SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

GTPase activation domain, GAP alignments in Homo sapiens 69_37

These alignments are sequences aligned to the 0044148 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1tx4a_            p................................................................................
ENSP00000362887  lpmemykefaehitnhylglcaalepilsaktkeemasalvhilqstgkvkdfltdlmmsevdrcgdnehlifrentlatk
ENSP00000274376  mpeeeysefkelilqkelhvvyalshvcgqdrtllasi...........................................
ENSP00000356621  lpmeqykefaefvtsnytmlcsvlepvisvrnkeelacalvhilqstgrakdfltdlvmsevdrcgehdvlifrentiatk
ENSP00000335029  sdyysplrdlllksadvepvsasaahilgevcrekqeaavplvrlflhygrvvpfisaiasaevkrtqdpntifrgnslas
ENSP00000348498  elvtmmgdqgelpiamalanvvpcsqwdelarvlvtlfdsrhllyqllwnmfskeveladsmqtlfrgnslaskimtfcfk
ENSP00000293748  lpmelykefaeyvtnhyrmlcavlepalnvkgkeevasalvhilqstgkakdflsdmamsevdrfmerehlifrentlatk
ENSP00000348072  lpmelykefaeyvtnhyrmlcavlepalnvkgkeevasalvhilqstgkakdflsdmamsevdrfmerehlifrentlatk
ENSP00000448510  lpsqcyqplmellmesvqgpaeedtasplalleeltlgdcrqdlatklvklflgrglagrfldyltrrevartmdpntlfr
ENSP00000424293  lpseyygplktlllkspdvqpisasaayilseicrdkndavlplvrlllhhdklvpfatavaeldlkdtqdantifrgnsl
ENSP00000274364  etyqqlfyllqtnplylaklifqmpqnkstkfmdtviftlynyasnqreeylllklfktaleeeikskvdqvqdivtgnpt
ENSP00000341905  erykelaefltfhyarlcgalepalpaqakeelaaamvrvlratgraqalvtdlgtaelarcggreallfrentlatkaid
ENSP00000268182  eayqhlfyllqtnptylaklifqmpqnkstkfmdsviftlynyasnqreeylllrlfktalqeeikskvdqiqeivtgnpt
ENSP00000262940  lpssyyqplvhllchevklgmqgpgqliplieettstecrqdva.....................................
ENSP00000417373  lpssyyqplvhllchevklgmqgpgqliplieettstecrqdva.....................................
ENSP00000354451  eayqhlfyllqtqpiylaklifqmpqnkttkfmeavifslynyassrreaylllqlfktalqeeikskveqpqdvvtgnpt
ENSP00000386560  .................................................................................
ENSP00000364394  i................................................................................
ENSP00000295497  k................................................................................
ENSP00000442812  v................................................................................
ENSP00000264343  f................................................................................
ENSP00000365592  t................................................................................
ENSP00000446550  .................................................................................
ENSP00000403323  .................................................................................
ENSP00000455109  a................................................................................
ENSP00000393539  a................................................................................
ENSP00000422663  l................................................................................
ENSP00000350480  y................................................................................
ENSP00000399162  s................................................................................
ENSP00000353587  s................................................................................
ENSP00000378450  q................................................................................
ENSP00000310491  l................................................................................
ENSP00000385720  e................................................................................
ENSP00000393307  w................................................................................
ENSP00000264245  a................................................................................
ENSP00000310561  r................................................................................
ENSP00000342566  s................................................................................
ENSP00000221905  r................................................................................
ENSP00000356995  r................................................................................
ENSP00000349660  m................................................................................
ENSP00000377380  r................................................................................
ENSP00000289968  a................................................................................
ENSP00000251772  tlfgqlltkkhflltfirtleaqrsfsmrdrgnvaslimtalqgemeyatgvlkqllsdlieknlesknhpklllrrtesv
ENSP00000291107  .................................................................................
ENSP00000397075  r................................................................................
ENSP00000295713  tvrk.............................................................................
ENSP00000347710  .................................................................................
ENSP00000336923  t................................................................................
ENSP00000323194  lklfaqlinnkvfllsfirtlesqrsfsmrdrgnvaslimtvlqskleyatdvlkqlladlidknlesknhpklllrrtes
ENSP00000337287  l................................................................................
ENSP00000354732  l................................................................................
ENSP00000386241  .................................................................................
ENSP00000274498  .................................................................................
ENSP00000303507  .................................................................................
ENSP00000356000  kalklfaqlinnkvflltfirtlelqrsfsmrdrgnvaslimtglqgrleyatdvlkqllsdlidknlenknhpklllrrt
ENSP00000298815  .................................................................................
ENSP00000359033  .................................................................................
ENSP00000380444  e................................................................................
ENSP00000358696  kalrlfgqllhsrafvltfihtleaqssfsmrdrgtvasltmvalqsrldyatgllkqlladlieknlesknhpklllrrt
ENSP00000338967  iy...............................................................................
ENSP00000467525  pd...............................................................................
ENSP00000350018  .................................................................................
ENSP00000352288  eqalyqfsnllnsksflinfihtlenqrefsarakvyfaslltvalhgkleyytdimhtlflelleqyvvaknpklmlrrs
ENSP00000309871  ts...............................................................................
ENSP00000322650  ds...............................................................................
ENSP00000335506  gd...............................................................................
ENSP00000377646  aygeflsrlrenprliasslvageklnqentqsviytvftslygncimqedesyllqvlryliefelkesdnprrllrrgt
ENSP00000276297  d................................................................................
ENSP00000260526  ke...............................................................................
ENSP00000341489  e................................................................................
ENSP00000357131  d................................................................................
ENSP00000414822  e................................................................................
ENSP00000019317  d................................................................................
ENSP00000296440  qglgqlsnllnsklfltkfihtlesqrtfsardrayvaslltvalhgkleyftdilrtllsdlvaqyvaknpklmlrrtet
ENSP00000340594  pi...............................................................................
ENSP00000382300  .................................................................................
ENSP00000351333  gv...............................................................................
ENSP00000363725  qr...............................................................................
ENSP00000392760  i................................................................................
ENSP00000033079  .................................................................................
ENSP00000355090  i................................................................................
ENSP00000406907  r................................................................................
ENSP00000366522  .................................................................................
ENSP00000276211  ia...............................................................................
ENSP00000302895  sk...............................................................................
ENSP00000445569  gltqlsnllnsklflltlihtleeqpsfsqrdrchvasllslalhgkleyltdimrtllgdlaahyvhrnpklmlrrtetm
ENSP00000379855  dla..............................................................................
ENSP00000421148  qms..............................................................................
ENSP00000362114  p................................................................................
ENSP00000349635  p................................................................................
ENSP00000317128  islfssllnnkhflivfvhaleqqkdfavrdrcslaslltialhgkleyytsimkellvdlidasaaknpklmlrrtesvv
ENSP00000258526  knesltaldalicnksflvtvihtlekqknfsvkdrclfasfltialqtklvyltsilevltrdlmeqcsnmqpklmlrrt
ENSP00000265036  h................................................................................
ENSP00000222254  dlp..............................................................................
ENSP00000412292  tskrgv...........................................................................


                                                                                                    
                                                                                                    
d1tx4a_            .................................................................................
ENSP00000362887  aieeylklvgqkylqdalgefikalyesdencevdpskcsaadlpehqgnlkmccelafckiinsycvfprelkevfaswr
ENSP00000274376  .................................................................................
ENSP00000356621  sieeylklvgqqylhdalgefikalyesdencevdpskcssselidhqsnlkmccelafckiinsycvfprelkevfaswk
ENSP00000335029  kcidetmklagmhylhvtlkpaieeicqshkpceidpvklkdgenlennmenlrqyvdrvfhaitesgvscptvmcdiffs
ENSP00000348498  vygatylqklldpllrivitssdwqhvsfevdptrlep...........................................
ENSP00000293748  aieeymrligqkylkdaigefiralyeseencevdpikctasslaehqanlrmccelalckvvnshcvfprelkevfaswr
ENSP00000348072  aieeymrligqkylkdaigefiralyeseencevdpikctasslaehqanlrmccelalckvvnshcvfprelkevfaswr
ENSP00000448510  snslasksmeqfmklvgmpylhevlkpvisrvfeekkymeldpckmdlgrtrrisfkgalseeqmretslglltgylgpiv
ENSP00000424293  atrcldemmkivgghylkvtlkpildeicdssksceidpiklkegdnvennkenlryyvdklfntivkss...........
ENSP00000274364  vikmvvsfnrgargqntlrqllapvvkeiiddksliintnpvevykawvnqletqtgeasklpydvtteqaltypevknkl
ENSP00000341905  eymklvaqdylqetlgqvvrrlcastedcevdpskcpaselpehqarlrnsceevfetiihsydwfpaelgivfsswreac
ENSP00000268182  vikmvvsfnrgargqnalrqilapvvkeimddkslniktdpvdiykswvnqmesqtgeasklpydvtpeqalaheevktrl
ENSP00000262940  .................................................................................
ENSP00000417373  .................................................................................
ENSP00000354451  vvrlvvrfyrngrgqsalqeilgkviqdvledkvlsvhtdpvhlyknwinqteaqtgqrshlpydvtpeqalshpevqrr.
ENSP00000386560  .................................................................................
ENSP00000364394  .................................................................................
ENSP00000295497  .................................................................................
ENSP00000442812  .................................................................................
ENSP00000264343  .................................................................................
ENSP00000365592  .................................................................................
ENSP00000446550  .................................................................................
ENSP00000403323  .................................................................................
ENSP00000455109  .................................................................................
ENSP00000393539  .................................................................................
ENSP00000422663  .................................................................................
ENSP00000350480  .................................................................................
ENSP00000399162  .................................................................................
ENSP00000353587  .................................................................................
ENSP00000378450  .................................................................................
ENSP00000310491  .................................................................................
ENSP00000385720  .................................................................................
ENSP00000393307  .................................................................................
ENSP00000264245  .................................................................................
ENSP00000310561  .................................................................................
ENSP00000342566  .................................................................................
ENSP00000221905  .................................................................................
ENSP00000356995  .................................................................................
ENSP00000349660  .................................................................................
ENSP00000377380  .................................................................................
ENSP00000289968  .................................................................................
ENSP00000251772  aekmltnwftfllykflkecageplfmlycaikqqmekgpidaitgearyslsedklirqqidyktltlncvnpenenape
ENSP00000291107  .................................................................................
ENSP00000397075  .................................................................................
ENSP00000295713  .................................................................................
ENSP00000347710  .................................................................................
ENSP00000336923  .................................................................................
ENSP00000323194  vaekmltnwftfllykflkecageplfslfcaikqqmekgpidaitgearyslsedklirqqidyktlvlscvspdnansp
ENSP00000337287  .................................................................................
ENSP00000354732  .................................................................................
ENSP00000386241  .................................................................................
ENSP00000274498  .................................................................................
ENSP00000303507  .................................................................................
ENSP00000356000  esvaekmltnwfafllhkflkecageplfmlycaikqqmekgpidaitgearyslsedklirqqieyktlilncvnpdnen
ENSP00000298815  .................................................................................
ENSP00000359033  .................................................................................
ENSP00000380444  .................................................................................
ENSP00000358696  esvaekmltnwftfllhkflkecageplfllycaikqqmekgpidaitgearyslsedklirqqidyktltlhcvcpeneg
ENSP00000338967  .................................................................................
ENSP00000467525  .................................................................................
ENSP00000350018  .................................................................................
ENSP00000352288  etvvermlsnwmsiclyqylkdsageplyklfkaikhqvekgpvdavqkkakytlndtgllgddveyapltvsvivqdegv
ENSP00000309871  .................................................................................
ENSP00000322650  .................................................................................
ENSP00000335506  .................................................................................
ENSP00000377646  cafsilfklfseglfsaklfltatlhepimqllvededhletdpnklierfspsq..........................
ENSP00000276297  .................................................................................
ENSP00000260526  .................................................................................
ENSP00000341489  .................................................................................
ENSP00000357131  .................................................................................
ENSP00000414822  .................................................................................
ENSP00000019317  .................................................................................
ENSP00000296440  vveklltnwmsiclytfvrdsvgeplymlfrgikhqvdkgpvdsvtgkakytlndnrllredveyrpltlnallavgpgag
ENSP00000340594  .................................................................................
ENSP00000382300  .................................................................................
ENSP00000351333  .................................................................................
ENSP00000363725  .................................................................................
ENSP00000392760  .................................................................................
ENSP00000033079  .................................................................................
ENSP00000355090  .................................................................................
ENSP00000406907  .................................................................................
ENSP00000366522  .................................................................................
ENSP00000276211  .................................................................................
ENSP00000302895  .................................................................................
ENSP00000445569  veklltnwlsiclyaflrevageplymlfraiqyqvdkgpvdavtgkakrtlndsrllredvefqpltlmvlvgpgaggaa
ENSP00000379855  .................................................................................
ENSP00000421148  .................................................................................
ENSP00000362114  .................................................................................
ENSP00000349635  .................................................................................
ENSP00000317128  ekmltnwmsicmysclretvgepfflllcaikqqinkgsidaitgkarytlseewll........................
ENSP00000258526  esvveklltnwmsvclsgflretvgepfyllvttlnqkinkgpvdvitckalytlnedwllwqvpefstvalnvvfekipe
ENSP00000265036  .................................................................................
ENSP00000222254  .................................................................................
ENSP00000412292  .................................................................................


                                                                                                    
                                                                                                    
d1tx4a_            .................................................................................
ENSP00000362887  qecssrgrpdiserlisasl.............................................................
ENSP00000274376  .................................................................................
ENSP00000356621  qqclnrgkqdiserlisaslflrflcpaimspslfnlmqeypddrtsrtltliakviqnlan...................
ENSP00000335029  lreaaakrfqddpdvrytavssfiflrffapa.................................................
ENSP00000348498  .................................................................................
ENSP00000293748  lrcaergrediadrlisas..............................................................
ENSP00000348072  lrcaergrediadrlisas..............................................................
ENSP00000448510  daivgsvgrcppamrlafkqlh...........................................................
ENSP00000424293  .................................................................................
ENSP00000274364  easienlrrvtdkvlnsiissl...........................................................
ENSP00000341905  kergsevlgprlvcaslflrllcpailapslfgl...............................................
ENSP00000268182  dssirnmravtdkflsaivssvdkipygmrfiakv..............................................
ENSP00000262940  .................................................................................
ENSP00000417373  .................................................................................
ENSP00000354451  .................................................................................
ENSP00000386560  .................................................................................
ENSP00000364394  .................................................................................
ENSP00000295497  .................................................................................
ENSP00000442812  .................................................................................
ENSP00000264343  .................................................................................
ENSP00000365592  .................................................................................
ENSP00000446550  .................................................................................
ENSP00000403323  .................................................................................
ENSP00000455109  .................................................................................
ENSP00000393539  .................................................................................
ENSP00000422663  .................................................................................
ENSP00000350480  .................................................................................
ENSP00000399162  .................................................................................
ENSP00000353587  .................................................................................
ENSP00000378450  .................................................................................
ENSP00000310491  .................................................................................
ENSP00000385720  .................................................................................
ENSP00000393307  .................................................................................
ENSP00000264245  .................................................................................
ENSP00000310561  .................................................................................
ENSP00000342566  .................................................................................
ENSP00000221905  .................................................................................
ENSP00000356995  .................................................................................
ENSP00000349660  .................................................................................
ENSP00000377380  .................................................................................
ENSP00000289968  .................................................................................
ENSP00000251772  vpvkgldcdtvtqakeklldaaykgvpysqrpkaadmdlewrqgrmariilqdedvttkidndwkrlntlahyqvtdgssv
ENSP00000291107  .................................................................................
ENSP00000397075  .................................................................................
ENSP00000295713  .................................................................................
ENSP00000347710  .................................................................................
ENSP00000336923  .................................................................................
ENSP00000323194  evpvkilncdtitqvkekildaifknvpcshrpkaadmdlewrqgsgarmilqdedittkiendwkrlntlahyqvpdgsv
ENSP00000337287  .................................................................................
ENSP00000354732  .................................................................................
ENSP00000386241  .................................................................................
ENSP00000274498  .................................................................................
ENSP00000303507  .................................................................................
ENSP00000356000  speipvkvlncdtitqvkekildavyknvpysqrpravdmdlewrqgriarvvlqdedittkiegdwkrlntlmhyqvsdr
ENSP00000298815  .................................................................................
ENSP00000359033  .................................................................................
ENSP00000380444  .................................................................................
ENSP00000358696  saqvpvkvlncdsitqakdklldtvykgipysqrpkaedmdlewrqgrmtriilqdedvttkiecdwkrlnslahyqvtdg
ENSP00000338967  .................................................................................
ENSP00000467525  .................................................................................
ENSP00000350018  .................................................................................
ENSP00000352288  daipvkvlncdtisqvkekiidqvyrgqpcscwprpdsvvlewrpgstaqilsdldltsqregrwkrvntlmhynvrdgat
ENSP00000309871  .................................................................................
ENSP00000322650  .................................................................................
ENSP00000335506  .................................................................................
ENSP00000377646  .................................................................................
ENSP00000276297  .................................................................................
ENSP00000260526  .................................................................................
ENSP00000341489  .................................................................................
ENSP00000357131  .................................................................................
ENSP00000414822  .................................................................................
ENSP00000019317  .................................................................................
ENSP00000296440  eaqgvpvkvldcdtisqakekmldqlykgvpltqrpdprtldvewrsgvaghlilsdedvtsevqglwrrlntlqhykvpd
ENSP00000340594  .................................................................................
ENSP00000382300  .................................................................................
ENSP00000351333  .................................................................................
ENSP00000363725  .................................................................................
ENSP00000392760  .................................................................................
ENSP00000033079  .................................................................................
ENSP00000355090  .................................................................................
ENSP00000406907  .................................................................................
ENSP00000366522  .................................................................................
ENSP00000276211  .................................................................................
ENSP00000302895  .................................................................................
ENSP00000445569  gssemqrvparvldtdtitqvkekvldqvykgtpfsqrpsvhaldlewrsglaghltlsdedltsvtqnhwkrlntlqhyk
ENSP00000379855  .................................................................................
ENSP00000421148  .................................................................................
ENSP00000362114  .................................................................................
ENSP00000349635  .................................................................................
ENSP00000317128  .................................................................................
ENSP00000258526  nesadvcrnisvnvldcdtigqakekifqaflskngspyglqlneiglelqmgtrqkelldidsssviledgitklntigh
ENSP00000265036  .................................................................................
ENSP00000222254  .................................................................................
ENSP00000412292  .................................................................................


                                                                                                    
                                                                                                    
d1tx4a_            .................................................................................
ENSP00000362887  .................................................................................
ENSP00000274376  .................................................................................
ENSP00000356621  .................................................................................
ENSP00000335029  .................................................................................
ENSP00000348498  .................................................................................
ENSP00000293748  .................................................................................
ENSP00000348072  .................................................................................
ENSP00000448510  .................................................................................
ENSP00000424293  .................................................................................
ENSP00000274364  .................................................................................
ENSP00000341905  .................................................................................
ENSP00000268182  .................................................................................
ENSP00000262940  .................................................................................
ENSP00000417373  .................................................................................
ENSP00000354451  .................................................................................
ENSP00000386560  .................................................................................
ENSP00000364394  .................................................................................
ENSP00000295497  .................................................................................
ENSP00000442812  .................................................................................
ENSP00000264343  .................................................................................
ENSP00000365592  .................................................................................
ENSP00000446550  .................................................................................
ENSP00000403323  .................................................................................
ENSP00000455109  .................................................................................
ENSP00000393539  .................................................................................
ENSP00000422663  .................................................................................
ENSP00000350480  .................................................................................
ENSP00000399162  .................................................................................
ENSP00000353587  .................................................................................
ENSP00000378450  .................................................................................
ENSP00000310491  .................................................................................
ENSP00000385720  .................................................................................
ENSP00000393307  .................................................................................
ENSP00000264245  .................................................................................
ENSP00000310561  .................................................................................
ENSP00000342566  .................................................................................
ENSP00000221905  .................................................................................
ENSP00000356995  .................................................................................
ENSP00000349660  .................................................................................
ENSP00000377380  .................................................................................
ENSP00000289968  .................................................................................
ENSP00000251772  alvpkqtsaynisnsstftkslsryesmlrtasspdslrsrtpmitpdlesgtklwhlvknhdhldqregdrgskmvseiy
ENSP00000291107  .................................................................................
ENSP00000397075  .................................................................................
ENSP00000295713  .................................................................................
ENSP00000347710  .................................................................................
ENSP00000336923  .................................................................................
ENSP00000323194  valvskqvtaynavnnstvsrtsaskyenmirytgspdslrsrtpmitpdlesgvkmwhlvknhehgdqkegdrgskmvse
ENSP00000337287  .................................................................................
ENSP00000354732  .................................................................................
ENSP00000386241  .................................................................................
ENSP00000274498  .................................................................................
ENSP00000303507  .................................................................................
ENSP00000356000  svvalvpkqtssynipasasisrtsisrydssfrytgspdslrsrapmitpdlesgvkvwhlvknhdhgdqkegdrgskmv
ENSP00000298815  .................................................................................
ENSP00000359033  .................................................................................
ENSP00000380444  .................................................................................
ENSP00000358696  slvalvpkqvsaynmansftftrslsryesllrtasspdslrsrapmitpdqetgtklwhlvknhdhadhregdrgskmvs
ENSP00000338967  .................................................................................
ENSP00000467525  .................................................................................
ENSP00000350018  .................................................................................
ENSP00000352288  lilskvgvsqqpedsqqdlpgerhalleeenrvwhlvrptdevdegkskrgsvkekertkaiteiyltrllsvkgtlqqfv
ENSP00000309871  .................................................................................
ENSP00000322650  .................................................................................
ENSP00000335506  .................................................................................
ENSP00000377646  .................................................................................
ENSP00000276297  .................................................................................
ENSP00000260526  .................................................................................
ENSP00000341489  .................................................................................
ENSP00000357131  .................................................................................
ENSP00000414822  .................................................................................
ENSP00000019317  .................................................................................
ENSP00000296440  gatvalvpcltkhvlrenqdyvpgertpmledvdeggirpwhlvkpsdepepprprrgslrggererakaipeiyltrlls
ENSP00000340594  .................................................................................
ENSP00000382300  .................................................................................
ENSP00000351333  .................................................................................
ENSP00000363725  .................................................................................
ENSP00000392760  .................................................................................
ENSP00000033079  .................................................................................
ENSP00000355090  .................................................................................
ENSP00000406907  .................................................................................
ENSP00000366522  .................................................................................
ENSP00000276211  .................................................................................
ENSP00000302895  .................................................................................
ENSP00000445569  vpdgatvglvpqlhrgstisqslaqrcplgeniptledgeeggvclwhlvkateepegakvrcsslrereparakaipeiy
ENSP00000379855  .................................................................................
ENSP00000421148  .................................................................................
ENSP00000362114  .................................................................................
ENSP00000349635  .................................................................................
ENSP00000317128  .................................................................................
ENSP00000258526  yeisngstikvfkkianftsdveysddhchlilpdseafqdvqgkrhrgkhkfkvkemylt....................
ENSP00000265036  .................................................................................
ENSP00000222254  .................................................................................
ENSP00000412292  .................................................................................


                                                             10           20                        
                                                              |            |                        
d1tx4a_            ..................................-LPNQQFGVSLQHLQEKNP...E........................
ENSP00000362887  ..................................-------------------...-........................
ENSP00000274376  ..................................-------------------...-........................
ENSP00000356621  ..................................-------------------...-........................
ENSP00000335029  ..................................-------------------...-........................
ENSP00000348498  ..................................-------------------...-........................
ENSP00000293748  ..................................-------------------...-........................
ENSP00000348072  ..................................-------------------...-........................
ENSP00000448510  ..................................-------------------...-........................
ENSP00000424293  ..................................-------------------...-........................
ENSP00000274364  ..................................-------------------...-........................
ENSP00000341905  ..................................-------------------...-........................
ENSP00000268182  ..................................-------------------...-........................
ENSP00000262940  ..................................-------------------...-........................
ENSP00000417373  ..................................-------------------...-........................
ENSP00000354451  ..................................-------------------...-........................
ENSP00000386560  ..................................----QIFGSHLHKVCERE-...-........................
ENSP00000364394  ..................................--KDQVFGSNLANLCQRE-...-........................
ENSP00000295497  ..................................-----VYSCDLTTLVKAH-...-........................
ENSP00000442812  ..................................------YCCDLTTLVKAH-...-........................
ENSP00000264343  ..................................--GGGIFGQKLEDTVRYEKry.G........................
ENSP00000365592  ..................................------FGVRLDDCPPAH-...T........................
ENSP00000446550  ..................................----QVFGCALAALCERE-...-........................
ENSP00000403323  ..................................----QVFGCALAALCERE-...-........................
ENSP00000455109  ..................................------FGVRLEECQPAT-...E........................
ENSP00000393539  ..................................------FGVRLEECQPAT-...E........................
ENSP00000422663  ..................................--PPGIFGQRLEETVHHERky.G........................
ENSP00000350480  ..................................--NTKLFNGDLETFVKDS-...-........................
ENSP00000399162  ..................................---SRQFGVELSRLTSED-...-........................
ENSP00000353587  ..................................---HKLFNGSMEAFIKDS-...-........................
ENSP00000378450  ..................................----KLFGVSLQELERQGL...T........................
ENSP00000310491  ..................................--PNQQFGVSLQHLQEKNP...E........................
ENSP00000385720  ..................................---SNYFGVPLTTVVTPE-...-........................
ENSP00000393307  ..................................--ESNYFGMPLQDLVTAE-...-........................
ENSP00000264245  ..................................------FGCDLTEYLESS-...-........................
ENSP00000310561  ..................................-----VFGCDLGEHLLNS-...-........................
ENSP00000342566  ..................................------FGKPLEEHLTIS-...-........................
ENSP00000221905  ..................................-----VFGCDLGEHLSNS-...-........................
ENSP00000356995  ..................................-----VFGCDLQEHLQHS-...-........................
ENSP00000349660  ..................................--PGQLFGISLPNICE---...-........................
ENSP00000377380  ..................................---DQVFGCQLESLCQRE-...-........................
ENSP00000289968  ..................................------FGTPLEEHLKRS-...-........................
ENSP00000251772  ................ltrllatkgtlqkfvddl----------F--------...-........................
ENSP00000291107  ..................................----GVFGVKISVVTKRE-...-........................
ENSP00000397075  ..................................---TPLFGVDFLQLPRDF-...-........................
ENSP00000295713  ..................................-----------------QD...S........................
ENSP00000347710  ..................................-------------------...-........................
ENSP00000336923  ..................................-------------------...-........................
ENSP00000323194  .............iyltrllatkgtlqkfvddlf-----------E-------...-........................
ENSP00000337287  ..................................--PTQQFGVSLQYLKDKN-...Q........................
ENSP00000354732  ..................................--PTQQFGVSLQYLKDKN-...Q........................
ENSP00000386241  ..................................-----VFGQRLDETVAYEQkf.G........................
ENSP00000274498  ..................................-------------------...-........................
ENSP00000303507  ..................................----GVFGVKIAVVTKRE-...-........................
ENSP00000356000  seiyltrllatkgtlqkfvddlfetlfstvhrgs-------------------...-........................
ENSP00000298815  ..................................-------------------...-........................
ENSP00000359033  ..................................-----LFGGDMEKFIQSS-...-........................
ENSP00000380444  ..................................---PGHFGVCVDSLTSDK-...-........................
ENSP00000358696  ............................eiyltr-------------------...-........................
ENSP00000338967  ..................................-------------------...-........................
ENSP00000467525  ..................................-------------------...-........................
ENSP00000350018  ..................................-----VYGVSLATHLQEL-...-........................
ENSP00000352288  ........................dnffqsvlap-------------------...-........................
ENSP00000309871  ..................................-------------------...-........................
ENSP00000322650  ..................................-------------------...-........................
ENSP00000335506  ..................................-------------------...-........................
ENSP00000377646  ..................................-------------------...-........................
ENSP00000276297  ..................................---RSVFGVPLTVNVQRT-...-........................
ENSP00000260526  ..................................-------------------...-........................
ENSP00000341489  ..................................---PRVFGLPLPLLVERER...P........................
ENSP00000357131  ..................................---SGLFCVPLTALLEQDQrkvP........................
ENSP00000414822  ..................................---TRLFGVPLDSLLEADHkvlP........................
ENSP00000019317  ..................................-------------------...-........................
ENSP00000296440  ...............mkgtlqkfvddlfqvilst-------------------...-........................
ENSP00000340594  ..................................-----IFGVDIQKVVEKEN...I........................
ENSP00000382300  ..................................-----VFGVPLIVHVQRT-...-........................
ENSP00000351333  ..................................-----IFGSPLTEEGIAQ-...-........................
ENSP00000363725  ..................................-------------------...T........................
ENSP00000392760  ..................................--GGKIFGVPFNALPHSAVp..E........................
ENSP00000033079  ..................................---NKIFGIPLDELQQGGH...P........................
ENSP00000355090  ..................................--GGKIFGVPFNALPHSAVp..E........................
ENSP00000406907  ..................................--DNGIFGVPLTVLLDGDRkkdP........................
ENSP00000366522  ..................................-----MFGSALQEVMGMQReryP........................
ENSP00000276211  ..................................-------------------...-........................
ENSP00000302895  ..................................-------------------...-........................
ENSP00000445569  .................ltrllsmkgtlqkfvdd-------------------...-........................
ENSP00000379855  ..................................---------------EQFA...P........................
ENSP00000421148  ..................................-------------------...-........................
ENSP00000362114  ..................................----SCFGSPIHTLCYMRE...Pildlpletiseltlmpvwtgddgs
ENSP00000349635  ..................................----SCFGTSLEALCRMKR...Pirevpvtklidleedsflekeksl
ENSP00000317128  ..................................-------------------...-........................
ENSP00000258526  ..................................-------------------...-........................
ENSP00000265036  ..................................----NVYSVSKQGVVILDD...K........................
ENSP00000222254  ..................................---------------EQFS...P........................
ENSP00000412292  ..................................--------------VILQN...K........................


                                        30          40        50        60             70           
                                         |           |         |         |              |           
d1tx4a_            .............QEPIPIVLRETVAYLQA.HA.LTTEGIFRRSANTQVVREVQQKYNMGLPVD.....FDQ.........
ENSP00000362887  .............-----------------.--.------------------------------.....---.........
ENSP00000274376  .............-----------------.--.------------------------------.....---.........
ENSP00000356621  .............-----------------.--.------------------------------.....---.........
ENSP00000335029  .............-----------------.--.------------------------------.....---.........
ENSP00000348498  .............-----------------.--.------------------------------.....---.........
ENSP00000293748  .............-----------------.--.------------------------------.....---.........
ENSP00000348072  .............-----------------.--.------------------------------.....---.........
ENSP00000448510  .............-----------------.--.--------------------R---------.....---.........
ENSP00000424293  .............-M---------------.--.------------------------------.....---.........
ENSP00000274364  .............-----------------.--.------------------------------.....D--.........
ENSP00000341905  .............-----------------.--.------------------------------.....---.........
ENSP00000268182  .............-----------------.--.------------------------------.....---.........
ENSP00000262940  .............-----------------.--.------------------------------.....---.........
ENSP00000417373  .............-----------------.--.------------------------------.....---.........
ENSP00000354451  .............-----------------.--.------------------------------.....---.........
ENSP00000386560  .............NSTVPWFVKQCIEAVEK.RG.LDVDGIYRVSGNLATIQKLRFIVNQEEKLNld...DSQ.........
ENSP00000364394  .............NGTVPKFVKLCIEHVEE.HG.LDIDGIYRVSGNLAVIQKLRFAVNHDEKLDln...DSK.........
ENSP00000295497  .............TTKRPMVVDMCIREIES.RG.LNSEGLYRVSGFSDLIEDVKMAFDRDGEKA.....DISvnm......
ENSP00000442812  .............NTQRPMVVDICIREIEA.RG.LKSEGLYRVSGFTEHIEDVKMAFDRDGEKA.....DISanv......
ENSP00000264343  .............NRLAPMLVEQCVDFIRQ.RG.LKEEGLFRLPGQANLVKELQDAFDCGEKPS.....FDS.........
ENSP00000365592  .............NRYIPLIVDICCKLVEE.RG.LEYTGIYRVPGNNAAISSMQEELNKGMADIdiq..DDK.........
ENSP00000446550  .............RSRVPRFVQQCIRAVEA.RG.LDIDGLYRISGNLATIQKLRYKVDHDERLDld...DGR.........
ENSP00000403323  .............RSRVPRFVQQCIRAVEA.RG.LDIDGLYRISGNLATIQKLRYKVDHDERLDld...DGR.........
ENSP00000455109  .............NQRVPLIVAACCRIVEA.RG.LESTGIYRVPGNNAVVSSLQEQLNRGPGDInlq..DER.........
ENSP00000393539  .............NQRVPLIVAACCRIVEA.RG.LESTGIYRVPGNNAVVSSLQEQLNRGPGDInlq..DER.........
ENSP00000422663  .............PRLAPLLVEQCVDFIRE.RG.LTEEGLFRMPGQANLVRDLQDSFDCGEKPL.....FDS.........
ENSP00000350480  .............GQVIPLIVESCIRFINL.YG.LQHQGIFRVSGSQVEVNDIKNSFERGENPLad...DQS.........
ENSP00000399162  .............-RTVPLVVEKLINYIEM.HG.LYTEGIYRKSGSTNKIKELRQGLDTDAESV.....NLD.........
ENSP00000353587  .............GQAIPLVVESCIRYINL.YG.LQQQGIFRVPGSQVEVNDIKNSFERGEDPLvd...DQN.........
ENSP00000378450  .............ENGIPAVVWNIVEYLTQ.HG.LTQEGLFRVNGNVKVVEQLRLKFESGVPVE.....LGK.........
ENSP00000310491  .............QEPIPIVLRETVAYLQA.HA.LTTEGIFRRSANTQVVREVQQKYNMGLPVD.....FDQ.........
ENSP00000385720  .............-KPIPIFIERCIEYIEA.TG.LSTEGIYRVSGNKSEMESLQRQFDQDHNLDl....AEK.........
ENSP00000393307  .............-KPIPLFVEKCVEFIED.TG.LCTEGLYRVSGNKTDQDNIQKQFDQDHNINl....VSM.........
ENSP00000264245  .............GQDVPYVLKSCAEFIET.HG.I-VDGIYRLSGVTSNIQRLRQEFGSDQCPDltr..EVY.........
ENSP00000310561  .............GFEVPQVLQSCTAFIER.YG.I-VDGIYRLSGVASNIQRLRHEFDSEHVPDltk..EPY.........
ENSP00000342566  .............GREIAFPIEACVTMLLE.CG.MQEEGLFRVAPSASKLKKLKAALDCCVVDV.....QEY.........
ENSP00000221905  .............GQDVPQVLRCCSEFIEA.HG.V-VDGIYRLSGVSSNIQRLRHEFDSERIPE.....-LSgpaf.....
ENSP00000356995  .............GQEVPQVLKSCAEFVEE.YG.V-VDGIYRLSGVSSNIQKLRQEFESERKPDlrr..DVY.........
ENSP00000349660  .............NDNLPKPVLDMLFFLNQ.KG.PLTKGIFRQSANVKSCRELKEKLNSGVEV-.....HLD.........
ENSP00000377380  .............GDTVPSFLRLCIAAVDK.RG.LDVDGIYRVSGNLAVVQKLRFLVDRERAVT.....SDGryvfpeqpg
ENSP00000289968  .............GREIALPIEACVMLLLE.TG.MKEEGLFRIGAGASKLKKLKAALDCSTSHL.....DEF.........
ENSP00000251772  .............-----------------.--.------------------------------.....---.........
ENSP00000291107  .............RSKVPYIVRQCVEEVEK.RG.IEEVGIYRISGVATDIQALKAVFDANNKDIll...MLS.........
ENSP00000397075  .............PEEVPFVVTKCTAEIEH.RA.LDVQGIYRVSGSRVRVERLCQAFENGRALV.....ELS.........
ENSP00000295713  .............SQAIPLVVESCIRFISR.HG.LQHEGIFRVSGSQVEVNDIKNAFERGEDPLag...DQN.........
ENSP00000347710  .............------FVRKCINIIET.KG.IKTEGLYRTVGSNIQVQKLLNAFFDPKCPG.....DVDfhns.....
ENSP00000336923  .............------IIRKCISAVET.RG.INDQGLYRVVGVSSKVQRLLSMLMDVKTCNevdleNSA.........
ENSP00000323194  .............-----------------.--.------------------------------.....---.........
ENSP00000337287  .............GELIPPVLRFTVTYLRE.KG.LRTEGLFRRSASVQTVREIQRLYNQGKPVN.....FDD.........
ENSP00000354732  .............GELIPPVLRFTVTYLRE.KG.LRTEGLFRRSASVQTVREIQRLYNQGKPVN.....FDD.........
ENSP00000386241  .............PHLVPILVEKCAEFILE.HG.RNEEGIFRLPGQDNLVKQLRDAFDAGERPS.....FDR.........
ENSP00000274498  .............------IIRKCIHAVET.RG.INEQGLYRIVGVNSRVQKLLSVLMDPKTASetetdICA.........
ENSP00000303507  .............RSKVPYIVRQCVEEIER.RG.MEEVGIYRVSGVATDIQALKAAFDVNNKDVsv...MMS.........
ENSP00000356000  .............--A--------------.--.------------------------------.....---.........
ENSP00000298815  .............------FVRKCIQAVET.RG.ITILGLYRIGGVNSKVQKLMNTTFSPKSPPdidi.DIE.........
ENSP00000359033  .............GQPVPLVVESCIRFINL.NG.LQHEGIFRVSGAQLRVSEIRDAFERGEDPLve...GCT.........
ENSP00000380444  .............-ASVPIVLEKLLEHVEM.HG.LYTEGLYRKSGAANRTRELRQALQTDPAAV.....KLE.........
ENSP00000358696  .............-----------------.--.------------------------------.....---.........
ENSP00000338967  .............-RQVPRLVDSCCQHLEK.HG.LQTVGIFRVGSSKKRVRQLREEFDRGIDVS.....LEE.........
ENSP00000467525  .............--GVPFIVKKCVCEIER.RA.LRTKGIYRVNGVKTRVEKLCQAFENGKELV.....ELS.........
ENSP00000350018  .............GREIALPIEACVMMLLS.EG.MKEEGLFRLAAGASVLKRLKQTMASDPHSL.....EEF.........
ENSP00000352288  .............GHAVPPAVKYFFDFLD-.--.------------------------------.....---.........
ENSP00000309871  .............-PMIPSIVVHCVNEIEQ.RG.LTETGLYRISGCDRTVKELKEKFLRVKTVPl....LSK.........
ENSP00000322650  .............-DTLPRPIQDILTILCL.KG.PSTEGIFRRAANEKARKELKEELNSGDAV-.....DLE.........
ENSP00000335506  .............-SDIPVIVYRCVDYITQ.CG.LTSEGIYRKCGQTSKTQRLLESLRQDARSVhl...KEG.........
ENSP00000377646  .............-----------------.--.--QEKLFGEKGSDRFRQKVQEMVESNE---.....---.........
ENSP00000276297  .............GQPLPQSIQQAMRYLRN.HC.LDQVGLFRKSGVKSRIQALRQMNEGAIDCV.....NYE.........
ENSP00000260526  .............PDGIPFILKICASEIEN.RA.LCLQGIYRVCGNKIKTEKLCQALENGMHLV.....DIS.........
ENSP00000341489  .............PGQVPLIIQKCVGQIER.RG.LRVVGLYRLCGSAAVKKELRDAFERDSAAV.....CLSedl......
ENSP00000357131  .............GMRIPLIFQKLISRIEE.RG.LETEGLLRIPGAAIRIKNLCQELEAKFYEGtf...NWE.........
ENSP00000414822  .............STQVPLVLQALLSCLEK.RG.LDMEGILRVPGSQARVKGLEQKLERDFYAGlf...SWD.........
ENSP00000019317  .............GIRLPAVFRECIDYVEK.YG.MKCEGIYRVSGIKSKVDELKAAYDREEST-.....NLE.........
ENSP00000296440  .............S----------------.--.------------------------------.....---.........
ENSP00000340594  .............GLMVPLLIQKCIMEIEK.RG.CQVVGLYRLCGSAAVKKELREAFERDSKAVglc..ENQ.........
ENSP00000382300  .............GQPLPQSIQQALRYLRS.NC.LDQVGLFRKSGVKSRIHALRQMNENFPENV.....NYE.........
ENSP00000351333  .............-------IYQLIEYLHK.N-.LRVEGLFRVPGNSVRQQILRDALNNGTDIDl....ESG.........
ENSP00000363725  .............GQPLPQSIQQAMRYLRS.QC.LDQVGIFRKSGVKSRIQNLRQMNETSPDNV.....CYE.........
ENSP00000392760  .............YGHIPSFLVDACTSLEE.H-.IHTEGLFRKSGSVIRLKALKNKVDHGEG--.....CLS.........
ENSP00000033079  .............DNEVPFIVRHVVDYIEE.HGgLEQQGLFQVNGNAETVEWLRQRYDSGEEVD.....LVK.........
ENSP00000355090  .............YGHIPSFLVDACTSLED.H-.IHTEGLFRKSGSVIRLKALKNKVDHGEG--.....CLS.........
ENSP00000406907  .............GVKVPLVLQKFFEKVEE.SG.LESEGIFRLSGCTAKVKQYREELDAKFNADkf...KWD.........
ENSP00000366522  .............ERQLPWVQTRLSEEVLAlNG.DQTEGIFRVPGDIDEVNALKLQVDQWKVP-.....-TG.........
ENSP00000276211  .............-KQIPQVVEACCQFIEK.HG.LSAVGIFTLEYSVQRVRQLREEFDQGLDVV.....LDD.........
ENSP00000302895  .............-NDVPIIVNSCIAFVTQ.YG.LGCKYIYQKNGDPLHISELLESFKKDARSFkl...RAG.........
ENSP00000445569  .............-----------------.--.------------------------------.....---.........
ENSP00000379855  .............PDIAPPLLIKLVEAIEK.KG.LECSTLYRTQSSSNLAE-LRQLLDCDTPSV.....DLE.........
ENSP00000421148  .............RGDIPIIVDACISFVTQ.HG.LRLEGVYRKGGARARSLRLLAEFRRDARSVkl...RPG.........
ENSP00000362114  .........qldsPMEIPKELWMMVDYLYR.NA.VQQEDLFQQPGLRSEFEHIRDCLDTGMID-.....-NL.........
ENSP00000349635  lqmvpldegaserPLQVPKEIWLLVDHLFK.YA.CHQEDLFQTPGMQEELQQIIDCLDTSIPET.....IPG.........
ENSP00000317128  .............-----------------.--.-------R----------------------.....---.........
ENSP00000258526  .............-----------------.--.------------------------------.....---.........
ENSP00000265036  .............SKELPHWVLSAMKCLAN.W-.---------PNCSDLKQPMYLGFEKDVFK-.....---.........
ENSP00000222254  .............PDVAPPLLVKLVEAIER.TG.LDSESHYRPELPAPRTD---------WSLS.....DVD.........
ENSP00000412292  .............SDDLPHWVLSAMKCLAN.W-.---------PRSNDMNNPTYVGFERDVFR-.....---.........


                                    80        90       100                                          
                                     |         |         |                                          
d1tx4a_            ...........YNALHLPAVILKTFLRELPEPLLTFDLYPHVV......................................
ENSP00000362887  ...........-------------F------------------......................................
ENSP00000274376  ...........---------LLRIFLHEKLESLLLCTLNDREI......................................
ENSP00000356621  ...........--------------------------------......................................
ENSP00000335029  ...........--------------------------------......................................
ENSP00000348498  ...........--------------------------------......................................
ENSP00000293748  ...........------------LFLRFLCPAIMSPSLFGLMQ......................................
ENSP00000348072  ...........------------LFLRFLCPAIMSPSLFGLMQ......................................
ENSP00000448510  ...........--------------------------------......................................
ENSP00000424293  ...........--------------------------------......................................
ENSP00000274364  ...........--------------------------------......................................
ENSP00000341905  ...........--------------------------------......................................
ENSP00000268182  ...........----------L---------------------......................................
ENSP00000262940  ...........-------TNLLKLFL-----------------......................................
ENSP00000417373  ...........-------TNLLKLFL-----------------......................................
ENSP00000354451  ...........--------------------------------......................................
ENSP00000386560  ...........WEDIHVVTGALKMFFRELPEPLFPYSFFEQFV......................................
ENSP00000364394  ...........WEDIHVITGALKMFFRELPEPLFTFNHFNDFV......................................
ENSP00000295497  ...........YEDINIITGALKLYFRDLPIPLITYDAYPKFI......................................
ENSP00000442812  ...........YPDINIITGALKLYFRDLPIPVITYDTYSKFI......................................
ENSP00000264343  ...........NTDVHTVASLLKLYLRELPEPVIPYAKYEDFL......................................
ENSP00000365592  ...........WRDLNVISSLLKSFFRKLPEPLFTNDKYADFI......................................
ENSP00000446550  ...........WEDVHVITGALKLFFRELPEPLFPFSHFRQFI......................................
ENSP00000403323  ...........WEDVHVITGALKLFFRELPEPLFPFSHFRQFI......................................
ENSP00000455109  ...........WQDLNVISSLLKSFFRKLPEPLFTDDKYNDFI......................................
ENSP00000393539  ...........WQDLNVISSLLKSFFRKLPEPLFTDDKYNDFI......................................
ENSP00000422663  ...........TTDVHTVASLLKLYLRELPEPVVPFARYEDFL......................................
ENSP00000350480  ...........NHDINSVAGVLKLYFRGLENPLFPKERFNDLI......................................
ENSP00000399162  ...........DYNIHVIASVFKQWLRDLPNPLMTFELYEEFL......................................
ENSP00000353587  ...........ERDINSVAGVLKLYFRGLENPLFPKERFQDLI......................................
ENSP00000378450  ...........DGDVCSAASLLKLFLRELPDSLITSALQPRFI......................................
ENSP00000310491  ...........YNELHLPAVILKTFLRELPEPLLTFDLYPHVV......................................
ENSP00000385720  ...........DFTVNTVAGAMKSFFSELPDPLVPYNMQIDLV......................................
ENSP00000393307  ...........EVTVNAVAGALKAFFADLPDPLIPYSLHPELL......................................
ENSP00000264245  ...........LQDIHCVGSLCKLYFRELPNPLLTYELYEKFT......................................
ENSP00000310561  ...........VQDIHSVGSLCKLYFRELPNPLLTYQLYEKFS......................................
ENSP00000342566  ...........SADPHAIAGALKSYLRELPEPLMTFELYDEWI......................................
ENSP00000221905  ...........LQDIHSVSSLCKLYFRELPNPLLTYQLYGKFS......................................
ENSP00000356995  ...........LQDIHCVSSLCKAYFRELPDPLLTYRLYDKFA......................................
ENSP00000349660  ...........CESIFVIASVLKDFLRNIPGSIFSSDLYDHWV......................................
ENSP00000377380  qegrldldsteWDDIHVVTGALKLFLRELPQPLVPPLLLPHFR......................................
ENSP00000289968  ...........YSDPHAVAGALKSYLRELPEPLMTFNLYEEWT......................................
ENSP00000251772  ...........--------------------------------......................................
ENSP00000291107  ...........DMDINAIAGTLKLYFRELPEPLLTDRLYPAFM......................................
ENSP00000397075  ...........GNSPHDVSSVLKRFLQELTEPVIPFHLYDAFI......................................
ENSP00000295713  ...........DHDMDSIAGVLKLYFRGLEHPLFPKDIFHDLM......................................
ENSP00000347710  ...........DWDIKTITSSLKFYLRNLSEPVMTYRLHKELV......................................
ENSP00000336923  ...........DWEVKTITSALKQYLRSLPEPLMTYELHGDFI......................................
ENSP00000323194  ...........--------------------------------......................................
ENSP00000337287  ...........YGDIHIPAVILKTFLRELPQPLLTFQAYEQIL......................................
ENSP00000354732  ...........YGDIHIPAVILKTFLRELPQPLLTFQAYEQIL......................................
ENSP00000386241  ...........DTDVHTVASLLKLYLRDLPEPVVPWSQYEGFL......................................
ENSP00000274498  ...........EWEIKTITSALKTYLRMLPGPLMMYQFQRSFI......................................
ENSP00000303507  ...........EMDVNAIAGTLKLYFRELPEPLFTDEFYPNFA......................................
ENSP00000356000  ...........--------------------------------......................................
ENSP00000298815  ...........LWDNKTITSGLKNYLRCLAEPLMTYKLHKDFI......................................
ENSP00000359033  ...........AHDLDSVAGVLKLYFRSLEPPLFPPDLFGELL......................................
ENSP00000380444  ...........NFPIHAITGVLKQWLRELPEPLMTFAQYGDFL......................................
ENSP00000358696  ...........---L----------------------------......................................
ENSP00000338967  ...........EHSVHDVAALLKEFLRDMPDPLLTRELYTAFI......................................
ENSP00000467525  ...........QASPHDISNVLKLYLRQLPEPLISFRLYHELV......................................
ENSP00000350018  ...........CSDPHAVAGALKSYLRELPEPLMTFDLYDDWM......................................
ENSP00000352288  ...........--------------------------------......................................
ENSP00000309871  ...........VDDIHAICSLLKDFLRNLKEPLLTFRLNRAFM......................................
ENSP00000322650  ...........RLPVHLLAVVFKDFLRSIPRKLLSSDLFEEWM......................................
ENSP00000335506  ...........EQHVDDVSSALKRFLRDLPDGLFTRAQRLTWL......................................
ENSP00000377646  ...........--------------------------------......................................
ENSP00000276297  ...........GQSAYDVADMLKQYFRDLPEPLMTNKLSETFL......................................
ENSP00000260526  ...........EFSSHDICDVLKLYLRQLPEPFILFRLYKEFI......................................
ENSP00000341489  ...........YPDINVITGILKDYLRELPTPLITQPLYKVVL......................................
ENSP00000357131  ...........SVKQHDAASLLKLFIRELPQPLLSVEYLKAFQ......................................
ENSP00000414822  ...........EVHHNDASDLLKRFIRKLPTPLLTAEYLPAFA......................................
ENSP00000019317  ...........DYEPNTVASLLKQYLRDLPENLLTKELMPRFE......................................
ENSP00000296440  ...........--------------------------------......................................
ENSP00000340594  ...........YPDINVITGVLKDYLRELPSPLITKQLYEAVL......................................
ENSP00000382300  ...........DQSAYDVADMVKQFFRDLPEPLFTNKLSETFL......................................
ENSP00000351333  ...........EFHSNDVATLLKMFLGELPEPLLTHKHFNAHL......................................
ENSP00000363725  ...........GQSAYDVADLLKQYFRDLPEPIFTSKLTTTFL......................................
ENSP00000392760  ...........SAPPCDIAGLLKQFFRELPEPILPADLHEALL......................................
ENSP00000033079  ...........EADVPSAISLLRFFLQELPEPVIPGSLHIHLM......................................
ENSP00000355090  ...........SAPPCDIAGLLKQFFRELPEPILPADLHEALL......................................
ENSP00000406907  ...........KMCHREAAVMLKAFFRELPTSLFPVEYIPAFI......................................
ENSP00000366522  ...........LEDPHVPASLLKLWYRELEEPLIPHEFYEQCI......................................
ENSP00000276211  ...........NQNVHDVAALLKEFFRDMKDSLLPDDLYMSFL......................................
ENSP00000302895  ...........KHQLEDVTAVLKSFLSDIDDALLTKELYPYWI......................................
ENSP00000445569  ...........--------------------------------......................................
ENSP00000379855  ...........MIDVHVLADAFKRYLLDLPNPVIPAAVYSEMI......................................
ENSP00000421148  ...........EHFVEDVTDTLKRFFRELDDPVTSARLLPRWR......................................
ENSP00000362114  ...........SASNHSVAEALLLFLESLPEPVICYSTYHNCL......................................
ENSP00000349635  ...........--SNHSVAEALLIFLEALPEPVICYELYQRCL......................................
ENSP00000317128  ...........--------------------------------......................................
ENSP00000258526  ...........------------------------------K-......................................
ENSP00000265036  ...........---------TIADYYGHLKEPLLTFHLFDAFV......................................
ENSP00000222254  ...........QWDTAALADGIKSFLLALPAPLVTPEASAEAR......................................
ENSP00000412292  ...........---------TIADYFLDLPEPLLTFEYYELFVnilvvcgyitvsdrssgihkiqddpqsskflhlnnlns


                                                                                                    
                                                                                                    
d1tx4a_            .................................................................................
ENSP00000362887  .................................................................................
ENSP00000274376  .................................................................................
ENSP00000356621  .................................................................................
ENSP00000335029  .................................................................................
ENSP00000348498  .................................................................................
ENSP00000293748  .................................................................................
ENSP00000348072  .................................................................................
ENSP00000448510  .................................................................................
ENSP00000424293  .................................................................................
ENSP00000274364  .................................................................................
ENSP00000341905  .................................................................................
ENSP00000268182  .................................................................................
ENSP00000262940  .................................................................................
ENSP00000417373  .................................................................................
ENSP00000354451  .................................................................................
ENSP00000386560  .................................................................................
ENSP00000364394  .................................................................................
ENSP00000295497  .................................................................................
ENSP00000442812  .................................................................................
ENSP00000264343  .................................................................................
ENSP00000365592  .................................................................................
ENSP00000446550  .................................................................................
ENSP00000403323  .................................................................................
ENSP00000455109  .................................................................................
ENSP00000393539  .................................................................................
ENSP00000422663  .................................................................................
ENSP00000350480  .................................................................................
ENSP00000399162  .................................................................................
ENSP00000353587  .................................................................................
ENSP00000378450  .................................................................................
ENSP00000310491  .................................................................................
ENSP00000385720  .................................................................................
ENSP00000393307  .................................................................................
ENSP00000264245  .................................................................................
ENSP00000310561  .................................................................................
ENSP00000342566  .................................................................................
ENSP00000221905  .................................................................................
ENSP00000356995  .................................................................................
ENSP00000349660  .................................................................................
ENSP00000377380  .................................................................................
ENSP00000289968  .................................................................................
ENSP00000251772  .................................................................................
ENSP00000291107  .................................................................................
ENSP00000397075  .................................................................................
ENSP00000295713  .................................................................................
ENSP00000347710  .................................................................................
ENSP00000336923  .................................................................................
ENSP00000323194  .................................................................................
ENSP00000337287  .................................................................................
ENSP00000354732  .................................................................................
ENSP00000386241  .................................................................................
ENSP00000274498  .................................................................................
ENSP00000303507  .................................................................................
ENSP00000356000  .................................................................................
ENSP00000298815  .................................................................................
ENSP00000359033  .................................................................................
ENSP00000380444  .................................................................................
ENSP00000358696  .................................................................................
ENSP00000338967  .................................................................................
ENSP00000467525  .................................................................................
ENSP00000350018  .................................................................................
ENSP00000352288  .................................................................................
ENSP00000309871  .................................................................................
ENSP00000322650  .................................................................................
ENSP00000335506  .................................................................................
ENSP00000377646  .................................................................................
ENSP00000276297  .................................................................................
ENSP00000260526  .................................................................................
ENSP00000341489  .................................................................................
ENSP00000357131  .................................................................................
ENSP00000414822  .................................................................................
ENSP00000019317  .................................................................................
ENSP00000296440  .................................................................................
ENSP00000340594  .................................................................................
ENSP00000382300  .................................................................................
ENSP00000351333  .................................................................................
ENSP00000363725  .................................................................................
ENSP00000392760  .................................................................................
ENSP00000033079  .................................................................................
ENSP00000355090  .................................................................................
ENSP00000406907  .................................................................................
ENSP00000366522  .................................................................................
ENSP00000276211  .................................................................................
ENSP00000302895  .................................................................................
ENSP00000445569  .................................................................................
ENSP00000379855  .................................................................................
ENSP00000421148  .................................................................................
ENSP00000362114  .................................................................................
ENSP00000349635  .................................................................................
ENSP00000317128  .................................................................................
ENSP00000258526  .................................................................................
ENSP00000265036  .................................................................................
ENSP00000222254  .................................................................................
ENSP00000412292  fksteclllsllhreknkeesdsterlqisnpgfqercakkmqlvnlrnrrvsandimggschnliglsnmhdlssnskpr


                                                                                                    
                                                                                                    
d1tx4a_            .................................................................................
ENSP00000362887  .................................................................................
ENSP00000274376  .................................................................................
ENSP00000356621  .................................................................................
ENSP00000335029  .................................................................................
ENSP00000348498  .................................................................................
ENSP00000293748  .................................................................................
ENSP00000348072  .................................................................................
ENSP00000448510  .................................................................................
ENSP00000424293  .................................................................................
ENSP00000274364  .................................................................................
ENSP00000341905  .................................................................................
ENSP00000268182  .................................................................................
ENSP00000262940  .................................................................................
ENSP00000417373  .................................................................................
ENSP00000354451  .................................................................................
ENSP00000386560  .................................................................................
ENSP00000364394  .................................................................................
ENSP00000295497  .................................................................................
ENSP00000442812  .................................................................................
ENSP00000264343  .................................................................................
ENSP00000365592  .................................................................................
ENSP00000446550  .................................................................................
ENSP00000403323  .................................................................................
ENSP00000455109  .................................................................................
ENSP00000393539  .................................................................................
ENSP00000422663  .................................................................................
ENSP00000350480  .................................................................................
ENSP00000399162  .................................................................................
ENSP00000353587  .................................................................................
ENSP00000378450  .................................................................................
ENSP00000310491  .................................................................................
ENSP00000385720  .................................................................................
ENSP00000393307  .................................................................................
ENSP00000264245  .................................................................................
ENSP00000310561  .................................................................................
ENSP00000342566  .................................................................................
ENSP00000221905  .................................................................................
ENSP00000356995  .................................................................................
ENSP00000349660  .................................................................................
ENSP00000377380  .................................................................................
ENSP00000289968  .................................................................................
ENSP00000251772  .................................................................................
ENSP00000291107  .................................................................................
ENSP00000397075  .................................................................................
ENSP00000295713  .................................................................................
ENSP00000347710  .................................................................................
ENSP00000336923  .................................................................................
ENSP00000323194  .................................................................................
ENSP00000337287  .................................................................................
ENSP00000354732  .................................................................................
ENSP00000386241  .................................................................................
ENSP00000274498  .................................................................................
ENSP00000303507  .................................................................................
ENSP00000356000  .................................................................................
ENSP00000298815  .................................................................................
ENSP00000359033  .................................................................................
ENSP00000380444  .................................................................................
ENSP00000358696  .................................................................................
ENSP00000338967  .................................................................................
ENSP00000467525  .................................................................................
ENSP00000350018  .................................................................................
ENSP00000352288  .................................................................................
ENSP00000309871  .................................................................................
ENSP00000322650  .................................................................................
ENSP00000335506  .................................................................................
ENSP00000377646  .................................................................................
ENSP00000276297  .................................................................................
ENSP00000260526  .................................................................................
ENSP00000341489  .................................................................................
ENSP00000357131  .................................................................................
ENSP00000414822  .................................................................................
ENSP00000019317  .................................................................................
ENSP00000296440  .................................................................................
ENSP00000340594  .................................................................................
ENSP00000382300  .................................................................................
ENSP00000351333  .................................................................................
ENSP00000363725  .................................................................................
ENSP00000392760  .................................................................................
ENSP00000033079  .................................................................................
ENSP00000355090  .................................................................................
ENSP00000406907  .................................................................................
ENSP00000366522  .................................................................................
ENSP00000276211  .................................................................................
ENSP00000302895  .................................................................................
ENSP00000445569  .................................................................................
ENSP00000379855  .................................................................................
ENSP00000421148  .................................................................................
ENSP00000362114  .................................................................................
ENSP00000349635  .................................................................................
ENSP00000317128  .................................................................................
ENSP00000258526  .................................................................................
ENSP00000265036  .................................................................................
ENSP00000222254  .................................................................................
ENSP00000412292  ccslegivdvpgnsskeassvfhqsfpniegqnnklfleskpkqefllnlhseeniqkpfsagfkrtstltvqdqeelcng


                                                                                                    
                                                                                                    
d1tx4a_            .................................................................................
ENSP00000362887  .................................................................................
ENSP00000274376  .................................................................................
ENSP00000356621  .................................................................................
ENSP00000335029  .................................................................................
ENSP00000348498  .................................................................................
ENSP00000293748  .................................................................................
ENSP00000348072  .................................................................................
ENSP00000448510  .................................................................................
ENSP00000424293  .................................................................................
ENSP00000274364  .................................................................................
ENSP00000341905  .................................................................................
ENSP00000268182  .................................................................................
ENSP00000262940  .................................................................................
ENSP00000417373  .................................................................................
ENSP00000354451  .................................................................................
ENSP00000386560  .................................................................................
ENSP00000364394  .................................................................................
ENSP00000295497  .................................................................................
ENSP00000442812  .................................................................................
ENSP00000264343  .................................................................................
ENSP00000365592  .................................................................................
ENSP00000446550  .................................................................................
ENSP00000403323  .................................................................................
ENSP00000455109  .................................................................................
ENSP00000393539  .................................................................................
ENSP00000422663  .................................................................................
ENSP00000350480  .................................................................................
ENSP00000399162  .................................................................................
ENSP00000353587  .................................................................................
ENSP00000378450  .................................................................................
ENSP00000310491  .................................................................................
ENSP00000385720  .................................................................................
ENSP00000393307  .................................................................................
ENSP00000264245  .................................................................................
ENSP00000310561  .................................................................................
ENSP00000342566  .................................................................................
ENSP00000221905  .................................................................................
ENSP00000356995  .................................................................................
ENSP00000349660  .................................................................................
ENSP00000377380  .................................................................................
ENSP00000289968  .................................................................................
ENSP00000251772  .................................................................................
ENSP00000291107  .................................................................................
ENSP00000397075  .................................................................................
ENSP00000295713  .................................................................................
ENSP00000347710  .................................................................................
ENSP00000336923  .................................................................................
ENSP00000323194  .................................................................................
ENSP00000337287  .................................................................................
ENSP00000354732  .................................................................................
ENSP00000386241  .................................................................................
ENSP00000274498  .................................................................................
ENSP00000303507  .................................................................................
ENSP00000356000  .................................................................................
ENSP00000298815  .................................................................................
ENSP00000359033  .................................................................................
ENSP00000380444  .................................................................................
ENSP00000358696  .................................................................................
ENSP00000338967  .................................................................................
ENSP00000467525  .................................................................................
ENSP00000350018  .................................................................................
ENSP00000352288  .................................................................................
ENSP00000309871  .................................................................................
ENSP00000322650  .................................................................................
ENSP00000335506  .................................................................................
ENSP00000377646  .................................................................................
ENSP00000276297  .................................................................................
ENSP00000260526  .................................................................................
ENSP00000341489  .................................................................................
ENSP00000357131  .................................................................................
ENSP00000414822  .................................................................................
ENSP00000019317  .................................................................................
ENSP00000296440  .................................................................................
ENSP00000340594  .................................................................................
ENSP00000382300  .................................................................................
ENSP00000351333  .................................................................................
ENSP00000363725  .................................................................................
ENSP00000392760  .................................................................................
ENSP00000033079  .................................................................................
ENSP00000355090  .................................................................................
ENSP00000406907  .................................................................................
ENSP00000366522  .................................................................................
ENSP00000276211  .................................................................................
ENSP00000302895  .................................................................................
ENSP00000445569  .................................................................................
ENSP00000379855  .................................................................................
ENSP00000421148  .................................................................................
ENSP00000362114  .................................................................................
ENSP00000349635  .................................................................................
ENSP00000317128  .................................................................................
ENSP00000258526  .................................................................................
ENSP00000265036  .................................................................................
ENSP00000222254  .................................................................................
ENSP00000412292  kckskqlcrsqslllrsstrrnsyintpvaeiimkpnvgqgstsvqtameselgessatinkrlckstielsensllpass


                                                    110          120         130       140          
                                                      |            |           |         |          
d1tx4a_            .....GFLNI.........................DE...SQRVPATLQVLQT..LPEENYQVLRFLTAFLVQISA..HSD
ENSP00000362887  .....-----.........................--...-------------..---------------------..---
ENSP00000274376  .....SMEDE.........................AT...-------------..---------------------..---
ENSP00000356621  .....-----.........................--...-------------..---F-----------------..---
ENSP00000335029  .....-----.........................--...-------------..---------------------..---
ENSP00000348498  .....-----.........................--...----------SES..LEENQRNLLQMTEKFFHAIIS..SSS
ENSP00000293748  .....EYPDE.........................QT...SRTLTLIAKVIQN..L--------------------..---
ENSP00000348072  .....EYPDE.........................QT...SRTLTLIAKVIQN..L--------------------..---
ENSP00000448510  .....-----.........................--...-------------..---------------------..---
ENSP00000424293  .....-----.........................--...-------------..---------------------..---
ENSP00000274364  .....-----.........................--...-------------..---------------------..---
ENSP00000341905  .....-----.........................--...-------------..---------------------..---
ENSP00000268182  .....-----.........................--...-------------..---------------------..---
ENSP00000262940  .....-----.........................--...-------------..---------------------..---
ENSP00000417373  .....-----.........................--...-------------..---------------------..---
ENSP00000354451  .....-----.........................--...-------------..L--------------------..---
ENSP00000386560  .....EAIKK.........................QDn..NTRIEAVKSLVQK..LPPPNRDTMKVLFGHLTKIVA..KAS
ENSP00000364394  .....NAIKQ.........................EP...RQRVAAVKDLIRQ..LPKPNQDTMQILFRHLRRVIE..NGE
ENSP00000295497  .....ESAKI.........................MDp..DEQLETLHEALKL..LPPAHCETLRYLMAHLKRVTL..HEK
ENSP00000442812  .....DAAKI.........................SNa..DERLEAVHEVLML..LPPAHYETLRYLMIHLKKVTM..NEK
ENSP00000264343  .....SCAKLlsk......................EE...EAGVKELAKQVKS..LPVVNYNLLKYICRFLDEVQS..YSG
ENSP00000365592  .....EANRK.........................EDp..LDRLKTLKRLIHD..LPEHHYETLKFLSAHLKTVAE..NSE
ENSP00000446550  .....AAIKL.........................QDq..ARRSRCVRDLVRS..LPAPNHDTLRMLFQHLCRVIE..HGE
ENSP00000403323  .....AAIKL.........................QDq..ARRSRCVRDLVRS..LPAPNHDTLRMLFQHLCRVIE..HGE
ENSP00000455109  .....EANRI.........................EDa..RERMRTLRKLIRD..LPGHYYETLKFLVGHLKTIAD..HSE
ENSP00000393539  .....EANRI.........................EDa..RERMRTLRKLIRD..LPGHYYETLKFLVGHLKTIAD..HSE
ENSP00000422663  .....SCAQLltk......................DE...GEGTLELAKQVSN..LPQANYNLLRYICKFLDEVQA..YSN
ENSP00000350480  .....SCIRI.........................DNl..YERALHIRKLLLT..LPRSVLIVMRYLFAFLNHLSQ..YSD
ENSP00000399162  .....RAMGL.........................QEr..KETIRGVYSVIDQ..LSRTHLNTLERLIFHLVRIAL..QED
ENSP00000353587  .....STIKL.........................ENp..AERVHQIQQILVT..LPRVVIVVMRYLFAFLNHLSQ..YSD
ENSP00000378450  .....QLFQD.........................GRn..DVQESSLRDLIKE..LPDTHYCLLKYLCQFLTKVAK..HHV
ENSP00000310491  .....GFLNI.........................DE...SQRVPATLQVLQT..LPEENYQVLRFLTAFLVQISA..HSD
ENSP00000385720  .....EAHKI.........................NDr..EQKLHALKEVLKK..FPKENHEVFKYVISHLNKVSH..NNK
ENSP00000393307  .....EAAKI.........................PDk..TERLHALKEIVKK..FHPVNYDVFRYVITHLNRVSQ..QHK
ENSP00000264245  .....EAVSHc........................PE...EGQLARIQNVIQE..LPPSHYRTLEYLIRHLAHIAS..FSS
ENSP00000310561  .....DAVSA.........................ATd..EERLIKIHDVIQQ..LPPPHYRTLEFLMRHLSLLAD..YCS
ENSP00000342566  .....QASNV.........................QEq..DKKLQALWNACEK..LPKANHNNIRYLIKFLSKLSE..YQD
ENSP00000221905  .....EAMSV.........................PGe..EERLVRVHDVIQQ..LPPPHYRTLEYLLRHLARMAR..HSA
ENSP00000356995  .....EAVGV.........................QLe..PERLVKILEVLRE..LPVPNYRTLEFLMRHLVHMAS..FSA
ENSP00000349660  .....SVMDQ.........................GNd..EEKINTVQRLLDQ..LPRANVVLLRYLFGVLHNIEQ..HSS
ENSP00000377380  .....AALAL.........................SEs..EQCLSQIQELIGS..MPKPNHDTLRYLLEHLCRVIA..HSD
ENSP00000289968  .....QVASV.........................QDq..DKKLQDLWRTCQK..LPPQNFVNFRYLIKFLAKLAQ..TSD
ENSP00000251772  .....-----.........................--...-------------..---------------------..---
ENSP00000291107  .....EGIAL.........................SDp..AAKENCMMHLLRS..LPDPNLITFLFLLEHLKRVAE..KEP
ENSP00000397075  .....SLAKTlhadpgddpgtps............PS...PEVIRSLKTLLVQ..LPDSNYNTLRHLVAHLFRVAA..RFM
ENSP00000295713  .....ACVTM.........................DNl..QERALHIRKVLLV..LPKTTLIIMRYLFAFLNHLSQ..FSE
ENSP00000347710  .....SAAKS.........................DNl..DYRLGAIHSLVYK..LPEKNREMLELLIRHLVNVCE..HSK
ENSP00000336923  .....VPAKS.........................GSp..ESRVNAIHFLVHK..LPEKNKEMLDILVKHLTNVSN..HSK
ENSP00000323194  .....-----.........................--...-------------..---------------------..---
ENSP00000337287  .....GITCV.........................ES...SLRVTGCRQILRS..LPEHNYVVLRYLMGFLHAVSR..ESI
ENSP00000354732  .....GITCV.........................ES...SLRVTGCRQILRS..LPEHNYVVLRYLMGFLHAVSR..ESI
ENSP00000386241  .....LCGQLtna......................DE...AKAQQELMKQLSI..LPRDNYSLLSYICRFLHEIQL..NCA
ENSP00000274498  .....KAAKL.........................ENq..ESRVSEIHSLVHR..LPEKNRQMLQLLMNHLANVAN..NHK
ENSP00000303507  .....EGIAL.........................SDp..VAKESCMLNLLLS..LPEANLLTFLFLLDHLKRVAE..KEA
ENSP00000356000  .....-----.........................--...-------------..---------------------..---
ENSP00000298815  .....IAVKS.........................DDq..NYRVEAVHALVHK..LPEKNREMLDILIKHLVKVSL..HSQ
ENSP00000359033  .....ASSEL.........................EAt..AERVEHVSRLLWR..LPAPVLVVLRYLFTFLNHLAQ..YSD
ENSP00000380444  .....RAVEL.........................PEk..QEQLAAIYAVLEH..LPEANHNSLERLIFHLVKVAL..LED
ENSP00000358696  .....-----.........................--...-------------..---------------------..---
ENSP00000338967  .....NTLLL.........................EP...EEQLGTLQLLIYL..LPPCNCDTLHRLLQFLSIVAR..HAD
ENSP00000467525  .....GLAKDslkaeaeakaasrgrqdgse.....SEavaVALAGRLRELLRD..LPPENRASLQYLLRHLRRIVE..VEQ
ENSP00000350018  .....RAASL.........................KEp..GARLQALQEVCSR..LPPENLSNLRYLMKFLARLAE..EQE
ENSP00000352288  .....-----.........................--...-------------..---------------------..---
ENSP00000309871  .....EAAEI.........................TDe..DNSIAAMYQAVGE..LPQANRDTLAFLMIHLQRVAQ..-SP
ENSP00000322650  .....GALEM.........................QDe..EDRIEALKQVADK..LPRPNLLLLKHLVYVLHLISK..NSE
ENSP00000335506  .....EASEI.........................EDe..EEKVSRYRELLVR..LPPVNRATVKALISHLYCVQC..FSD
ENSP00000377646  .....-----.........................--...-------------..---------------------..---
ENSP00000276297  .....QIYQYv........................PK...DQRLQAIKAAIML..LPDENREVLQTLLYFLSDVTA..AVK
ENSP00000260526  .....DLAKEiqhvneeqetkknsledkkwpnmciEI...NRILLKSKDLLRQ..LPASNFNSLHFLIVHLKRVVD..HAE
ENSP00000341489  .....EAMARdp.......................PNrv.PPTTEGTRGLLSC..LPDVERATLTLLLDHLRLVSS..FHA
ENSP00000357131  .....AVQNL.........................PTk..KQQLQALNLLVIL..LPDANRDTLKALLEFLQRVID..NKE
ENSP00000414822  .....VVPNI.........................PNl..KQRLQVLHLLILI..LPEPNRNALKALLEFLRKVVA..REQ
ENSP00000019317  .....EACGR.........................TTe..TEKVQEFQRLLKE..LPECNYLLISWLIVHMDHVIA..KEL
ENSP00000296440  .....-----.........................--...-------------..---------------------..---
ENSP00000340594  .....DAMAKsplkmssngce..............ND...PGDSKYTVDLLDC..LPEIEKATLKMLLDHLKLVAS..YHE
ENSP00000382300  .....HIYQYv........................SK...EQRLQAVQAAILL..LADENREVLQTLLCFLNDVVN..LVE
ENSP00000351333  .....KIADLmqfddkgnktni.............PDk..DRQIEALQLLFLI..LPPPNRNLLKLLLDLLYQTAK..KQD
ENSP00000363725  .....QIYQLl........................PK...DQWLAAAQAATLL..LPDENREVLQTLLYFLSDIAS..-AE
ENSP00000392760  .....KAQQL.........................GT...EEKNKAILLLSCL..LADHTVHVLRYFFNFLRNVSL..RSS
ENSP00000033079  .....QLSQDy........................NNe..DEFGRKLRFLLQQ..LPPVNYSLLKFLCRFLANVAS..-HH
ENSP00000355090  .....KAQQL.........................GT...EEKNKATLLLSCL..LADHTVHVLRYFFNFLRNVSL..RSS
ENSP00000406907  .....SLMER.........................GPhv.KVQFQALHLMVMA..LPDANRDAAQALMTFFNKVIA..NES
ENSP00000366522  .....AHYDS.........................PE...-----AAVAVVHA..LPRINRMVLCYLIRFLQVFVQpaNVA
ENSP00000276211  .....LTATL.........................KP...QDQLSALQLLVYL..MPPCHSDTLERLLKALHKITE..NCE
ENSP00000302895  .....SALDT.........................QDd..KERIKKYGAFIRS..LPGVNRATLAAIIEHLYRVQK..CSE
ENSP00000445569  .....-----.........................--...------T------..---------------------..---
ENSP00000379855  .....SLAPEvq.......................SS...EEYIQLLKKLIRSpsIPHQYWLTLQYLLKHFFKLSQ..TSS
ENSP00000421148  .....EAAEL.........................PQk..NQRLEKYKDVIGC..LPRVNRRTLATLIGHLYRVQK..CAA
ENSP00000362114  .....ECSGN.........................YT...-----ASKQVIST..LPIFHKNVFHYLMAFLRELLK..NSA
ENSP00000349635  .....DSAYD.........................PR...-----ICRQVISQ..LPRCHRNVFRYLMAFLRELLK..FSE
ENSP00000317128  .....-----.........................--...-------------..---------------------..---
ENSP00000258526  .....-----.........................--...-------------..---------------------..---
ENSP00000265036  .....SVLGLlq.......................KE...KVAVEAFQICCLL..LPPENRRKLQLLMRMMARICL..NKE
ENSP00000222254  .....RALREaagpv....................G-...------PALEPPT..LPLHRALTLRFLLQHLGRVAS..RAP
ENSP00000412292  mltgtQSLLQ.........................PHle.RVAIDALQLCCLL..LPPPNRRKLQLLMRMISRMSQ..NVD


                             150        160                                    170            180   
                               |          |                                      |              |   
d1tx4a_            Q...........NKMTNTNLAV.VFGPNLLW....................AK.........DAAI.....TLKAINPINT
ENSP00000362887  -...........----------.--------....................--.........----.....----------
ENSP00000274376  -...........----------.--------....................--.........----.....----------
ENSP00000356621  -...........----------.--------....................--.........----.....----------
ENSP00000335029  -...........----------.I-------....................--.........----.....----------
ENSP00000348498  E...........FPPQLRSVCH.CL------....................--.........----.....----------
ENSP00000293748  -...........----------.--------....................--.........----.....----------
ENSP00000348072  -...........----------.--------....................--.........----.....----------
ENSP00000448510  -...........----------.--------....................--.........----.....----------
ENSP00000424293  -...........----------.--------....................--.........----.....----------
ENSP00000274364  -...........----------.--------....................--.........----.....----------
ENSP00000341905  -...........----------.--------....................-A.........----.....----------
ENSP00000268182  -...........----------.--------....................--.........----.....----------
ENSP00000262940  -...........----------.--------....................--.........----.....----------
ENSP00000417373  -...........----------.--------....................--.........----.....----------
ENSP00000354451  -...........----------.--------....................--.........----.....----------
ENSP00000386560  K...........NLMSTQSLGI.VFGPTLLR....................AEn........ETGN.....MAIHMVYQNQ
ENSP00000364394  K...........NRMTYQSIAI.VFGPTLLK....................PEk........ETGN.....IAVHTVYQNQ
ENSP00000295497  E...........NLMNAENLGI.VFGPTLMR....................SPel.......DAMA.....ALNDIRYQRL
ENSP00000442812  D...........NFMNAENLGI.VFGPTLMR....................PPed.......STLT.....TLHDMRYQKL
ENSP00000264343  V...........NKMSVQNLAT.VFGPNILR....................PKve.......DPLT.....IMEGTVVVQQ
ENSP00000365592  K...........NKMEPRNLAI.VFGPTLVR....................TS.........EDNMth...MVTHMPDQYK
ENSP00000446550  Q...........NRMSVQSVAI.VFGPTLLR....................PEv........EETS.....MPMTMVFQNQ
ENSP00000403323  Q...........NRMSVQSVAI.VFGPTLLR....................PEv........EETS.....MPMTMVFQNQ
ENSP00000455109  K...........NKMEPRNLAL.VFGPTLVR....................TSed.......N--Mtd...MVTHMPDRYK
ENSP00000393539  K...........NKMEPRNLAL.VFGPTLVR....................TSed.......N--Mtd...MVTHMPDRYK
ENSP00000422663  V...........NKMSVQNLAT.VFGPNILR....................PQve.......DPVT.....IMEGTSLVQH
ENSP00000350480  E...........NMMDPYNLAI.CFGPTLMP....................VP.........EIQD.....QVSCQAHVNE
ENSP00000399162  T...........NRMSANALAI.VFAPCILR....................CPdtt......DPLQ.....SVQDISKTTT
ENSP00000353587  E...........NMMDPYNLAI.CFGPTLMH....................IP.........DGQD.....PVSCQAHINE
ENSP00000378450  Q...........NRMNVHNLAT.VFGPNCFH....................VP.........PGLE.....GMKEQDLCNK
ENSP00000310491  Q...........NKMTNTNLAV.VFGPNLLW....................AK.........DAAI.....TLKAINPINT
ENSP00000385720  V...........NLMTSENLSI.CFWPTLMR....................PDf........STMD.....ALTATRTYQT
ENSP00000393307  I...........NLMTADNLSI.CFWPTLMR....................PDf........ENRE.....FLSTTKIHQS
ENSP00000264245  K...........TNMHARNLAL.VWAPNLLR....................SKeieatgc..NGDA.....AFLAVRVQQV
ENSP00000310561  I...........TNMHAKNLAI.VWAPNLLR....................SKqiesacf..SGTA.....AFMEVRIQSV
ENSP00000342566  V...........NKMTPSNMAI.VLGPNLLW....................PQaegn.....ITEM.....MTTVSLQIVG
ENSP00000221905  N...........TSMHARNLAI.VWAPNLLR....................SMelesvgm..GGAA.....AFREVRVQSV
ENSP00000356995  Q...........TNMHARNLAI.VWAPNLLR....................SKdieasgf..NGTA.....AFMEVRVQSI
ENSP00000349660  S...........NQMTAFNLAV.CVAPSILW....................PPass......SPEL.....ENEFTKKVSL
ENSP00000377380  K...........NRMTPHNLGI.VFGPTLFR....................PEq........ETSD.....PAAHALYPGQ
ENSP00000289968  V...........NKMTPSNIAI.VLGPNLLW....................AR.........NEGTlaem.AAATSVHVVA
ENSP00000251772  -...........----------.--------....................--.........----.....----------
ENSP00000291107  I...........NKMSLHNLAT.VFGPTLLR....................PS.........E---.....----------
ENSP00000397075  E...........NKMSANNLGI.VFGPTLLR....................PPdgpraasa.IPVT.....CLLDSGHQAQ
ENSP00000295713  E...........NMMDPYNLAI.CFGPSLMS....................VP.........EGHD.....QVSCQAHVNE
ENSP00000347710  E...........NLMTPSNMGV.IFGPTLMR....................AQe........DTVA.....AMMNIKFQNI
ENSP00000336923  Q...........NLMTVANLGV.VFGPTLMR....................PQe........ETVA.....ALMDLKFQNI
ENSP00000323194  -...........----------.--------....................--.........----.....----------
ENSP00000337287  F...........NKMNSSNLAC.VFGLNLIW....................PS.........QGVS.....SLSALVPLNM
ENSP00000354732  F...........NKMNSSNLAC.VFGLNLIW....................PS.........QGVS.....SLSALVPLNM
ENSP00000386241  V...........NKMSVDNLAT.VIGVNLIR....................SKve.......DPAV.....IMRGTPQIQR
ENSP00000274498  Q...........NLMTVANLGV.VFGPTLLR....................PQe........ETVA.....AIMDIKFQNI
ENSP00000303507  V...........NKMSLHNLAT.VFGPTLLR....................PS.........E---.....----------
ENSP00000356000  -...........----------.--------....................--.........----.....----------
ENSP00000298815  Q...........NLMTVSNLGV.IFGPTLMR....................AQe........ETVA.....AMMNIKFQNI
ENSP00000359033  E...........NMMDPYNLAV.CFGPTLLP....................VP.........AGQD.....PVALQGRVNQ
ENSP00000380444  V...........NRMSPGALAI.IFAPCLLR....................CPdns......DPLT.....SMKDVLKITT
ENSP00000358696  -...........----------.--------....................--.........----.....----------
ENSP00000338967  DniskdgqevtgNKMTSLNLAT.IFGPNLLH....................KQkssdkefsvQSSA.....RAEESTAIIA
ENSP00000467525  D...........NKMTPGNLGI.VFGPTLLR....................PR.........PTEAtvslsSLVDYPHQAR
ENSP00000350018  V...........NKMTPSNIAI.VLGPNLLW....................PPekeg.....D--QaqldaASVSSIQVVG
ENSP00000352288  -...........----------.--------....................--.........----.....----------
ENSP00000309871  H...........TKMDVANLAK.VFGPTIVA....................HAvpnp.....DPVT.....MLQDIKRQPK
ENSP00000322650  V...........NRMDSSNLAI.CIGPNMLT....................LE.........NDQSlsfeaQKDLNNKVKT
ENSP00000335506  T...........NQMNVHNLAI.VFGPTLFQ....................TD.........GQD-.....-----YKAGR
ENSP00000377646  -...........----------.--------....................--.........----.....----------
ENSP00000276297  E...........NQMTPTNLAV.CLAPSLFHlntlkrenssprvmqrkqslGK.........PDQK.....DLNENLAATQ
ENSP00000260526  E...........NKMNSKNLGV.IFGPSLIR....................PR.........PTTApitisSLAEYSNQAR
ENSP00000341489  Y...........NRMTPQNLAV.CFGPVLLParqaptrprars........SG.........PGLA.....SAVDFKHHIE
ENSP00000357131  K...........NKMTVMNVAM.VMAPNLFM....................CHalglks...SEQR.....EFVMAAGTAN
ENSP00000414822  H...........NKMTLRNVST.VMAPNLFL....................HQgrppkl...PKGK.....EKQLAEGAAE
ENSP00000019317  E...........TKMNIQNISI.VLSPTV--....................--.........----.....-----QISNR
ENSP00000296440  -...........----------.--------....................--.........----.....----------
ENSP00000340594  V...........NKMTCQNLAV.CFGPVLLSqrqepsthnnrvft......DS.........EELA.....SALDFKKHIE
ENSP00000382300  E...........NQMTPMNLAV.CLAPSLFH....................L-.........----.....----------
ENSP00000351333  K...........NKMSAYNLAL.MFAPHVLW....................PKnv.......TAND.....LQENITKLNS
ENSP00000363725  E...........NQMTAGNLAV.CLAPSIFHlnvskkdspsprikskrsliGR.........PGPR.....DLSDNMAATQ
ENSP00000392760  E...........NKMDSSNLAV.IFAPNLLQ....................TS.........EGH-.....----------
ENSP00000033079  E...........EIWSANSLAA.VFGPDVFH....................IY.........TDVE.....DMKEQEIVSR
ENSP00000355090  E...........NKMDSSNLAV.IFAPNLLQ....................TS.........EGHEkmssnTEKKLRLQAA
ENSP00000406907  K...........NRMSLWNIST.VMAPNLFF....................SRskh......SDYE.....ELLLANTAAH
ENSP00000366522  V...........TKMDVSNLAM.VMAPNCLR....................CQsd.......DPRV.....IFENTRKEMS
ENSP00000276211  DsigidgqlvpgNRMTSTNLAL.VFGSALLK....................KGkfgkresr.KTKL.....GIDHYVASVN
ENSP00000302895  I...........NHMNAHNLAL.VFSSCLFQ....................TK.........GQT-.....-----SEEVN
ENSP00000445569  -...........----------.--------....................--.........----.....----------
ENSP00000379855  K...........NLLNARVLSE.IFSPMLFR....................FS.........AASS.....D--NTENLIK
ENSP00000421148  L...........NQMCTRNLAL.LFAPSVFQ....................TD.........GRG-.....-----EHEVR
ENSP00000362114  K...........NHLDENILAS.IFGSLLLR....................NPag.......HQKL.....DMTEKKKAQE
ENSP00000349635  Y...........NSVNANMIAT.LFTSLLLR....................PP.........PNLM.....ARQTPSDRQR
ENSP00000317128  -...........----------.--------....................--.........----.....----------
ENSP00000258526  -...........----------.--------....................--.........----.....----------
ENSP00000265036  Mpplc.......DGFGTRTLMVqTFSRCILC....................SK.........DEVD.....L--DELLAAR
ENSP00000222254  A...........LGPAVRALGA.TFGPLLLR....................AP.........PP--.....----------
ENSP00000412292  Mpklh.......DAMGTRSLMIhTFSRCVLC....................CA.........EEVD.....L--DELLAGR


                       190                                                                          
                         |                                                                          
d1tx4a_            FTKFLLDHQGELF....................................................................
ENSP00000362887  -------------lrflcpaimspslfnllqeypddrtartltliakvtqnlanfakfgskeeymsfmnqflehewtnmqr
ENSP00000274376  -------------tlfrattlastlmeqymkatatqfvhhalkdsilkimeskqscelspskleknedvntnlthllnils
ENSP00000356621  -------------akfgnkeeymafmndflehewggmkrflleisnpdtisntpgfdgyidlgrelsvlhsllwevvsqld
ENSP00000335029  -------------lspnlfqltphhtdpqtsrtltlisktvqtlgslsksksasfkesymatfyeffneqkyadavknfld
ENSP00000348498  -------------yqatchsllnkatvkekkenkksvvsqrfpqnsigavgsamflrfinpaivspyeagildkkppprie
ENSP00000293748  -------------anfskftskedflgfmneflelewgsmqqflyeisnldtltnsssfegyidlgrelstlhallwevlp
ENSP00000348072  -------------anfskftskedflgfmneflelewgsmqqflyeisnldtltnsssfegyidlgrelstlhallwevlp
ENSP00000448510  -------------rveerfpqaehqqdvkylaisgflflrffapailtpklfdlrdqhadpqtsrsllllakavqsignlg
ENSP00000424293  -------------scptvmcdifyslrqmatqrfpndphvqysavssfvflrffavavvsphtfhlrphhpdaqtirtltl
ENSP00000274364  -------------llpyglryiakvlknsihekfpdatedellkivgnllyyrymnpaivapdgfdiidmtaggqinsdqr
ENSP00000341905  -------------pdhpapgpartltliakviqnlanrapfgekeaymgfmnsfleehgpamqcfldqvamvdvdaapsgy
ENSP00000268182  -------------kdslhekfpdagedellkiignllyyrymnpaivapdafdiidlsaggqlttdqrrnlgsiakmlqha
ENSP00000262940  -------------gqglakdfldllfqlelsrtsetntlfrsnslasksmesflkvagmqylhgvlgpiinkvfeekkyve
ENSP00000417373  -------------gqglakdfldllfqlelsrtsetntlfrsnslasksvesflkvagmqylhgvlgpiinkvfeekkyve
ENSP00000354451  -------------dialrnllamtdkfllaitssvdqipygmryvakvlkatlaekfpdatdsevykvvgnllyyrflnpa
ENSP00000386560  IAELMLSEYSKIF....................................................................
ENSP00000364394  IVELILLELSSIF....................................................................
ENSP00000295497  VVELLIKNEDILF....................................................................
ENSP00000442812  IVQILIENEDVLF....................................................................
ENSP00000264343  LMSVMISKHDCLF....................................................................
ENSP00000365592  IVETLIQHHDWFF....................................................................
ENSP00000446550  VVELILQQCADIF....................................................................
ENSP00000403323  VVELILQQCADIF....................................................................
ENSP00000455109  IVETLIQHSDWFF....................................................................
ENSP00000393539  IVETLIQHSDWFF....................................................................
ENSP00000422663  LMTVLIRKHSQLF....................................................................
ENSP00000350480  IIKTIIIHHETIF....................................................................
ENSP00000399162  CVELIV-------v...................................................................
ENSP00000353587  VIKTIIIHHEAIF....................................................................
ENSP00000378450  IMAKILENYNTLF....................................................................
ENSP00000310491  FTKFLLDHQGELF....................................................................
ENSP00000385720  IIELFIQQCPFFF....................................................................
ENSP00000393307  VVETFIQQCQFFF....................................................................
ENSP00000264245  VIEFILNHVDQIF....................................................................
ENSP00000310561  VVEFILNHVDVLF....................................................................
ENSP00000342566  IIEPIIQHADWFF....................................................................
ENSP00000221905  VVEFLLTHVDVLF....................................................................
ENSP00000356995  VVEFILTHVDQLF....................................................................
ENSP00000349660  LIQFLIENCLRIF....................................................................
ENSP00000377380  LVQLMLTNFTSLF....................................................................
ENSP00000289968  VIEPIIQHADWFF....................................................................
ENSP00000251772  -------------etifstahrgsalplaikymfdfldeqadkhqihdadvrhtwksnclplrfwvnviknpqfvfdihkn
ENSP00000291107  -------------vesk................................................................
ENSP00000397075  LVEFLIVHYEQIF....................................................................
ENSP00000295713  LIKTIIIQHENIF....................................................................
ENSP00000347710  VVEILIEHFGKI-y...................................................................
ENSP00000336923  VVEILIENHEKIFrtpp................................................................
ENSP00000323194  -------------tifstahrgsalplaikymfdfldeqadkhgihdphvrhtwksnclplrfwvnmiknpqfvfdihkns
ENSP00000337287  FTELLIEYYEKIF....................................................................
ENSP00000354732  FTELLIEYYEKIF....................................................................
ENSP00000386241  VMTMMIRDHEVLF....................................................................
ENSP00000274498  VIEILIENHEKIFntv.................................................................
ENSP00000303507  -------------ke..................................................................
ENSP00000356000  -------------lplaikymfdfldeqadrhsihdtdvrhtwksnclplrfwvnviknpqfvfdihkgsitdaclsvvaq
ENSP00000298815  VVEILIEHYEKIFht..................................................................
ENSP00000359033  LVQTLIVQPDRVF....................................................................
ENSP00000380444  CVEMLIK------e...................................................................
ENSP00000358696  -------------latkgtlqkfvddlfetvfstahrgsalplaikymfdfldeqadqrqisdpdvrhtwksnclplrfwv
ENSP00000338967  VVQKMIENYEALF....................................................................
ENSP00000467525  VIETLIVHYGLVFeee.................................................................
ENSP00000350018  VVEALIQSADTLF....................................................................
ENSP00000352288  -------------eqaekhniqdedtihiwktnslplrfwvnilknphfifdvhvhevvdaslsviaqtfmdactrtehkl
ENSP00000309871  VVERLLSLP----leyws...............................................................
ENSP00000322650  LVEFLIDNCFEIFge..................................................................
ENSP00000335506  VVEDLINHYVVVFsvde................................................................
ENSP00000377646  -------------aklvalvnkfigylkqntycfphslrwivsqmyktlscvdrlevgevramctdlllacficpavvnpe
ENSP00000276297  GLAHMIAECKKLF....................................................................
ENSP00000260526  LVEFLITYSQKIFd...................................................................
ENSP00000341489  VLHYLLQSW----p...................................................................
ENSP00000357131  TMHLLIKYQKLLW....................................................................
ENSP00000414822  VVQIMVHYQDLLW....................................................................
ENSP00000019317  VLYVFFTHVQELFgn..................................................................
ENSP00000296440  -------------rpvplavkyffdlldeqaqqhgisdqdtihiwktnslplrfwiniiknpqfvfdvqtsdnmdavllvi
ENSP00000340594  VLHYLLQ------lw..................................................................
ENSP00000382300  -------------nll.................................................................
ENSP00000351333  GMAFMIKHSQKLF....................................................................
ENSP00000363725  GLSHMISDCKKLFqvp.................................................................
ENSP00000392760  -------------ekmss...............................................................
ENSP00000033079  IMAGLLENYYEFF....................................................................
ENSP00000355090  VVQTLIDYA----sd..................................................................
ENSP00000406907  IIRLMLKYQKILW....................................................................
ENSP00000366522  FLRVLIQHLDTSF....................................................................
ENSP00000276211  VVRAMIDNWDVLF....................................................................
ENSP00000302895  VIEDLINNYVEIFevk.................................................................
ENSP00000445569  -------------fqailsvnrpipiavkylfdlldelaekhgiedpgtlhiwktnslllrfwvnalknpqlifdvrvsdn
ENSP00000379855  VIEILI-------s...................................................................
ENSP00000421148  VLQELIDGYI---svf.................................................................
ENSP00000362114  FIHQFLCN-----....................................................................
ENSP00000349635  AIQFLL-------....................................................................
ENSP00000317128  -------------enieakprnlnvsfqgcgmdslsvramdtdtltqvkekileafcknvpysqwpraedvdlewfasstq
ENSP00000258526  -------------llstkvaihsvleklfrsiwslpnsrapfaikyffdfldaqaenkkitdpdvvhiwktnslplrfwvn
ENSP00000265036  LVTFLMDNYQEI-....................................................................
ENSP00000222254  -------------p...................................................................
ENSP00000412292  LVSFLMDHHQEI-....................................................................


                                                                                                    
                                                                                                    
d1tx4a_            .................................................................................
ENSP00000362887  flleisnpetlsntagfegyidlgrelsslhsllweavsqleqsivsklgplprilrdvhtalstpg..............
ENSP00000274376  elvekifmaseilpptlryiygclqksvqhkwptnttmrtrvvsgfvflrlicpailnprmfniisdspspiaartlilva
ENSP00000356621  katvaklgplprvladitksltnptpiqqq...................................................
ENSP00000335029  lisssgrrdpksveqpivlkegfmikraqgrkrfgmknfkkrwfrltnheftyhkskgdq.....................
ENSP00000348498  rglklmskilqsianhvlftkeehmrpfndfvksnfdaarrffldiasdcptsdavnhslsfisdgnvlalhrllwnnqek
ENSP00000293748  qlskeallklgplprllndistalrnpni....................................................
ENSP00000348072  qlskeallklgplprllndistalrnpni....................................................
ENSP00000448510  qqlgqgkelwmaplhpfllqcvsrvrdfldrlvdvdgdeeagvparalfppsaivregyllkrkeepaglatrfafkkryv
ENSP00000424293  isktiqtlgswgslskskssfketfmceffkmfqeegyiiavkkfldeisstetkessgtsepvhlkegemykraqgrtri
ENSP00000274364  rnlgsvakvlqhaasnklfegenehlssmnnylsetyqefrkyfkeacnvpepeekfnmdkytdlvtvskpviyisieeii
ENSP00000341905  qgsgdlalqlavlhaqlctifaeldqttrdtleplptilraie......................................
ENSP00000268182  asnkmflgdnahlsiineylsqsyqkfrrffqtacdvpelqdkfnvdeysdlvtltkpviyisigeiinthtllldhqdai
ENSP00000262940  ldpskvevkdvgcsglhrpqteaevleqsaqtlrahlgallsalsrsvracpavvratfrqlfrrvrerfpgaqhenvpfi
ENSP00000417373  ldpskvevkdvgcsglhrpqteaevleqsaqtlrahlgallsalsrsvracpavvratfrqlfrrvrerfpgaqhenvpfi
ENSP00000354451  vvapdafdivamaaggalaapqrhalgavaqllqhaaagkafsgqsqhlrvlndyleethlkfrkfihracqvpepeerfa
ENSP00000386560  .................................................................................
ENSP00000364394  .................................................................................
ENSP00000295497  .................................................................................
ENSP00000442812  .................................................................................
ENSP00000264343  .................................................................................
ENSP00000365592  .................................................................................
ENSP00000446550  .................................................................................
ENSP00000403323  .................................................................................
ENSP00000455109  .................................................................................
ENSP00000393539  .................................................................................
ENSP00000422663  .................................................................................
ENSP00000350480  .................................................................................
ENSP00000399162  .................................................................................
ENSP00000353587  .................................................................................
ENSP00000378450  .................................................................................
ENSP00000310491  .................................................................................
ENSP00000385720  .................................................................................
ENSP00000393307  .................................................................................
ENSP00000264245  .................................................................................
ENSP00000310561  .................................................................................
ENSP00000342566  .................................................................................
ENSP00000221905  .................................................................................
ENSP00000356995  .................................................................................
ENSP00000349660  .................................................................................
ENSP00000377380  .................................................................................
ENSP00000289968  .................................................................................
ENSP00000251772  sitdaclsvvaqtfmdscstsehklgkdspsnkllyakdipnykswveryyadiakmpaisdqdmsaylaeqsrlhlsqfn
ENSP00000291107  .................................................................................
ENSP00000397075  .................................................................................
ENSP00000295713  .................................................................................
ENSP00000347710  .................................................................................
ENSP00000336923  .................................................................................
ENSP00000323194  itdaclsvvaqtfmdscstsehrlgkdspsnkllyakdipsyknwveryysdigkmpaisdqdmnaylaeqsrmhmnefnt
ENSP00000337287  .................................................................................
ENSP00000354732  .................................................................................
ENSP00000386241  .................................................................................
ENSP00000274498  .................................................................................
ENSP00000303507  .................................................................................
ENSP00000356000  tfmdscstsehrlgkdspsnkllyakdipsykswveryyadiaklpaisdqdmnaylaeqsrlhavefnmlsalneiysyv
ENSP00000298815  .................................................................................
ENSP00000359033  .................................................................................
ENSP00000380444  .................................................................................
ENSP00000358696  nviknpqfvfdihknsitdaclsvvaqtfmdscstsehrlgkdspsnkllyakdipnykswveryyrdiakmasisdqdmd
ENSP00000338967  .................................................................................
ENSP00000467525  .................................................................................
ENSP00000350018  .................................................................................
ENSP00000352288  srdspsnkllyakeistykkmvedyykgirqmvqvsdqdmnthlaeisrahtdslntlvalhqlyqytqkyydei......
ENSP00000309871  .................................................................................
ENSP00000322650  .................................................................................
ENSP00000335506  .................................................................................
ENSP00000377646  qygiisdapinevarfnlmqvgrllqqlamtgseegdprtksslgkfdkscvaafldvviggravetpplssvnlleglsr
ENSP00000276297  .................................................................................
ENSP00000260526  .................................................................................
ENSP00000341489  .................................................................................
ENSP00000357131  .................................................................................
ENSP00000414822  .................................................................................
ENSP00000019317  .................................................................................
ENSP00000296440  aqtfmdactladhklgrdspinkllyardiprykrmveryyadirqtvpasdqemnsvlaelswnysgdlgarvalhelyk
ENSP00000340594  .................................................................................
ENSP00000382300  .................................................................................
ENSP00000351333  .................................................................................
ENSP00000363725  .................................................................................
ENSP00000392760  .................................................................................
ENSP00000033079  .................................................................................
ENSP00000355090  .................................................................................
ENSP00000406907  .................................................................................
ENSP00000366522  .................................................................................
ENSP00000276211  .................................................................................
ENSP00000302895  .................................................................................
ENSP00000445569  vdailaviaqtfidscttsehkvgrdspvnkllyareiprykqmveryyadirqsspasyqem..................
ENSP00000379855  .................................................................................
ENSP00000421148  .................................................................................
ENSP00000362114  .................................................................................
ENSP00000349635  .................................................................................
ENSP00000317128  syilrdlddtsvvedgrkklntlahykipegaslamslidkkdntlgrvkdldtekyfhlvlptdelaepkkshrqshrkk
ENSP00000258526  ilknpqfvfdikktphidgclsviaqafmdafslteqqlgkeaptnkllyakdiptykeevksyykairdlpplssseme.
ENSP00000265036  .................................................................................
ENSP00000222254  .................................................................................
ENSP00000412292  .................................................................................


                                                                                                    
                                                                                                    
d1tx4a_            .................................................................................
ENSP00000362887  .................................................................................
ENSP00000274376  ksvqnlanlvefgakepymegvnpfiksnkhrmimfldelgnvpelpdttehsrtdlsrdlaalheicvahsdelrtlsne
ENSP00000356621  .................................................................................
ENSP00000335029  .................................................................................
ENSP00000348498  igqylssnrdhkavgrrpfdkmatllaylgpp.................................................
ENSP00000293748  .................................................................................
ENSP00000348072  .................................................................................
ENSP00000448510  wlsgetlsfskspewqm................................................................
ENSP00000424293  gkknfkkrwfcltsreltyhkqpg.........................................................
ENSP00000274364  sthslllehqdaiapekndllsellgslgev..................................................
ENSP00000341905  .................................................................................
ENSP00000268182  apehndpihellddlgevp..............................................................
ENSP00000262940  avtsflclrffspaimspklfhlrerhadartsrtllllakavqnvgnmdtpasrakeawmeplqptvrqgvaqlkdfitk
ENSP00000417373  avtsflclrffspaimspklfhlrerhadartsrtllllakavqnvgnmdtpasrakeawmeplqptvhqgvaqlkdfitk
ENSP00000354451  vdeysdmvavakpmvyitvgelvnthrlllehqdciapdhqdplhelledlgel...........................
ENSP00000386560  .................................................................................
ENSP00000364394  .................................................................................
ENSP00000295497  .................................................................................
ENSP00000442812  .................................................................................
ENSP00000264343  .................................................................................
ENSP00000365592  .................................................................................
ENSP00000446550  .................................................................................
ENSP00000403323  .................................................................................
ENSP00000455109  .................................................................................
ENSP00000393539  .................................................................................
ENSP00000422663  .................................................................................
ENSP00000350480  .................................................................................
ENSP00000399162  .................................................................................
ENSP00000353587  .................................................................................
ENSP00000378450  .................................................................................
ENSP00000310491  .................................................................................
ENSP00000385720  .................................................................................
ENSP00000393307  .................................................................................
ENSP00000264245  .................................................................................
ENSP00000310561  .................................................................................
ENSP00000342566  .................................................................................
ENSP00000221905  .................................................................................
ENSP00000356995  .................................................................................
ENSP00000349660  .................................................................................
ENSP00000377380  .................................................................................
ENSP00000289968  .................................................................................
ENSP00000251772  smsalheiysyitkykdei..............................................................
ENSP00000291107  .................................................................................
ENSP00000397075  .................................................................................
ENSP00000295713  .................................................................................
ENSP00000347710  .................................................................................
ENSP00000336923  .................................................................................
ENSP00000323194  msalseifsyvgkyseei...............................................................
ENSP00000337287  .................................................................................
ENSP00000354732  .................................................................................
ENSP00000386241  .................................................................................
ENSP00000274498  .................................................................................
ENSP00000303507  .................................................................................
ENSP00000356000  skysee...........................................................................
ENSP00000298815  .................................................................................
ENSP00000359033  .................................................................................
ENSP00000380444  .................................................................................
ENSP00000358696  aylveqsrlhasdfsvlsalnelyfyvtkyrqei...............................................
ENSP00000338967  .................................................................................
ENSP00000467525  .................................................................................
ENSP00000350018  .................................................................................
ENSP00000352288  .................................................................................
ENSP00000309871  .................................................................................
ENSP00000322650  .................................................................................
ENSP00000335506  .................................................................................
ENSP00000377646  tvvyitysqlitlvnfmksvmsgdqlredrmaldnllanlppakpgkssslemtpyntpqlsp..................
ENSP00000276297  .................................................................................
ENSP00000260526  .................................................................................
ENSP00000341489  .................................................................................
ENSP00000357131  .................................................................................
ENSP00000414822  .................................................................................
ENSP00000019317  .................................................................................
ENSP00000296440  yinkyydqi........................................................................
ENSP00000340594  .................................................................................
ENSP00000382300  .................................................................................
ENSP00000351333  .................................................................................
ENSP00000363725  .................................................................................
ENSP00000392760  .................................................................................
ENSP00000033079  .................................................................................
ENSP00000355090  .................................................................................
ENSP00000406907  .................................................................................
ENSP00000366522  .................................................................................
ENSP00000276211  .................................................................................
ENSP00000302895  .................................................................................
ENSP00000445569  .................................................................................
ENSP00000379855  .................................................................................
ENSP00000421148  .................................................................................
ENSP00000362114  .................................................................................
ENSP00000349635  .................................................................................
ENSP00000317128  vlpeiyltrllstkgtlqkflddlfkailsiredkpplavkyffdfleeqaekrgisdpdtlhiwktnslplrfwvnilkn
ENSP00000258526  .................................................................................
ENSP00000265036  .................................................................................
ENSP00000222254  .................................................................................
ENSP00000412292  .................................................................................


                                                                                                  
                                                                                                  
d1tx4a_            ...............................................................................
ENSP00000362887  ...............................................................................
ENSP00000274376  rgaqqhvlkkllaitellqqkqnqy......................................................
ENSP00000356621  ...............................................................................
ENSP00000335029  ...............................................................................
ENSP00000348498  ...............................................................................
ENSP00000293748  ...............................................................................
ENSP00000348072  ...............................................................................
ENSP00000448510  ...............................................................................
ENSP00000424293  ...............................................................................
ENSP00000274364  ...............................................................................
ENSP00000341905  ...............................................................................
ENSP00000268182  ...............................................................................
ENSP00000262940  lvdieekdeldlqrtlslqappvkegplfihrtkgkgplmsssfkklyfslttealsfaktps................
ENSP00000417373  lvdieekdeldlqrtlslqappvkegplfihrtkgkgplmsssfkklyfslttealsfaktps................
ENSP00000354451  ...............................................................................
ENSP00000386560  ...............................................................................
ENSP00000364394  ...............................................................................
ENSP00000295497  ...............................................................................
ENSP00000442812  ...............................................................................
ENSP00000264343  ...............................................................................
ENSP00000365592  ...............................................................................
ENSP00000446550  ...............................................................................
ENSP00000403323  ...............................................................................
ENSP00000455109  ...............................................................................
ENSP00000393539  ...............................................................................
ENSP00000422663  ...............................................................................
ENSP00000350480  ...............................................................................
ENSP00000399162  ...............................................................................
ENSP00000353587  ...............................................................................
ENSP00000378450  ...............................................................................
ENSP00000310491  ...............................................................................
ENSP00000385720  ...............................................................................
ENSP00000393307  ...............................................................................
ENSP00000264245  ...............................................................................
ENSP00000310561  ...............................................................................
ENSP00000342566  ...............................................................................
ENSP00000221905  ...............................................................................
ENSP00000356995  ...............................................................................
ENSP00000349660  ...............................................................................
ENSP00000377380  ...............................................................................
ENSP00000289968  ...............................................................................
ENSP00000251772  ...............................................................................
ENSP00000291107  ...............................................................................
ENSP00000397075  ...............................................................................
ENSP00000295713  ...............................................................................
ENSP00000347710  ...............................................................................
ENSP00000336923  ...............................................................................
ENSP00000323194  ...............................................................................
ENSP00000337287  ...............................................................................
ENSP00000354732  ...............................................................................
ENSP00000386241  ...............................................................................
ENSP00000274498  ...............................................................................
ENSP00000303507  ...............................................................................
ENSP00000356000  ...............................................................................
ENSP00000298815  ...............................................................................
ENSP00000359033  ...............................................................................
ENSP00000380444  ...............................................................................
ENSP00000358696  ...............................................................................
ENSP00000338967  ...............................................................................
ENSP00000467525  ...............................................................................
ENSP00000350018  ...............................................................................
ENSP00000352288  ...............................................................................
ENSP00000309871  ...............................................................................
ENSP00000322650  ...............................................................................
ENSP00000335506  ...............................................................................
ENSP00000377646  ...............................................................................
ENSP00000276297  ...............................................................................
ENSP00000260526  ...............................................................................
ENSP00000341489  ...............................................................................
ENSP00000357131  ...............................................................................
ENSP00000414822  ...............................................................................
ENSP00000019317  ...............................................................................
ENSP00000296440  ...............................................................................
ENSP00000340594  ...............................................................................
ENSP00000382300  ...............................................................................
ENSP00000351333  ...............................................................................
ENSP00000363725  ...............................................................................
ENSP00000392760  ...............................................................................
ENSP00000033079  ...............................................................................
ENSP00000355090  ...............................................................................
ENSP00000406907  ...............................................................................
ENSP00000366522  ...............................................................................
ENSP00000276211  ...............................................................................
ENSP00000302895  ...............................................................................
ENSP00000445569  ...............................................................................
ENSP00000379855  ...............................................................................
ENSP00000421148  ...............................................................................
ENSP00000362114  ...............................................................................
ENSP00000349635  ...............................................................................
ENSP00000317128  pqfvfdidktdhidaclsviaqafidacsisdlqlgkdsptnkllyakeipeyrkivqryykqiqdmtplseqemnahl
ENSP00000258526  ...............................................................................
ENSP00000265036  ...............................................................................
ENSP00000222254  ...............................................................................
ENSP00000412292  ...............................................................................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0044148 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Drosophila melanogaster 58 (pseudogenes) - Fruit fly
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus tauri
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Cyanidioschyzon merolae strain 10D 22
NoYes   Cyanidioschyzon merolae
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Giardia lamblia 2.3
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Ichthyophthirius multifiliis strain G5
NoYes   Cryptosporidium hominis
NoYes   Cryptosporidium muris
NoYes   Cryptosporidium parvum Iowa II
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Babesia bovis T2Bo
NoYes   Theileria parva
NoYes   Theileria annulata
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Plasmodium yoelii ssp. yoelii 1
NoYes   Plasmodium chabaudi
NoYes   Plasmodium berghei ANKA
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Parachlamydia acanthamoebae UV-7
NoYes   Pseudovibrio sp. FO-BEG1
NoYes   Legionella longbeachae NSW150
NoYes   Legionella pneumophila str. Corby
NoYes   Providencia stuartii MRSN 2154
NoYes   Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Cryptococcus neoformans var. grubii H99
NoYes   Cryptococcus neoformans B-3501A
NoYes   Cryptococcus neoformans JEC21
NoYes   Paracoccidioides brasiliensis Pb01
NoYes   Paracoccidioides brasiliensis Pb03
NoYes   Coccidioides posadasii str. Silveira
NoYes   Coccidioides immitis RMSCC 3703
NoYes   Coccidioides immitis RMSCC 2394
NoYes   Coccidioides immitis H538.4
NoYes   Ajellomyces dermatitidis ER-3
NoYes   Histoplasma capsulatum H143
NoYes   Histoplasma capsulatum H88
NoYes   Histoplasma capsulatum G186AR
NoYes   Aspergillus fumigatus A1163
NoYes   Candida albicans WO-1
NoYes   Saccharomyces cerevisiae UC5
NoYes   Saccharomyces cerevisiae PW5
NoYes   Saccharomyces cerevisiae FL100
NoYes   Saccharomyces cerevisiae CLIB324
NoYes   Saccharomyces cerevisiae CBS7960
NoYes   Saccharomyces cerevisiae YJM269
NoYes   Saccharomyces cerevisiae T7
NoYes   Saccharomyces cerevisiae FostersB
NoYes   Saccharomyces cerevisiae FostersO
NoYes   Saccharomyces cerevisiae VL3
NoYes   Saccharomyces cerevisiae Vin13
NoYes   Saccharomyces cerevisiae LalvinQA23
NoYes   Saccharomyces cerevisiae AWRI796
NoYes   Saccharomyces cerevisiae Sigma1278b
NoYes   Saccharomyces cerevisiae W303
NoYes   Saccharomyces cerevisiae JAY291
NoYes   Saccharomyces cerevisiae AWRI1631
NoYes   Saccharomyces cerevisiae YPS163
NoYes   Saccharomyces cerevisiae M22
NoYes   Saccharomyces cerevisiae T73
NoYes   Saccharomyces cerevisiae CLIB215
NoYes   Saccharomyces cerevisiae Y10
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae SGD - Baker's yeast
NoYes   Schizosaccharomyces pombe 972h-
NoYes   Batrachochytrium dendrobatidis JEL423
NoYes   Batrachochytrium dendrobatidis JAM81
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Trypanosoma brucei Lister 427 v4.1
NoYes   Neospora caninum Nc-Liverpool 6.2
NoYes   Plasmodium falciparum HB3
NoYes   Legionella pneumophila str. Paris
NoYes   Legionella pneumophila str. Lens
NoYes   Legionella pneumophila subsp. pneumophila LPE509
NoYes   Legionella pneumophila subsp. pneumophila str. Thunder Bay
NoYes   Legionella pneumophila subsp. pneumophila str. Philadelphia 1
NoYes   Legionella pneumophila subsp. pneumophila
NoYes   Legionella pneumophila subsp. pneumophila
NoYes   Legionella pneumophila subsp. pneumophila ATCC 43290
NoYes   Legionella pneumophila 2300/99 Alcoy
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Caenorhabditis elegans 69_215 - Roundworm
NoYes   Saccharomyces cerevisiae 69_4 - Baker's yeast
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Heliconius numata
NoYes   Loa loa v3.3 - Eye worm
NoYes   Wuchereria bancrofti v1.0 - Agent of lymphatic filariasis
NoYes   Brugia malayi v1.0 - Agent of lymphatic filariasis
NoYes   Moniliophthora perniciosa FA553
NoYes   Encephalitozoon intestinalis
NoYes   Encephalitozoon cuniculi
NoYes   Lotus japonicus
NoYes   Malus x domestica - Apple
NoYes   Ricinus communis - Castor bean
NoYes   Nicotiana benthamiana 0.4.4
NoYes   Solanum pimpinellifolium A-1.0 - Currant tomato
NoYes   Solanum lycopersicum v2.3 - Tomato
NoYes   Phoenix dactylifera - Date palm
NoYes   Atta cephalotes fungus garden (ACEF) (meta-genome)
NoYes   Dendroctonus ponderosae beetle community (MPB hybrid beetle) (Lodgepole pine) (meta-genome)
NoYes   Dump bottom (Dump bottom) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #2 (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methane enrichment (meta-genome)
NoYes   Miscanthus rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample of Miscanthus x giga (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   Soil microbial communities from Minnesota Farm (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 4 Nevada Test Site Crust CO2- (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]