .........................
ENSSSCP00000011996  .........................
ENSSSCP00000028331  .........................
ENSSSCP00000003586  .........................
ENSSSCP00000029073  .........................
ENSSSCP00000029426  .........................
ENSSSCP00000028637  .........................
ENSSSCP00000027871  .........................
ENSSSCP00000020615  .........................
ENSSSCP00000003758  .........................
ENSSSCP00000030962  .........................
ENSSSCP00000010888  .........................
ENSSSCP00000009731  .........................
ENSSSCP00000029512  .........................
ENSSSCP00000026681  .........................
ENSSSCP00000001079  .........................
ENSSSCP00000030525  n........................
ENSSSCP00000003594  nd.......................
ENSSSCP00000014820  .........................
ENSSSCP00000026110  .........................
ENSSSCP00000020712  .........................
ENSSSCP00000000755  .........................
ENSSSCP00000008503  .........................
ENSSSCP00000029859  .........................
ENSSSCP00000017059  .........................
ENSSSCP00000013604  .........................
ENSSSCP00000023919  .........................
ENSSSCP00000020932  ipt......................
ENSSSCP00000000974  .........................
ENSSSCP00000026780  .........................
ENSSSCP00000022290  .........................
ENSSSCP00000031027  k........................
ENSSSCP00000000947  .........................
ENSSSCP00000030780  .........................
ENSSSCP00000003595  .........................
ENSSSCP00000007484  .........................
ENSSSCP00000008286  .........................
ENSSSCP00000030156  .........................
ENSSSCP00000022080  .........................
ENSSSCP00000010956  .........................
ENSSSCP00000017446  .........................
ENSSSCP00000025604  sm.......................
ENSSSCP00000023381  .........................
ENSSSCP00000007404  .........................
ENSSSCP00000007407  .........................
ENSSSCP00000028277  .........................
ENSSSCP00000013653  .........................
ENSSSCP00000030708  .........................
ENSSSCP00000003526  .........................
ENSSSCP00000010287  .........................
ENSSSCP00000014938  .........................
ENSSSCP00000003659  .........................
ENSSSCP00000003665  .........................
ENSSSCP00000012086  .........................
ENSSSCP00000027703  .........................
ENSSSCP00000011676  .........................
ENSSSCP00000016776  .........................
ENSSSCP00000030156  .........................
ENSSSCP00000010284  .........................
ENSSSCP00000028599  .........................
ENSSSCP00000018176  .........................
ENSSSCP00000015491  .........................
ENSSSCP00000014976  .........................
ENSSSCP00000010288  .........................
ENSSSCP00000023640  .........................
ENSSSCP00000022084  .........................
ENSSSCP00000004900  .........................
ENSSSCP00000020271  .........................
ENSSSCP00000003593  .........................
ENSSSCP00000017668  ql.......................
ENSSSCP00000030045  ql.......................
ENSSSCP00000026681  .........................
ENSSSCP00000015922  .........................
ENSSSCP00000026086  .........................
ENSSSCP00000006413  .........................
ENSSSCP00000006414  .........................
ENSSSCP00000006783  .........................
ENSSSCP00000010286  .........................
ENSSSCP00000027946  .........................
ENSSSCP00000030485  .........................
ENSSSCP00000022806  .........................
ENSSSCP00000001732  .........................
ENSSSCP00000020840  .........................
ENSSSCP00000011271  .........................
ENSSSCP00000024689  .........................
ENSSSCP00000027070  .........................
ENSSSCP00000030067  .........................
ENSSSCP00000017059  .........................
ENSSSCP00000017064  .........................
ENSSSCP00000022169  .........................
ENSSSCP00000003558  .........................
ENSSSCP00000008685  .........................
ENSSSCP00000006413  .........................
ENSSSCP00000006414  .........................

Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:

Model: 0045697 (list models)
Initial SAMT99 seed:

Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues

Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.

Select to display   Genome
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Eubacterium eligens ATCC 27750
NoYes   Nitrosococcus halophilus Nc4
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Caenorhabditis elegans 69_215 - Roundworm
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Heliconius numata
NoYes   Loa loa v3.3 - Eye worm
NoYes   Wuchereria bancrofti v1.0 - Agent of lymphatic filariasis
NoYes   Brugia malayi v1.0 - Agent of lymphatic filariasis
NoYes   Air microbial communities Singapore indoor air filters 2 (meta-genome)
NoYes   Combined (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden bottom (Fungus garden bottom) (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- (Oak Ridge ambient) (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing switchgr (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   NCBI viral sequences (Viral)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   UniProt viral sequences (Viral)
NoYes   ALL (only advised for small superfamilies)

Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]