SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Ras GEF alignments in Mus musculus 76_38

These alignments are sequences aligned to the 0041591 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                 10        20                         30            
                                                  |         |                          |            
d1nvus_               ..................q-MRLPSADVYRFAEPDSEENIIF........EENMQ.........PKAG....IPIIKA
ENSMUSP00000067786  ..................m--RLPSAEVYRFAEPDSEENILF........EENVQ.........PKAG....IPIIKA
ENSMUSP00000138589  ..................l--RLPSPDMYRFVVTDSEENIVF........EDNLQ.........SRSG....IPIIKG
ENSMUSP00000044866  ..................l--RLPSPDMYRFVVTDSEENIVF........EDNLQ.........SRSG....IPIIKG
ENSMUSP00000138793  ..................l--RLPSPDMYRFVVTDSEENIVF........EDNLQ.........SRSG....IPIIKG
ENSMUSP00000109526  .................ln-----------------------........---LY.........ETCK....VRTVKA
ENSMUSP00000028170  .................ln-----------------------........---LY.........ETCK....VRTVKA
ENSMUSP00000097812  .................ln-----------------------........---LY.........ETCK....VRTVKA
ENSMUSP00000129652  ...................-MPQTPPFSAMFDSSGYNRNLYQsae.....DSCGG.........LYYH....DNNLLS
ENSMUSP00000031276  ...................-MPQTPPFSAMFDSSGYNRNLYQsae.....DSCGG.........LYYH....DNNLLS
ENSMUSP00000027760  .............qlppgh-----------------------........TVSQY.........ETCK....IRTIKA
ENSMUSP00000107490  .............qlppgh-----------------------........TVSQY.........ETCK....IRTIKA
ENSMUSP00000107488  .................ht-----------------------........-VSQY.........ETCK....IRTIKA
ENSMUSP00000116892  ..............icfsk-----------------------........---TL.........NSCK....VPQIRY
ENSMUSP00000034912  ............ddvdirf-----------------------........-SKTM.........NSCK....VLQIRY
ENSMUSP00000096930  ..............icfsk-----------------------........---TL.........NSCK....VPQIRY
ENSMUSP00000028525  ..................l--RDVEANTVRLKEHDQDVLVLE........KVPAGnraanqgnsQPQQ....KYTVMS
ENSMUSP00000099759  ..................l--RDVEANTVRLKEHDQDVLVLE........KVPAGnraanqgnsQPQQ....KYTVMS
ENSMUSP00000088336  ..................l--RDVEANTVRLKEHDQDVLVLE........KVPAGnraanqgnsQPQQ....KYTVMS
ENSMUSP00000114119  ..................l--NQVEKNMQKVEEEGEIVMVKEhr......ELDRT.........GTRK....GHIVIK
ENSMUSP00000113778  ..................l--NQVEKNMQKVEEEGEIVMVKEhr......ELDRT.........GTRK....GHIVIK
ENSMUSP00000090829  .................dg-----------------------........-----.........----....--APSS
ENSMUSP00000065619  .................dg-----------------------........-----.........----....--APSS
ENSMUSP00000128947  ...................-MPQTPPFSAMFDSSGYNRNLYQsae.....DSCGG.........LYYH....DNNLLS
ENSMUSP00000092114  ..................l--NHVEKNTHKVEEEGEIVMVHEhr......ELDRS.........GTRK....GHIVIK
ENSMUSP00000104522  ..................l--NHVEKNTHKVEEEGEIVMVHEhr......ELDRS.........GTRK....GHIVIK
ENSMUSP00000099804  ..................l--NHVEKNTHKVEEEGEIVMVHEhr......ELDRS.........GTRK....GHIVIK
ENSMUSP00000098766  ..................l--NHVEKNTHKVEEEGEIVMVHEhr......ELDRS.........GTRK....GHIVIK
ENSMUSP00000105313  .................ae-----------------------........-----.........-NDA....RYVVVS
ENSMUSP00000132244  ..................q-----------------------........-----.........----....DGRLTS
ENSMUSP00000135238  ..................d----VEAKTMRLEEHGKVVLVLErtsqgagpSRPPT.........PGRN....RYTVMS
ENSMUSP00000116426  ..................d----VEAKTMRLEEHGKVVLVLErtsqgagpSRPPT.........PGRN....RYTVMS
ENSMUSP00000092828  ................ngl-----------------------........-----.........----....---GKA
ENSMUSP00000129393  ................ngl-----------------------........-----.........----....---GKA
ENSMUSP00000099593  .........itqfrmmvsl-----------------------........-----.........----....GHLAKG
ENSMUSP00000136423  .........itqfrmmvsl-----------------------........-----.........----....GHLAKG
ENSMUSP00000117631  ...............elsl--------------IDHNEIMAR........LTLKQ.........EGDD....GPDVRG
ENSMUSP00000099936  ................lsl--------------IDHNEIMAR........LTLKQ.........EGDD....GPDVRG
ENSMUSP00000088680  ................lsl--------------IDHNEIMAR........LTLKQ.........EGDD....GPDVRG
ENSMUSP00000092703  ................lsl--------------IDHNEIMAR........LTLKQ.........EGDD....GPDVRG
ENSMUSP00000035726  ...............flhy-----------------------........-----.........RTSK....VRALRA
ENSMUSP00000134167  .........itqfrmmvsl-----------------------........-----.........----....GHLAKG
ENSMUSP00000090828  .................dg-----------------------........-----.........----....--APSS
ENSMUSP00000134592  .........itqfrmmvsl-----------------------........-----.........----....GHLAKG
ENSMUSP00000118148  ..................d----VEAKTMRLEEHGKVVLVLErtsqgagpSRPPT.........PGRN....RYTVMS
ENSMUSP00000133449  .........itqfrmmvsl-----------------------........-----.........----....GHLAKG
ENSMUSP00000134027  .........itqfrmmvsl-----------------------........-----.........----....GHLAKG
ENSMUSP00000041135  ..................k-----------------------........-----.........----....-----G
ENSMUSP00000109104  ..................k-----------------------........-----.........----....-----G
ENSMUSP00000129873  ..................k-----------------------........-----.........----....-----G
ENSMUSP00000120126  ..................d----VEAKTMRLEEHGKVVLVLErtsqgagpSRPPT.........PGRN....RYTVMS
ENSMUSP00000124183  ...............scse-----------------------........-----.........----....------
ENSMUSP00000032811  ...............scse-----------------------........-----.........----....------
ENSMUSP00000125137  ...............scse-----------------------........-----.........----....------
ENSMUSP00000103103  ...........laggttrd-----------------------........-----.........----....------
ENSMUSP00000092200  ...............scse-----------------------........-----.........----....------
ENSMUSP00000123718  ...............scse-----------------------........-----.........----....------
ENSMUSP00000041082  ................ppr-----------------------........-----.........---S....SRRLRA
ENSMUSP00000124908  ...............scse-----------------------........-----.........----....------
ENSMUSP00000140055  .............atvsek-----------------------........-----.........----....------
ENSMUSP00000140342  .............atvsek-----------------------........-----.........----....------
ENSMUSP00000140230  .............atvsek-----------------------........-----.........----....------
ENSMUSP00000027886  .............atvsek-----------------------........-----.........----....------
ENSMUSP00000139618  .............atvsek-----------------------........-----.........----....------
ENSMUSP00000063872  .............atvsek-----------------------........-----.........----....------
ENSMUSP00000130581  .............atvsek-----------------------........-----.........----....------
ENSMUSP00000139645  .............atvsek-----------------------........-----.........----....------
ENSMUSP00000108790  .................ts-----------------------........-----.........----....------
ENSMUSP00000088563  .................ts-----------------------........-----.........----....------
ENSMUSP00000132533  ...................-----------------------........-----.........----....------
ENSMUSP00000048451  .................ts-----------------------........-----.........----....------
ENSMUSP00000108789  .................ts-----------------------........-----.........----....------
ENSMUSP00000135317  ...................-----------------------........-----.........----....------
ENSMUSP00000115747  .............ldesss-------------------LIFY........NVNKH.........PGSGrqkkARILQA
ENSMUSP00000050586  .............ldesss-------------------LIFY........NVNKH.........PGSGrqkkARILQA
ENSMUSP00000121635  ..................k-----------------------........-----.........----....-----G
ENSMUSP00000039186  ................kkt------------NHKDQGENVSA........PEDPR.........EHCT....QSHVSA
ENSMUSP00000130604  erqlgtsmansnpvpsssa-----------------------........-----.........----....------
ENSMUSP00000138360  erqlgtsmansnpvpsssa-----------------------........-----.........----....------
ENSMUSP00000138330  erqlgtsmansnpvpsssa-----------------------........-----.........----....------
ENSMUSP00000136756  ................kqd-------------------QNHT........DQDLR.........EPRR....ESPISA
ENSMUSP00000029766  ..........frpndfesk-----------------------........-----.........----....------
ENSMUSP00000139822  ..............atvse-----------------------........-----.........----....------
ENSMUSP00000104523  ..................l--NHVEKNTHKVEEEGEIVMVHEhr......ELDRS.........GTRK....GHIVIK
ENSMUSP00000071368  .................hf----WHASHRNPKEPDFPYNLPKf.......TYNSF.........EF--....------
ENSMUSP00000120630  ..................k-----------------------........-----.........----....-----G
ENSMUSP00000108868  ..............sqlip-----------------------........-----.........----....------
ENSMUSP00000073866  .................rp-----------------------........-----.........----....------
ENSMUSP00000031624  kepdfpynlpkftynsfef-----------------------........-----.........----....------
ENSMUSP00000115092  .................ln-----------------------........---LY.........ETCK....VRTVKA
ENSMUSP00000116215  ..................r-----------------------........-----.........----....--TVKA
ENSMUSP00000073399  .................vv-----------------------........-----.........----....------
ENSMUSP00000106227  .................vv-----------------------........-----.........----....------
ENSMUSP00000106225  .................vv-----------------------........-----.........----....------
ENSMUSP00000106229  .................vv-----------------------........-----.........----....------
ENSMUSP00000136434  .................vv-----------------------........-----.........----....------
ENSMUSP00000106226  .................vv-----------------------........-----.........----....------
ENSMUSP00000076380  .................vv-----------------------........-----.........----....------
ENSMUSP00000106241  .................vv-----------------------........-----.........----....------
ENSMUSP00000106228  .................vv-----------------------........-----.........----....------
ENSMUSP00000134203  .................ih-----------------------........-----.........----....------
ENSMUSP00000036997  .................vv-----------------------........-----.........----....------
ENSMUSP00000136735  .................vv-----------------------........-----.........----....------
ENSMUSP00000123036  ..................k-----------------------........-----.........----....-----G
ENSMUSP00000109099  ..................k-----------------------........-----.........----....-----G
ENSMUSP00000109100  ..................k-----------------------........-----.........----....-----G
ENSMUSP00000109103  ..................k-----------------------........-----.........----....-----G
ENSMUSP00000031501  ..................v-----------------------........-----.........----....------
ENSMUSP00000032648  ..................i-----------------------........-----.........----....------
ENSMUSP00000109096  ..................k-----------------------........-----.........----....-----G
ENSMUSP00000115401  ...............icfs-----------------------........--KTL.........NSCK....VPQIRY
ENSMUSP00000120949  ..................k-----------------------........-----.........----....-----G
ENSMUSP00000134312  ...................-----------------------........-----.........----....------
ENSMUSP00000117681  ...................-----------------------........-----.........----....----KG


                      40            50                 60        70         80                      
                       |             |                  |         |          |                      
d1nvus_               GTVIKLIERLT....YH..MYAD.......PNFVRTFLTTYRSFC.KPQELLSLIIERFEIP................
ENSMUSP00000067786  GTVLKLIERLT....YH..MYAD.......PNFVRTFLTTYRSFC.RPQELLSLLIERFEIP................
ENSMUSP00000138589  GTVVKLIERLT....YH..MYAD.......PNFVRTFLTTYRSFC.KPQELLNLLIERFEIP................
ENSMUSP00000044866  GTVVKLIERLT....YH..MYAD.......PNFVRTFLTTYRSFC.KPQELLNLLIERFEIP................
ENSMUSP00000138793  GTVVKLIERLT....YH..MYAD.......PNFVRTFLTTYRSFC.KPQELLNLLIERFEIP................
ENSMUSP00000109526  GTLEKLVEHLV....PAf.QGSD.......LSYVTVFLCTYRAFT.TTQQVLDLLFKRYGCI................
ENSMUSP00000028170  GTLEKLVEHLV....PAf.QGSD.......LSYVTVFLCTYRAFT.TTQQVLDLLFKRYGRC................
ENSMUSP00000097812  GTLEKLVEHLV....PAf.QGSD.......LSYVTVFLCTYRAFT.TTQQVLDLLFKRYGRC................
ENSMUSP00000129652  GSLEALIQHLV....PNvdYYPD.......RTYIFTFLLSSRLFM.HPYELMAKVCHLCVEH................
ENSMUSP00000031276  GSLEALIQHLV....PNvdYYPD.......RTYIFTFLLSSRLFM.HPYELMAKVCHLCVEH................
ENSMUSP00000027760  GTLEKLVENLL....TAf.GDND.......FTYISIFLSTYRGFA.STKEVLELLLDRYGNL................
ENSMUSP00000107490  GTLEKLVENLL....TAf.GDND.......FTYISIFLSTYRGFA.STKEVLELLLDRYGNL................
ENSMUSP00000107488  GTLEKLVENLL....TAf.GDND.......FTYISIFLSTYRGFA.STKEVLELLLDRYGNL................
ENSMUSP00000116892  ASVERLLERLT....DL..RFLS.......IDFLNTFLHTYRIFT.TATVVLAKLSDIYKRPftsipvrslelffats
ENSMUSP00000034912  ASVERLLERLT....DL..RFLS.......IDFLNTFLHSYRVFT.NAMVVLDKLINIYRKPmsaiparslellfsss
ENSMUSP00000096930  ASVERLLERLT....DL..RFLS.......IDFLNTFLHTYRIFT.TATVVLAKLSDIYKRPftsipvrslelffats
ENSMUSP00000028525  GTPEKILEHFL....ET..IRLEpslneatDSVLNDFVMMHCVFM.PNTQLCPALVAHYHAQ................
ENSMUSP00000099759  GTPEKILEHFL....ET..IRLEpslneatDSVLNDFVMMHCVFM.PNTQLCPALVAHYHAQ................
ENSMUSP00000088336  GTPEKILEHFL....ET..IRLEpslneatDSVLNDFVMMHCVFM.PNTQLCPALVAHYHAQ................
ENSMUSP00000114119  GTSERLTMHLV....EEh.SVVD.......PTFIEDFLLTYRTFLsSPMEVGKKLLEWFNDP................
ENSMUSP00000113778  GTSERLTMHLV....EEh.SVVD.......PTFIEDFLLTYRTFLsSPMEVGKKLLEWFNDP................
ENSMUSP00000090829  ASLDTLIQHLV....PTadYYPE.......KAYIFTFLLSSRLFI.EPRELLARVCHLCIEQ................
ENSMUSP00000065619  ASLDTLIQHLV....PTadYYPE.......KAYIFTFLLSSRLFI.EPRELLARVCHLCIEQ................
ENSMUSP00000128947  GSLEALIQHLV....PNv.D---.......---------------.----------------................
ENSMUSP00000092114  ATPERLIMHLI....EEh.SIVD.......PTYIEDFLLTYRTFLeTPLDVGIKLLEWFKID................
ENSMUSP00000104522  ATPERLIMHLI....EEh.SIVD.......PTYIEDFLLTYRTFLeTPLDVGIKLLEWFKID................
ENSMUSP00000099804  ATPERLIMHLI....EEh.SIVD.......PTYIEDFLLTYRTFLeTPLDVGIKLLEWFKID................
ENSMUSP00000098766  ATPERLIMHLI....EEh.SIVD.......PTYIEDFLLTYRTFLeTPLDVGIKLLEWFKID................
ENSMUSP00000105313  GTPEKILEHLL....NDl.HLAEvqhket.ETLLDDFLLTYTVFM.TTDDLCQALLRHYSAK................
ENSMUSP00000132244  GSLEALMEHLV....PTvdYYPD.......RTYIFTFLLSSRVFM.PPHDLLARVGQICLEQ................
ENSMUSP00000135238  GTPEKILELLL....EA..MRPDssahdptETFLSDFLLTHSVFM.PSTQLFTALLHHFHVE................
ENSMUSP00000116426  GTPEKILELLL....EA..MRPDssahdptETFLSDFLLTHSVFM.PSTQLFTALLHHFHVE................
ENSMUSP00000092828  ATLDELLSTCIemfdDNg.DLND.......SYLPRIVLLMHRWYL.SSTELAGKLLCMYRNA................
ENSMUSP00000129393  ATLDELLSTCIemfdDNg.DLND.......SYLPRIVLLMHRWYL.SSTELAGKLLCMYRNA................
ENSMUSP00000099593  ASLDDLIDSCI....QS..FDADgnlcrn.NQLLQVMLTMHRIII.SSAELLQKVMNLYKDA................
ENSMUSP00000136423  ASLDDLIDSCI....QS..FDADgnlcrn.NQLLQVMLTMHRIII.SSAELLQKVMNLYKDA................
ENSMUSP00000117631  GSGDILLVHAT....ET..DRKDl......VLYCEAFLTTYRTFI.SPEELIKKLQYRYEKF................
ENSMUSP00000099936  GSGDILLVHAT....ET..DRKDl......VLYCEAFLTTYRTFI.SPEELIKKLQYRYEKF................
ENSMUSP00000088680  GSGDILLVHAT....ET..DRKDl......VLYCEAFLTTYRTFI.SPEELIKKLQYRYEKF................
ENSMUSP00000092703  GSGDILLVHAT....ET..DRKDl......VLYCEAFLTTYRTFI.SPEELIKKLQYRYEKF................
ENSMUSP00000035726  ARLERLVHELV....SGd.REQD.......PGFVPAFLATHRAFV.PTARVLGFLLPPPPPP................
ENSMUSP00000134167  ASLDDLIDSCI....QS..FDADgnlcrn.NQLLQVMLTMHRIII.SSAELLQKVMNLYKDA................
ENSMUSP00000090828  ASLDTLIQHLV....PTa.D---.......---------------.----------------................
ENSMUSP00000134592  ASLDDLIDSCI....QS..FDADgnlcrn.NQLLQVMLTMHRIII.SSAELLQKVMNLYKDA................
ENSMUSP00000118148  GTPEKILELLL....EA..MRPDssahdptETFLSDFLLTHSVFM.PSTQLFTALLHHFHVE................
ENSMUSP00000133449  ASLDDLIDSCI....QS..FDADgnlcrn.NQLLQVMLTMHRIII.SSAELLQKVMNLYKDA................
ENSMUSP00000134027  ASLDDLIDSCI....QS..FDADgnlcrn.NQLLQVMLTMHRIII.SSAELLQKVMNLYKDA................
ENSMUSP00000041135  CTVEELLRGCIeafdDSg.KVRD.......PQLVRMFLMMHPWYI.PSSQLASKLLHFYQQS................
ENSMUSP00000109104  CTVEELLRGCIeafdDSg.KVRD.......PQLVRMFLMMHPWYI.PSSQLASKLLHFYQQS................
ENSMUSP00000129873  CTVEELLRGCIeafdDSg.KVRD.......PQLVRMFLMMHPWYI.PSSQLASKLLHFYQQS................
ENSMUSP00000120126  GTPEKILELLL....EA..MRPDssahdptETFLSDFLLTHSVFM.PSTQLFTALLHHFHVE................
ENSMUSP00000124183  ---DELLEECIrcfdSAgsLRRG.......DHILKMVLTMHSWVL.PSSELAARLLTSYQKA................
ENSMUSP00000032811  ---DELLEECIrcfdSAgsLRRG.......DHILKMVLTMHSWVL.PSSELAARLLTSYQKA................
ENSMUSP00000125137  ---DELLEECIrcfdSAgsLRRG.......DHILKMVLTMHSWVL.PSSELAARLLTSYQKA................
ENSMUSP00000103103  -----------....--..SSAS.......DILLDDIVLTHSLFL.PTEKFLQELHQYFVQS................
ENSMUSP00000092200  ---DELLEECIrcfdSAgsLRRG.......DHILKMVLTMHSWVL.PSSELAARLLTSYY--................
ENSMUSP00000123718  ---DELLEECIrcfdSAgsLRRG.......DHILKMVLTMHSWVL.PSSELAARLLTSYQKA................
ENSMUSP00000041082  GTLEALVRHLL....DArtAGAD.......MMFTPALLATHRAFT.STPALFGLVADRLEAL................
ENSMUSP00000124908  ---DELLEECIrcfdSAgsLRRG.......DHILKMVLTMHSWVL.PSSELAARLLTSYQKA................
ENSMUSP00000140055  -----------....--..----.......---------------.----------------................
ENSMUSP00000140342  -----------....--..----.......---------------.----------------................
ENSMUSP00000140230  -----------....--..----.......---------------.----------------................
ENSMUSP00000027886  -----------....--..----.......---------------.----------------................
ENSMUSP00000139618  -----------....--..----.......---------------.----------------................
ENSMUSP00000063872  -----------....--..----.......---------------.----------------................
ENSMUSP00000130581  -----------....--..----.......---------------.----------------................
ENSMUSP00000139645  -----------....--..----.......---------------.----------------................
ENSMUSP00000108790  -----------....--..----.......---------------.----------------................
ENSMUSP00000088563  -----------....--..----.......---------------.----------------................
ENSMUSP00000132533  -----------....--..----.......---------------.----------------................
ENSMUSP00000048451  -----------....--..----.......---------------.----------------................
ENSMUSP00000108789  -----------....--..----.......---------------.----------------................
ENSMUSP00000135317  -----------....--..----.......---------------.----------------................
ENSMUSP00000115747  GTPLGLMAYLY....SS..DAFL.......EGYVQQFLYTFRYFC.TPHDFLHFLLDRISST................
ENSMUSP00000050586  GTPLGLMAYLY....SS..DAFL.......EGYVQQFLYTFRYFC.TPHDFLHFLLDRISST................
ENSMUSP00000121635  CTVEELLRGCIeafdDSg.KVRD.......PQLVRMFLMMHPWYI.PSSQLASKLLHFYQQS................
ENSMUSP00000039186  DTLKKLVNHLV....PSl.QSGD.......PFFIPAFLSTYRRFA.TTLQVLNLLFKRYEYF................
ENSMUSP00000130604  -----------....--..----.......---------------.----------------................
ENSMUSP00000138360  -----------....--..----.......---------------.----------------................
ENSMUSP00000138330  -----------....--..----.......---------------.----------------................
ENSMUSP00000136756  EMVVKLVNNLV....PSl.QEGD.......HFFVSIFLSTYRSFV.TPLQVLGLLFMRYPYF................
ENSMUSP00000029766  -----------....--..----.......---------------.----------------................
ENSMUSP00000139822  -----------....--..----.......---------------.----------------................
ENSMUSP00000104523  ATPERLIMHLI....EEh.SIVD.......PTYIEDFLLTYRTFLeTPLDVGIKLLEWFKID................
ENSMUSP00000071368  --VEQMIAYIP....AAv.HYHD.......QLSISLFLAVYHRYC.STWEVLDLLMKTYPSF................
ENSMUSP00000120630  CTVEELLRGCIeafdDSg.KVRD.......PQLVRMFLMMHPWYI.PSSQLASKLLHFYQQS................
ENSMUSP00000108868  -----------....--..----.......---------------.----------------................
ENSMUSP00000073866  -----------....--..----.......---------------.----------------................
ENSMUSP00000031624  --VEQMIAYIP....AAv.HYHD.......QLSISLFLAVYHRYC.STWEVLDLLMKTYPSF................
ENSMUSP00000115092  GTLEKLVEHLV....PAf.QGSD.......LSYVTVFLCTYRAFT.TTQQVLDLLFKRYGCI................
ENSMUSP00000116215  GTLEKLVEHLV....PAf.QGSD.......LSYVTVFLCTYRAFT.TTQQVLDLLFKRYGCI................
ENSMUSP00000073399  ----QMIHYIP....AAv.QHND.......HVCIRIFLAMYPSYA.STWKVLDLLMTTYASF................
ENSMUSP00000106227  ----QMIHYIP....AAi.QKRD.......HICITIFLGVYRTYA.STWEVLDLLMRTYASF................
ENSMUSP00000106225  ----QMIHYIP....AAi.QKRD.......HICITIFLGVYRTYA.STWEVLDLLMRTYASF................
ENSMUSP00000106229  ----QMIHYIP....AAi.QKRD.......HICITIFLGVYRTYA.STWEVLDLLMRTYASF................
ENSMUSP00000136434  ----QMIHYIP....AAi.QKRD.......HICITIFLGVYRTYA.STWEVLDLLMRTYASF................
ENSMUSP00000106226  ----QMIHYIP....AAi.QKRD.......HICITIFLGVYRTYA.STWEVLDLLMRTYASF................
ENSMUSP00000076380  ----QMIHYFP....AAi.QKRD.......HICITIFLGVYRTYA.STWEVLDLLMRTYASF................
ENSMUSP00000106241  ----QMIHYIP....AAi.QKRD.......HICITIFLGVYRTYA.STWEVLDLLMRTYASF................
ENSMUSP00000106228  ----QMIHYIP....AAi.QKRD.......HICITIFLGVYRTYA.STWEVLDLLMRTYASF................
ENSMUSP00000134203  ----QMIHYIP....AAi.QKRD.......HICITIFLGVYRTYA.STWEVLDLLMRTYASF................
ENSMUSP00000036997  ----QMIHYFP....AAi.QKRD.......HICITIFLGVYRTYA.STWEVLDLLMRTYASF................
ENSMUSP00000136735  ----QMIHYIP....AAv.QHND.......HVCIRIFLAMYPSYA.STWKVLDLLMTTYAFF................
ENSMUSP00000123036  CTVEELLRGCIeafdDSg.KVRD.......PQLVRMFLMMHPWYI.PSSQLASKLLHFYQQS................
ENSMUSP00000109099  CTVEELLRGCIeafdDSg.KVRD.......PQLVRMFLMMHPWYI.PSSQLASKLLHFYQQS................
ENSMUSP00000109100  CTVEELLRGCIeafdDSg.KVRD.......PQLVRMFLMMHPWYI.PSSQLASKLLHFYQQS................
ENSMUSP00000109103  CTVEELLRGCIeafdDSg.KVRD.......PQLVRMFLMMHPWYI.PSSQLASKLLHFYQQS................
ENSMUSP00000031501  ---QQMIHYIP....AAi.QNRD.......HLCLDIFVAMYQTYA.TTWEVLDLLMKTYASF................
ENSMUSP00000032648  ---QQMIDYIP....AAi.QNRD.......HLCLDIFVAMYRTYA.TTWEVLDLLMKTYASF................
ENSMUSP00000109096  CTVEELLRGCIeafdDSg.KVRD.......PQLVRMFLMMHPWYI.PSSQLASKLLHFYQQS................
ENSMUSP00000115401  ASVERLLERLT....DL..RFLS.......IDFLNTFLHTYRIFT.TATVVLAKLSDIYKRP................
ENSMUSP00000120949  CTVEELLRGCIeafdDSg.KVRD.......PQLVRMFLMMHPWYI.PSSQLASKLLHFYQQS................
ENSMUSP00000134312  -----------....--..----.......---------------.----------------................
ENSMUSP00000117681  CTVEELLRGCIeafdDSg.KVRD.......PQLVRMFLMMHPWYI.PSSQLASKLLH-----................


                                                                                                    
                                                                                                    
d1nvus_               ..............................................................................
ENSMUSP00000067786  ..............................................................................
ENSMUSP00000138589  ..............................................................................
ENSMUSP00000044866  ..............................................................................
ENSMUSP00000138793  ..............................................................................
ENSMUSP00000109526  ..............................................................................
ENSMUSP00000028170  ..............................................................................
ENSMUSP00000097812  ..............................................................................
ENSMUSP00000129652  ..............................................................................
ENSMUSP00000031276  ..............................................................................
ENSMUSP00000027760  ..............................................................................
ENSMUSP00000107490  ..............................................................................
ENSMUSP00000107488  ..............................................................................
ENSMUSP00000116892  qnnrehlvdgksprlcrkfssppplavsrtsspvrarklsltsslnsrigaldltnssssssptttthspaaspppht
ENSMUSP00000034912  hnakllygdapksprasrkfssppplaigtsspsrrrklslnipiitggkalelaslgcssdsyanihspispfgktt
ENSMUSP00000096930  qnnrehlvdgksprlcrkfssppplavsrtsspvrarklsltsslnsrigaldltnssssssptttthspaaspppht
ENSMUSP00000028525  ..............................................................................
ENSMUSP00000099759  ..............................................................................
ENSMUSP00000088336  ..............................................................................
ENSMUSP00000114119  ..............................................................................
ENSMUSP00000113778  ..............................................................................
ENSMUSP00000090829  ..............................................................................
ENSMUSP00000065619  ..............................................................................
ENSMUSP00000128947  ..............................................................................
ENSMUSP00000092114  ..............................................................................
ENSMUSP00000104522  ..............................................................................
ENSMUSP00000099804  ..............................................................................
ENSMUSP00000098766  ..............................................................................
ENSMUSP00000105313  ..............................................................................
ENSMUSP00000132244  ..............................................................................
ENSMUSP00000135238  ..............................................................................
ENSMUSP00000116426  ..............................................................................
ENSMUSP00000092828  ..............................................................................
ENSMUSP00000129393  ..............................................................................
ENSMUSP00000099593  ..............................................................................
ENSMUSP00000136423  ..............................................................................
ENSMUSP00000117631  ..............................................................................
ENSMUSP00000099936  ..............................................................................
ENSMUSP00000088680  ..............................................................................
ENSMUSP00000092703  ..............................................................................
ENSMUSP00000035726  ..............................................................................
ENSMUSP00000134167  ..............................................................................
ENSMUSP00000090828  ..............................................................................
ENSMUSP00000134592  ..............................................................................
ENSMUSP00000118148  ..............................................................................
ENSMUSP00000133449  ..............................................................................
ENSMUSP00000134027  ..............................................................................
ENSMUSP00000041135  ..............................................................................
ENSMUSP00000109104  ..............................................................................
ENSMUSP00000129873  ..............................................................................
ENSMUSP00000120126  ..............................................................................
ENSMUSP00000124183  ..............................................................................
ENSMUSP00000032811  ..............................................................................
ENSMUSP00000125137  ..............................................................................
ENSMUSP00000103103  ..............................................................................
ENSMUSP00000092200  ..............................................................................
ENSMUSP00000123718  ..............................................................................
ENSMUSP00000041082  ..............................................................................
ENSMUSP00000124908  ..............................................................................
ENSMUSP00000140055  ..............................................................................
ENSMUSP00000140342  ..............................................................................
ENSMUSP00000140230  ..............................................................................
ENSMUSP00000027886  ..............................................................................
ENSMUSP00000139618  ..............................................................................
ENSMUSP00000063872  ..............................................................................
ENSMUSP00000130581  ..............................................................................
ENSMUSP00000139645  ..............................................................................
ENSMUSP00000108790  ..............................................................................
ENSMUSP00000088563  ..............................................................................
ENSMUSP00000132533  ..............................................................................
ENSMUSP00000048451  ..............................................................................
ENSMUSP00000108789  ..............................................................................
ENSMUSP00000135317  ..............................................................................
ENSMUSP00000115747  ..............................................................................
ENSMUSP00000050586  ..............................................................................
ENSMUSP00000121635  ..............................................................................
ENSMUSP00000039186  ..............................................................................
ENSMUSP00000130604  ..............................................................................
ENSMUSP00000138360  ..............................................................................
ENSMUSP00000138330  ..............................................................................
ENSMUSP00000136756  ..............................................................................
ENSMUSP00000029766  ..............................................................................
ENSMUSP00000139822  ..............................................................................
ENSMUSP00000104523  ..............................................................................
ENSMUSP00000071368  ..............................................................................
ENSMUSP00000120630  ..............................................................................
ENSMUSP00000108868  ..............................................................................
ENSMUSP00000073866  ..............................................................................
ENSMUSP00000031624  ..............................................................................
ENSMUSP00000115092  ..............................................................................
ENSMUSP00000116215  ..............................................................................
ENSMUSP00000073399  ..............................................................................
ENSMUSP00000106227  ..............................................................................
ENSMUSP00000106225  ..............................................................................
ENSMUSP00000106229  ..............................................................................
ENSMUSP00000136434  ..............................................................................
ENSMUSP00000106226  ..............................................................................
ENSMUSP00000076380  ..............................................................................
ENSMUSP00000106241  ..............................................................................
ENSMUSP00000106228  ..............................................................................
ENSMUSP00000134203  ..............................................................................
ENSMUSP00000036997  ..............................................................................
ENSMUSP00000136735  ..............................................................................
ENSMUSP00000123036  ..............................................................................
ENSMUSP00000109099  ..............................................................................
ENSMUSP00000109100  ..............................................................................
ENSMUSP00000109103  ..............................................................................
ENSMUSP00000031501  ..............................................................................
ENSMUSP00000032648  ..............................................................................
ENSMUSP00000109096  ..............................................................................
ENSMUSP00000115401  ..............................................................................
ENSMUSP00000120949  ..............................................................................
ENSMUSP00000134312  ..............................................................................
ENSMUSP00000117681  ..............................................................................


                                                                                                    
                                                                                                    
d1nvus_               ..............................................................................
ENSMUSP00000067786  ..............................................................................
ENSMUSP00000138589  ..............................................................................
ENSMUSP00000044866  ..............................................................................
ENSMUSP00000138793  ..............................................................................
ENSMUSP00000109526  ..............................................................................
ENSMUSP00000028170  ..............................................................................
ENSMUSP00000097812  ..............................................................................
ENSMUSP00000129652  ..............................................................................
ENSMUSP00000031276  ..............................................................................
ENSMUSP00000027760  ..............................................................................
ENSMUSP00000107490  ..............................................................................
ENSMUSP00000107488  ..............................................................................
ENSMUSP00000116892  avlesapadkagdsadmspcrspttprhlryrqpggqvadsahcsvspasafaiataaaghg................
ENSMUSP00000034912  ldtgklcmasslpktpeeidvpatipekpgelsasrkhssdvlkeeseddqnhsdedntevspvkspptpksflnrti
ENSMUSP00000096930  avlesapadkagdsadmspcrspttprhlryrqpggqvadsahcsvspasafaiataaaghg................
ENSMUSP00000028525  ..............................................................................
ENSMUSP00000099759  ..............................................................................
ENSMUSP00000088336  ..............................................................................
ENSMUSP00000114119  ..............................................................................
ENSMUSP00000113778  ..............................................................................
ENSMUSP00000090829  ..............................................................................
ENSMUSP00000065619  ..............................................................................
ENSMUSP00000128947  ..............................................................................
ENSMUSP00000092114  ..............................................................................
ENSMUSP00000104522  ..............................................................................
ENSMUSP00000099804  ..............................................................................
ENSMUSP00000098766  ..............................................................................
ENSMUSP00000105313  ..............................................................................
ENSMUSP00000132244  ..............................................................................
ENSMUSP00000135238  ..............................................................................
ENSMUSP00000116426  ..............................................................................
ENSMUSP00000092828  ..............................................................................
ENSMUSP00000129393  ..............................................................................
ENSMUSP00000099593  ..............................................................................
ENSMUSP00000136423  ..............................................................................
ENSMUSP00000117631  ..............................................................................
ENSMUSP00000099936  ..............................................................................
ENSMUSP00000088680  ..............................................................................
ENSMUSP00000092703  ..............................................................................
ENSMUSP00000035726  ..............................................................................
ENSMUSP00000134167  ..............................................................................
ENSMUSP00000090828  ..............................................................................
ENSMUSP00000134592  ..............................................................................
ENSMUSP00000118148  ..............................................................................
ENSMUSP00000133449  ..............................................................................
ENSMUSP00000134027  ..............................................................................
ENSMUSP00000041135  ..............................................................................
ENSMUSP00000109104  ..............................................................................
ENSMUSP00000129873  ..............................................................................
ENSMUSP00000120126  ..............................................................................
ENSMUSP00000124183  ..............................................................................
ENSMUSP00000032811  ..............................................................................
ENSMUSP00000125137  ..............................................................................
ENSMUSP00000103103  ..............................................................................
ENSMUSP00000092200  ..............................................................................
ENSMUSP00000123718  ..............................................................................
ENSMUSP00000041082  ..............................................................................
ENSMUSP00000124908  ..............................................................................
ENSMUSP00000140055  ..............................................................................
ENSMUSP00000140342  ..............................................................................
ENSMUSP00000140230  ..............................................................................
ENSMUSP00000027886  ..............................................................................
ENSMUSP00000139618  ..............................................................................
ENSMUSP00000063872  ..............................................................................
ENSMUSP00000130581  ..............................................................................
ENSMUSP00000139645  ..............................................................................
ENSMUSP00000108790  ..............................................................................
ENSMUSP00000088563  ..............................................................................
ENSMUSP00000132533  ..............................................................................
ENSMUSP00000048451  ..............................................................................
ENSMUSP00000108789  ..............................................................................
ENSMUSP00000135317  ..............................................................................
ENSMUSP00000115747  ..............................................................................
ENSMUSP00000050586  ..............................................................................
ENSMUSP00000121635  ..............................................................................
ENSMUSP00000039186  ..............................................................................
ENSMUSP00000130604  ..............................................................................
ENSMUSP00000138360  ..............................................................................
ENSMUSP00000138330  ..............................................................................
ENSMUSP00000136756  ..............................................................................
ENSMUSP00000029766  ..............................................................................
ENSMUSP00000139822  ..............................................................................
ENSMUSP00000104523  ..............................................................................
ENSMUSP00000071368  ..............................................................................
ENSMUSP00000120630  ..............................................................................
ENSMUSP00000108868  ..............................................................................
ENSMUSP00000073866  ..............................................................................
ENSMUSP00000031624  ..............................................................................
ENSMUSP00000115092  ..............................................................................
ENSMUSP00000116215  ..............................................................................
ENSMUSP00000073399  ..............................................................................
ENSMUSP00000106227  ..............................................................................
ENSMUSP00000106225  ..............................................................................
ENSMUSP00000106229  ..............................................................................
ENSMUSP00000136434  ..............................................................................
ENSMUSP00000106226  ..............................................................................
ENSMUSP00000076380  ..............................................................................
ENSMUSP00000106241  ..............................................................................
ENSMUSP00000106228  ..............................................................................
ENSMUSP00000134203  ..............................................................................
ENSMUSP00000036997  ..............................................................................
ENSMUSP00000136735  ..............................................................................
ENSMUSP00000123036  ..............................................................................
ENSMUSP00000109099  ..............................................................................
ENSMUSP00000109100  ..............................................................................
ENSMUSP00000109103  ..............................................................................
ENSMUSP00000031501  ..............................................................................
ENSMUSP00000032648  ..............................................................................
ENSMUSP00000109096  ..............................................................................
ENSMUSP00000115401  ..............................................................................
ENSMUSP00000120949  ..............................................................................
ENSMUSP00000134312  ..............................................................................
ENSMUSP00000117681  ..............................................................................


                                                                                     90       100   
                                                                                      |         |   
d1nvus_               .............................................................EPEPTEADRIAIENGDQ
ENSMUSP00000067786  .............................................................EPEPTEADRIAIENGDQ
ENSMUSP00000138589  .............................................................EPEPTEADKLALEKGEQ
ENSMUSP00000044866  .............................................................EPEPTEADKLALEKGEQ
ENSMUSP00000138793  .............................................................EPEPTEADKLALEKGEQ
ENSMUSP00000109526  .............................................................LPYSSE-----------
ENSMUSP00000028170  .............................................................--------DALTASSRY
ENSMUSP00000097812  .............................................................--------DALTASSRY
ENSMUSP00000129652  .............................................................QRLSEG-----------
ENSMUSP00000031276  .............................................................QRLSEG-----------
ENSMUSP00000027760  .............................................................TGPNCEDDGS-------
ENSMUSP00000107490  .............................................................TGPNCEDDGS-------
ENSMUSP00000107488  .............................................................TGPNCEDDGS-------
ENSMUSP00000116892  .............................................................SPPGFNNERT-------
ENSMUSP00000034912  tefpffnynngilmttcrdlvdnnrstlsatsafaiataganegpsnkevfrrmslantgfSSDQRNI----------
ENSMUSP00000096930  .............................................................SPPGFNNERT-------
ENSMUSP00000028525  .............................................................PSQGTEQER--------
ENSMUSP00000099759  .............................................................PSQGTEQER--------
ENSMUSP00000088336  .............................................................PSQGTEQER--------
ENSMUSP00000114119  .............................................................-----------------
ENSMUSP00000113778  .............................................................-----------------
ENSMUSP00000090829  .............................................................QQLDKP-----------
ENSMUSP00000065619  .............................................................QQLDKP-----------
ENSMUSP00000128947  .............................................................-----------------
ENSMUSP00000092114  .............................................................-----------------
ENSMUSP00000104522  .............................................................-----------------
ENSMUSP00000099804  .............................................................-----------------
ENSMUSP00000098766  .............................................................-----------------
ENSMUSP00000105313  .............................................................KYQGEE-----------
ENSMUSP00000132244  .............................................................RQQLEA-----------
ENSMUSP00000135238  .............................................................PADPAGGS---------
ENSMUSP00000116426  .............................................................PADPAGGS---------
ENSMUSP00000092828  .............................................................-----------------
ENSMUSP00000129393  .............................................................-----------------
ENSMUSP00000099593  .............................................................-----------------
ENSMUSP00000136423  .............................................................-----------------
ENSMUSP00000117631  .............................................................SPF--------------
ENSMUSP00000099936  .............................................................SPF--------------
ENSMUSP00000088680  .............................................................SPF--------------
ENSMUSP00000092703  .............................................................SPF--------------
ENSMUSP00000035726  .............................................................PPPPAGVDSKRTEGQDL
ENSMUSP00000134167  .............................................................-----------------
ENSMUSP00000090828  .............................................................-----------------
ENSMUSP00000134592  .............................................................-----------------
ENSMUSP00000118148  .............................................................PADPAGGS---------
ENSMUSP00000133449  .............................................................-----------------
ENSMUSP00000134027  .............................................................-----------------
ENSMUSP00000041135  .............................................................-----------------
ENSMUSP00000109104  .............................................................-----------------
ENSMUSP00000129873  .............................................................-----------------
ENSMUSP00000120126  .............................................................PADPAGGS---------
ENSMUSP00000124183  .............................................................-----------------
ENSMUSP00000032811  .............................................................-----------------
ENSMUSP00000125137  .............................................................-----------------
ENSMUSP00000103103  .............................................................-----------------
ENSMUSP00000092200  .............................................................-----------------
ENSMUSP00000123718  .............................................................-----------------
ENSMUSP00000041082  .............................................................-----------------
ENSMUSP00000124908  .............................................................-----------------
ENSMUSP00000140055  .............................................................-----------------
ENSMUSP00000140342  .............................................................-----------------
ENSMUSP00000140230  .............................................................-----------------
ENSMUSP00000027886  .............................................................-----------------
ENSMUSP00000139618  .............................................................-----------------
ENSMUSP00000063872  .............................................................-----------------
ENSMUSP00000130581  .............................................................-----------------
ENSMUSP00000139645  .............................................................-----------------
ENSMUSP00000108790  .............................................................-----------------
ENSMUSP00000088563  .............................................................-----------------
ENSMUSP00000132533  .............................................................-----------------
ENSMUSP00000048451  .............................................................-----------------
ENSMUSP00000108789  .............................................................-----------------
ENSMUSP00000135317  .............................................................-----------------
ENSMUSP00000115747  .............................................................------LSRA-------
ENSMUSP00000050586  .............................................................------LSRA-------
ENSMUSP00000121635  .............................................................-----------------
ENSMUSP00000039186  .............................................................-----------------
ENSMUSP00000130604  .............................................................-----------------
ENSMUSP00000138360  .............................................................-----------------
ENSMUSP00000138330  .............................................................-----------------
ENSMUSP00000136756  .............................................................-----------------
ENSMUSP00000029766  .............................................................-----------------
ENSMUSP00000139822  .............................................................-----------------
ENSMUSP00000104523  .............................................................-----------------
ENSMUSP00000071368  .............................................................-----------------
ENSMUSP00000120630  .............................................................-----------------
ENSMUSP00000108868  .............................................................-----------------
ENSMUSP00000073866  .............................................................-----------------
ENSMUSP00000031624  .............................................................-----------------
ENSMUSP00000115092  .............................................................LPYSSE-----------
ENSMUSP00000116215  .............................................................LPYSSED----------
ENSMUSP00000073399  .............................................................-----------------
ENSMUSP00000106227  .............................................................-----------------
ENSMUSP00000106225  .............................................................-----------------
ENSMUSP00000106229  .............................................................-----------------
ENSMUSP00000136434  .............................................................-----------------
ENSMUSP00000106226  .............................................................-----------------
ENSMUSP00000076380  .............................................................-----------------
ENSMUSP00000106241  .............................................................-----------------
ENSMUSP00000106228  .............................................................-----------------
ENSMUSP00000134203  .............................................................-----------------
ENSMUSP00000036997  .............................................................-----------------
ENSMUSP00000136735  .............................................................-----------------
ENSMUSP00000123036  .............................................................-----------------
ENSMUSP00000109099  .............................................................-----------------
ENSMUSP00000109100  .............................................................-----------------
ENSMUSP00000109103  .............................................................-----------------
ENSMUSP00000031501  .............................................................-----------------
ENSMUSP00000032648  .............................................................-----------------
ENSMUSP00000109096  .............................................................-----------------
ENSMUSP00000115401  .............................................................-----------------
ENSMUSP00000120949  .............................................................-----------------
ENSMUSP00000134312  .............................................................-----------------
ENSMUSP00000117681  .............................................................-----------------


                          110       120       130        140              150                 160   
                            |         |         |          |                |                   |   
d1nvus_               PLSAELKRFRKEYIQPVQLRVLNVCRHWVEHHF.YDFER..DA..YL...LQRMEEFIGT...VRGK.......AMKK
ENSMUSP00000067786  PLSAELKRFRKEYIQPVQLRVLNVCRHWVEHHF.YDFER..DA..DL...LQRMEEFIGT...VRGK.......AMKK
ENSMUSP00000138589  PISADLKRFRKEYVQPVQLRVLNVFRHWVEHHY.YDFER..DL..EL...LERLESFISS...VRGK.......AMKK
ENSMUSP00000044866  PISADLKRFRKEYVQPVQLRVLNVFRHWVEHHY.YDFER..DL..EL...LERLESFISS...VRGK.......AMKK
ENSMUSP00000138793  PISADLKRFRKEYVQPVQLRVLNVFRHWVEHHY.YDFER..DL..EL...LERLESFISS...VRGK.......AMKK
ENSMUSP00000109526  ---------DGGPQDQLKNAISSILGTWLDQYS.EDFCQppDF..PC...LKQLVAYVQLn..MPGS.......DLER
ENSMUSP00000028170  GCILPYSSEDGGPQDQLKNAISSILGTWLDQYS.EDFCQppDF..PC...LKQLVAYVQLn..MPGS.......DLER
ENSMUSP00000097812  GCILPYSSEDGGPQDQLKNAISSILGTWLDQYS.EDFCQppDF..PC...LKQLVAYVQLn..MPGS.......DLER
ENSMUSP00000129652  -------DGDKNQMRKIAPKILQLLTEWTETFP.YDFR-..DE..RM...MRNLKDLAHR...MASGee.....TYRK
ENSMUSP00000031276  -------DGDKNQMRKIAPKILQLLTEWTETFP.YDFR-..DE..RM...MRNLKDLAHR...MASGeeq....TYRK
ENSMUSP00000027760  -------QSSPESKAVIRNAIASILRAWLDQCA.EDFRE..PPhfPC...LQKLLEYLKQm..MPGS.......DPER
ENSMUSP00000107490  -------QSSPESKAVIRNAIASILRAWLDQCA.EDFRE..PPhfPC...LQKLLEYLKQm..MPGS.......DPER
ENSMUSP00000107488  -------QSSPESKAVIRNAIASILRAWLDQCA.EDFRE..PPhfPC...LQKLLEYLKQm..MPGS.......DPER
ENSMUSP00000116892  ------CDKEFIIRRTATNRVLNVLRHWVSKHA.QDFEL..NN..EL...KMNVLNLLEEv..LRDP.......DLLP
ENSMUSP00000034912  -------DKEFVIRRAATNRVLNVLRHWVTKHT.QDFDT..DD..TL...KYRVICFLEE...VMHDpdllt..QERK
ENSMUSP00000096930  ------CDKEFIIRRTATNRVLNVLRHWVSKHA.QDFEL..NN..EL...KMNVLNLLEEv..LRDP.......DLLP
ENSMUSP00000028525  ----------MDYALNNKRRVIRLVLQWAAMYG.DLLQE..DD..VA...MAFLEEFYVS...VSDDarmma..AFKE
ENSMUSP00000099759  ----------MDYALNNKRRVIRLVLQWAAMYG.DLLQE..DD..VA...MAFLEEFYVS...VSDDarmma..AFKE
ENSMUSP00000088336  ----------MDYALNNKRRVIRLVLQWAAMYG.DLLQE..DD..VA...MAFLEEFYVS...VSDDarmma..AFKE
ENSMUSP00000114119  ---------------SLRDKVTRVVLLWVNNHF.NDFEG..DP..AM...TRFLEEFENN...LERE.......KMGG
ENSMUSP00000113778  ---------------SLRDKVTRVVLLWVNNHF.NDFEG..DP..AM...TRFLEEFENN...LERE.......KMGG
ENSMUSP00000090829  -------VLDKARVRKFGAKLLQLLAEWTETFP.RDFE-..EE..ST...IGHLTDVVGRis.PCDE.......TYGS
ENSMUSP00000065619  -------VLDKARVRKFGAKLLQLLAEWTETFP.RDFE-..EE..ST...IGHLTDVVGRis.PCDE.......TYGS
ENSMUSP00000128947  -------YYPDNQMRKIAPKILQLLTEWTETFP.YDFR-..DE..RM...MRNLKDLAHR...MASGee.....TYRK
ENSMUSP00000092114  ---------------NLRDKVTRIVLLWVNNHF.NDFEG..DP..AM...TQFLEEFERN...LEDT.......KMNG
ENSMUSP00000104522  ---------------NLRDKVTRIVLLWVNNHF.NDFEG..DP..AM...TQFLEEFERN...LEDT.......KMNG
ENSMUSP00000099804  ---------------NLRDKVTRIVLLWVNNHF.NDFEG..DP..AM...TQFLEEFERN...LEDT.......KMNG
ENSMUSP00000098766  ---------------NLRDKVTRIVLLWVNNHF.NDFEG..DP..AM...TQFLEEFERN...LEDT.......KMNG
ENSMUSP00000105313  ---------ENSDVPCRKRKVLHLVSQWISLYK.DWLHE..DE..HS...KMFLKTIYRN...VLDDvyeyp..ILEK
ENSMUSP00000132244  -------GPEKAKLKSFSTKIVQLLKEWTEAFP.YDFQ-..DE..KV...MAELKAIAHRv..TQCD.......EENG
ENSMUSP00000135238  ------EQEHSTYICNKRQQILRLVGRWVALYS.PMLHS..DP..VA...TSFLQKLSDL...VSRD.......----
ENSMUSP00000116426  ------EQEHSTYICNKRQQILRLVGRWVALYS.PMLHS..DP..VA...TSFLQKLSDL...VSRD.......----
ENSMUSP00000092828  ---------SGESCDEFRLKICYFMRYWILKFP.AEFNL..DL..GL...IRMTEEFREV...ASQL.......GHEK
ENSMUSP00000129393  ---------SGESCDEFRLKICYFMRYWILKFP.AEFNL..DL..GL...IRMTEEFREV...ASQL.......GHEK
ENSMUSP00000099593  ---------LEKNSPGVCLKICYFVRYWITEFW.IMFKM..DA..SL...TSTMEEFQDL...VKAN.......GE-E
ENSMUSP00000136423  ---------LEKNSPGVCLKICYFVRYWITEFW.IMFKM..DA..SL...TSTMEEFQDL...VKAN.......GE-E
ENSMUSP00000117631  --------ADTFKKRVSKNTFFVLVRVVDELCL.VEL--..TE..EI...LKLLMELVFR...LVCS.......GELS
ENSMUSP00000099936  --------ADTFKKRVSKNTFFVLVRVVDELCL.VEL--..TE..EI...LKLLMELVFR...LVCS.......GELS
ENSMUSP00000088680  --------ADTFKKRVSKNTFFVLVRVVDELCL.VEL--..TE..EI...LKLLMELVFR...LVCS.......GELS
ENSMUSP00000092703  --------ADTFKKRVSKNTFFVLVRVVDELCL.VEL--..TE..EI...LKLLMELVFR...LVCS.......GELS
ENSMUSP00000035726  ------------NFSKNLRAVVSVLGSWLRNHP.QDFRD..PP..DHqn.LGNVRIFLGWa..APGG.......AEAR
ENSMUSP00000134167  ---------LEKNSPGVCLKICYFVRYWITEFW.IMFKM..DA..SL...TSTMEEFQDL...VKAN.......GE-E
ENSMUSP00000090828  -------YYPEARVRKFGAKLLQLLAEWTETFP.RDFE-..EE..ST...IGHLTDVVGRis.PCDE.......TYGS
ENSMUSP00000134592  ---------LEKNSPGVCLKICYFVRYWITEFW.IMFKM..DA..SL...TSTMEEFQDL...VKAN.......GE-E
ENSMUSP00000118148  ------EQEHSTYICNKRQQILRLVGRWVALYS.PMLHS..DP..VA...TSFLQKLSDL...VSRD.......----
ENSMUSP00000133449  ---------LEKNSPGVCLKICYFVRYWITEFW.IMFKM..DA..SL...TSTMEEFQDL...VKAN.......GE-E
ENSMUSP00000134027  ---------LEKNSPGVCLKICYFVRYWITEFW.IMFKM..DA..SL...TSTMEEFQDL...VKAN.......GE-E
ENSMUSP00000041135  ---------RKDNSNSLQMKTCHLVRYWISAFP.AEFDL..NP..EL...AEQIKELKAL...LDQE.......GNRR
ENSMUSP00000109104  ---------RKDNSNSLQMKTCHLVRYWISAFP.AEFDL..NP..EL...AEQIKELKAL...LDQE.......GNRR
ENSMUSP00000129873  ---------RKDNSNSLQMKTCHLVRYWISAFP.AEFDL..NP..EL...AEQIKELKAL...LDQE.......GNRR
ENSMUSP00000120126  ------EQEHSTYICNKRQQILRLVGRWVALYS.PMLHS..DP..VA...TSFLQKLSDL...VSRD.......----
ENSMUSP00000124183  ---------AKDAQELRQLQICYLVRYWLTHHH.EAVHQ..EP..QL...EAVISRFWTT...VAQE.......G---
ENSMUSP00000032811  ---------AKDAQELRQLQICYLVRYWLTHHH.EAVHQ..EP..QL...EAVISRFWTT...VAQE.......G---
ENSMUSP00000125137  ---------AKDAQELRQLQICYLVRYWLTHHH.EAVHQ..EP..QL...EAVISRFWTT...VAQE.......G---
ENSMUSP00000103103  ------RNVEGPEGLGRKQACLALLLHFLDTYQ.GLLQE..EE..GA...GHIIKELYLLi..MKDEslyqdlrEDTL
ENSMUSP00000092200  ------QKAAKDAQELRQLQICYLVRYWLTHHH.EAVHQ..EP..QL...EAVISRFWTT...VAQE.......G---
ENSMUSP00000123718  ---------AKDAQELRQLQICYLVRYWLTHHH.EAVHQ..EP..QL...EAVISRFWTT...VAQE.......GNMA
ENSMUSP00000041082  ------ESHPPGELERTTGVAISVLSTWLASHP.EDFGS..E-..-VkgqLDRLESFLLRtgyAARE.......GVVG
ENSMUSP00000124908  ---------AKDAQELRQLQICYLVRYWLTHHH.EAVHQ..EP..QL...EAVISRFWTT...VAQE.......G---
ENSMUSP00000140055  ---------------------------------.-----..--..--...----------...----.......----
ENSMUSP00000140342  ---------------------------------.-----..--..--...----------...----.......----
ENSMUSP00000140230  ---------------------------------.-----..--..--...----------...----.......----
ENSMUSP00000027886  ---------------------------------.-----..--..--...----------...----.......----
ENSMUSP00000139618  ---------------------------------.-----..--..--...----------...----.......----
ENSMUSP00000063872  ---------------------------------.-----..--..--...----------...----.......----
ENSMUSP00000130581  ---------------------------------.-----..--..--...----------...----.......----
ENSMUSP00000139645  ---------------------------------.-----..--..--...----------...----.......----
ENSMUSP00000108790  ---------------------------------.-----..--..--...----------...----.......----
ENSMUSP00000088563  ---------------------------------.-----..--..--...----------...----.......----
ENSMUSP00000132533  ---------------------------------.-----..--..--...----------...----.......----
ENSMUSP00000048451  ---------------------------------.-----..--..--...----------...----.......----
ENSMUSP00000108789  ---------------------------------.-----..--..--...----------...----.......----
ENSMUSP00000135317  ---------------------------------.-----..--..--...----------...----.......----
ENSMUSP00000115747  ------HQDPTSTFTKIYRRSLCVLQAWVEDCYtVDFIR..NA..GL...LGQLEDFISSki.LPLD.......GTAE
ENSMUSP00000050586  ------HQDPTSTFTKIYRRSLCVLQAWVEDCYtVDFIR..NA..GL...LGQLEDFISSki.LPLD.......GTAE
ENSMUSP00000121635  ---------RKDNSNSLQMKTCHLVRYWISAFP.AEFDL..NP..EL...AEQIKELKAL...LDQE.......GNRR
ENSMUSP00000039186  -------RPNSEEDEQVKNTLCSFLNTWMDKNT.EDFCQ..TS..DLlp.LNYLKTYLSMn..MPDS.......DLNV
ENSMUSP00000130604  ---------------------------------.-----..--..--...----------...----.......----
ENSMUSP00000138360  ---------------------------------.-----..--..--...----------...----.......----
ENSMUSP00000138330  ---------------------------------.-----..--..--...----------...----.......----
ENSMUSP00000136756  -------HPHSVEHRQVRSSLCNFLHTWMDKNP.EDFCD..PS..DMlp.LTYLKAYLSVh..MPHS.......ELFI
ENSMUSP00000029766  ---------------------------------.-----..--..--...----------...----.......----
ENSMUSP00000139822  ---------------------------------.-----..--..--...----------...----.......----
ENSMUSP00000104523  ---------------NLRDKVTRIVLLWVNNHF.NDFEG..DP..AM...TQFLEEFERN...LEDT.......----
ENSMUSP00000071368  -------QPDCEQDQLTKSAIFNFLAHWLDTFP.EHFFD..SP..NLav.MRQLMDYAGRh..MPSA.......EFDK
ENSMUSP00000120630  ---------RKDNSNSLQMKTCHLVRYWISAFP.AEFDL..NP..EL...AEQIKELKAL...LDQE.......GNRR
ENSMUSP00000108868  ---------------------------------.-----..--..--...----------...----.......----
ENSMUSP00000073866  ---------------------------------.-----..--..--...----------...----.......----
ENSMUSP00000031624  -------QPDCKQDQLTKSAIFSFLAHWLDTFP.EHFFD..SP..NLav.MRQLMDYAGRh..MPSA.......EFDK
ENSMUSP00000115092  ---------------------------------.-----..--..--...----------...----.......----
ENSMUSP00000116215  ---------------------------------.-----..--..--...----------...----.......----
ENSMUSP00000073399  -------RPDCVEDQQTKSDVFSFLFHWFKKFP.KDFCE..SP..DLdv.VRQFIDYVRRn..VPSA.......DEDT
ENSMUSP00000106227  -------RPDCIKDQQTKRAIFRFLFGWFKKYP.QDFYE..SP..DLav.VRQFIDYVKH...NVPS.......SDVD
ENSMUSP00000106225  -------RPDCIKDQQTKRAIFRFLFGWFKKYP.QDFYE..SP..DLav.VRQFIDYVKH...NVPS.......SDVD
ENSMUSP00000106229  -------RPDCIKDQQTKRAIFRFLFGWFKKYP.QDFYE..SP..DLav.VRQFIDYVKH...NVPS.......SDVD
ENSMUSP00000136434  -------RPDCIKDQQTKRAIFRFLFGWFKKYP.QDFYE..SP..DLav.VRQFIDYVKH...NVPS.......SDVD
ENSMUSP00000106226  -------RPDCIKDQQTKRAIFRFLFGWFKKYP.QDFYE..SP..DLav.VRQFIDYVKR...NVPS.......SDVD
ENSMUSP00000076380  -------RPDCIKDQQTKRAIFRFLFGWFKKYP.QDFYE..SP..DLav.VRQFIDYVKH...NVPS.......SDVD
ENSMUSP00000106241  -------RPDCIKDQQTKRAIFRFLFGWFKKYP.QDFYE..SP..DLav.VRQFIDYVKR...NVPS.......SDVD
ENSMUSP00000106228  -------RPDCIKDQQTKRAIFRFLFGWFKKYP.QDFYE..SP..DLav.VRQFIDYVKR...NVPS.......SDVD
ENSMUSP00000134203  -------RPDCIKDQQTKRAIFRFLFGWFKKYP.QDFYE..SP..DLav.VRQFIDYVKR...NVPS.......SDVD
ENSMUSP00000036997  -------RPDCIKDQQTKRAIFRFLFGWFKKYP.QDFYE..SP..DLav.VRQFIDYVKH...NVPS.......SDVD
ENSMUSP00000136735  -------LPDRIKDQETKRAIFRFLFHWFKKFP.KDFYE..SP..DLav.VRQFIDYVRHn..VPSA.......DEDT
ENSMUSP00000123036  ---------RKDNSNSLQMKTCHLVRYWISAFP.AEFDL..NP..EL...AEQIKELKAL...LDQE.......GNRR
ENSMUSP00000109099  ---------RKDNSNSLQMKTCHLVRYWISAFP.AEFDL..NP..EL...AEQIKELKAL...LDQE.......GNRR
ENSMUSP00000109100  ---------RKDNSNSLQMKTCHLVRYWISAFP.AEFDL..NP..EL...AEQIKELKAL...LDQE.......GNRR
ENSMUSP00000109103  ---------RKDNSNSLQMKTCHLVRYWISAFP.AEFDL..NP..EL...AEQIKELKAL...LDQE.......GNRR
ENSMUSP00000031501  -------QPDFVEDQQTKRAIFSFLFGWFQKFP.QDFYE..SP..DLav.LSQFTEYVRLn..VPSP.......DIDT
ENSMUSP00000032648  -------RTDCIEDQQTKSAIFSFLFGWFQKFP.QDFYE..SP..DLav.LSQFTEYVRL...----.......----
ENSMUSP00000109096  ---------RKDNSNSLQMKTCHLVRYWISAFP.AEFDL..NP..E-...----------...----.......----
ENSMUSP00000115401  ---------------------------------.-----..--..--...----------...----.......----
ENSMUSP00000120949  ---------RKDNSNSLQMKTCHLVRYWISAFP.AEFDL..--..--...----------...----.......----
ENSMUSP00000134312  ---------------------------------.-----..--..--...----------...----.......----
ENSMUSP00000117681  ---------------------------------.-----..--..--...----------...----.......----


                          170               180                190                                  
                            |                 |                  |                                  
d1nvus_               WVESITKII..QRK......KIARDNGPGH.........NITFQS..SPPTV..........................
ENSMUSP00000067786  WVESITKII..QRK......KIARDNGPGH.........NITFQS..SPPTV..........................
ENSMUSP00000138589  WVESIAKII..KRK......KQAQANGISH.........NITFES..SPPPV..........................
ENSMUSP00000044866  WVESIAKII..KRK......KQAQANGISH.........NITFES..SPPPV..........................
ENSMUSP00000138793  WVESIAKII..KRK......KQAQANGISH.........NITFES..SPPPV..........................
ENSMUSP00000109526  RAHLLLAQL..EDL......EPSEAESEA-.........-----L..SPAPVlslkpasqlepallltpsqvvtstpv
ENSMUSP00000028170  RAHLLLAQL..EDL......EPSEAESEA-.........-----L..SPAPVlslkpasqlepallltpsqvvtstpv
ENSMUSP00000097812  RAHLLLAQL..EDL......EPSEAESEA-.........-----L..SPAPVlslkpasqlepallltpsqvvtstpv
ENSMUSP00000129652  NVQQMMQCL..IRK......LAALSQYEEV.........LAKLSStaTDRLT..........................
ENSMUSP00000031276  NVQQMMQCL..IRK......LAALSQYEEV.........LAKLSStaTDRLT..........................
ENSMUSP00000027760  RAQNLLEQF..QKQ......DVDSDNGLLN.........TSSFS-..-----..........................
ENSMUSP00000107490  RAQNLLEQF..QKQ......DVDSDNGLLN.........TSSFS-..-----..........................
ENSMUSP00000107488  RAQNLLEQF..QKQ......DVDSDNGLLN.........TSSFS-..-----..........................
ENSMUSP00000116892  QERKATANI..LRA......LSQDDQDDIH.........LKLEDI..IQMTD..........................
ENSMUSP00000034912  AAANIIRTL..TLE......ETTEQHSMLE.........EV----..-----..........................
ENSMUSP00000096930  QERKATANI..LRA......LSQDDQDDIH.........LKLEDI..IQMTD..........................
ENSMUSP00000028525  QLPELEKIV..KQI......S-EDAKAPQK.........KHKVLL..QQFNTgderaqkrqpirgsdevlfkvycidh
ENSMUSP00000099759  QLPELEKIV..KQI......S-EDAKAPQK.........KHKVLL..QQFNTgderaqkrqpirgsdevlfkvycidh
ENSMUSP00000088336  QLPELEKIV..KQI......S-EDAKAPQK.........KHKVLL..QQFNTgderaqkrqpirgsdevlfkvycidh
ENSMUSP00000114119  HLRLLNIAC..AAK......AKRRLMTLTK.........PSREAP..LPFILlggsekgfgifvdsvdscskateagl
ENSMUSP00000113778  HLRLLNIAC..AAK......AKRRLMTLTK.........PSREAP..LPFILlggsekgfgifvdsvdscskateagl
ENSMUSP00000090829  RVHQLLQTL..HQK......LASLGQGPES.........LVGADK..PISYR..........................
ENSMUSP00000065619  RVHQLLQTL..HQK......LASLGQGPES.........LVGADK..PISYR..........................
ENSMUSP00000128947  NVQQMMQCL..IRK......LAALSQYEEV.........LAKLSStaTDRLT..........................
ENSMUSP00000092114  HLRLLNIAC..AAK......AKWRQVVLQK.........ASRESP..LHFCLtggsekgfgvfveevesgskaadagl
ENSMUSP00000104522  HLRLLNIAC..AAK......AKWRQVVLQK.........ASRESP..LHFCLtggsekgfgvfveevesgskaadagl
ENSMUSP00000099804  HLRLLNIAC..AAK......AKWRQVVLQK.........ASRESP..LHFCLtggsekgfgvfveevesgskaadagl
ENSMUSP00000098766  HLRLLNIAC..AAK......AKWRQVVLQK.........ASRESP..LHFCLtggsekgfgvfveevesgskaadagl
ENSMUSP00000105313  ELKEFQKILgvYRR......HTVDEYSPQK.........KNKALF..HQFSLkenwlqhrgtvaeteeifchvyiteh
ENSMUSP00000132244  TVKKAIAQM..IQSlllslaARSQLQELRE.........KLRSPV..VDKGP..........................
ENSMUSP00000135238  --ARLSNLL..REQ......YPERRRHHRL.........ENGCGN..VSPQTkarnapvwlpnqeeplpssagairvg
ENSMUSP00000116426  --ARLSNLL..REQ......YPERRRHHRL.........ENGCGN..VSPQTkarnapvwlpnqeeplpssagairvg
ENSMUSP00000092828  HISLM----..---......----------.........---DIS..SVPSY..........................
ENSMUSP00000129393  HISLM----..---......----------.........---DIS..SVPSY..........................
ENSMUSP00000099593  THCHLIDTT..QIN......SRDWSRKLTQ.........RIKSNT..S----..........................
ENSMUSP00000136423  THCHLIDTT..QIN......SRDWSRKLTQ.........RIKSNT..S----..........................
ENSMUSP00000117631  LARVLRKNI..LDK......VD--------.........QKKLLR..CAHSD..........................
ENSMUSP00000099936  LARVLRKNI..LDK......VD--------.........QKKLLR..CAHSD..........................
ENSMUSP00000088680  LARVLRKNI..LDK......VD--------.........QKKLLR..CAHSD..........................
ENSMUSP00000092703  LARVLRKNI..LDK......VD--------.........QKKLLR..CAHSD..........................
ENSMUSP00000035726  EAEKLLEDF..LKE......AKGEQTEEEKrlawsgpprIAQTPG..SEFAE..........................
ENSMUSP00000134167  THCHLIDTT..QIN......SRDWSRKLTQ.........RIKSNT..S----..........................
ENSMUSP00000090828  RVHQLLQTL..HQK......LASLGQGPES.........LVGADK..PISYR..........................
ENSMUSP00000134592  THCHLIDTT..QIN......SRDWSRKLTQ.........RIKSNT..S----..........................
ENSMUSP00000118148  --ARLSNLL..REQ......YPERRRHHRL.........ENGCGN..VSPQTkarnapvwlpnqeeplpssagairvg
ENSMUSP00000133449  THCHLIDTT..QIN......SRDWSRKLTQ.........RIKSNT..S----..........................
ENSMUSP00000134027  THCHLIDTT..QIN......SRDWSRKLTQ.........RIKSNT..S----..........................
ENSMUSP00000041135  HSSLI----..---......--DIESVPTY.........KWKRQV..TQRNP..........................
ENSMUSP00000109104  HSSLI----..---......--DIESVPTY.........KWKRQV..TQRNP..........................
ENSMUSP00000129873  HSSLI----..---......--DIESVPTY.........KWKRQV..TQRNP..........................
ENSMUSP00000120126  --ARLSNLL..REQ......YPERRRHHRL.........ENGCGN..VSPQTkarnapvwlpnqeeplpssagairvg
ENSMUSP00000124183  -------NM..AQR......SLGDASSLLS.........PGGPGP..PPPMS..........................
ENSMUSP00000032811  -------NM..AQR......SLGDASSLLS.........PGGPGP..PPPMS..........................
ENSMUSP00000125137  -------NM..AQR......SLGDASSLLS.........PGGPGP..PPPMS..........................
ENSMUSP00000103103  RLHQLVETV..ELK......IPEESQPPSK.........QVKPLF..RHFRRidsclqtrvafrgsdeifcrvympdh
ENSMUSP00000092200  -------NM..AQR......SLGDASSLLS.........PGGPGP..PPPMS..........................
ENSMUSP00000123718  Q--------..---......----------.........---RSL..GDASS..........................
ENSMUSP00000041082  GSADLIRNL..RAR......VDPRAPDLPK.........PLALPG..DSPAD..........................
ENSMUSP00000124908  -------NM..AQR......SLGDASSLLS.........PGGPGP..PPPMS..........................
ENSMUSP00000140055  ---------..---......----------.........-SSSSE..SLSEK..........................
ENSMUSP00000140342  ---------..---......----------.........-SSSSE..SLSEK..........................
ENSMUSP00000140230  ---------..---......----------.........-SSSSE..SLSEK..........................
ENSMUSP00000027886  ---------..---......----------.........-SSSSE..SLSEK..........................
ENSMUSP00000139618  ---------..---......----------.........-SSSSE..SLSEK..........................
ENSMUSP00000063872  ---------..---......----------.........-SSSSE..SLSEK..........................
ENSMUSP00000130581  ---------..---......----------.........-SSSSE..SLSEK..........................
ENSMUSP00000139645  ---------..---......----------.........-SSSSE..SLSEK..........................
ENSMUSP00000108790  ---------..---......-----ATPQG.........SSSSDS..LEGQS..........................
ENSMUSP00000088563  ---------..---......-----ATPQG.........SSSSDS..LEGQS..........................
ENSMUSP00000132533  ---------..---......----------.........------..-----..........................
ENSMUSP00000048451  ---------..---......-----ATPQG.........SSSSDS..LEGQS..........................
ENSMUSP00000108789  ---------..---......-----ATPQG.........SSSSDS..LEGQS..........................
ENSMUSP00000135317  ---------..---......----------.........------..-----..........................
ENSMUSP00000115747  HLLALLEVG..TERradsa.SRGADLEDPK.........EAEEDT..RPFNAlckrfsedgitrksfswrlprgnglv
ENSMUSP00000050586  HLLALLEVG..TERradsa.SRGADLEDPK.........EAEEDT..RPFNAlckrfsedgitrksfswrlprgnglv
ENSMUSP00000121635  HSSLI----..---......--DIESVPTY.........KWKRQV..TQRNP..........................
ENSMUSP00000039186  RVTRLLTQL..QKE......QANVSQAKDE.........EDSDLE..SNTSS..........................
ENSMUSP00000130604  ---------..---......----------.........------..-----..........................
ENSMUSP00000138360  ---------..---......----------.........------..-----..........................
ENSMUSP00000138330  ---------..---......----------.........------..-----..........................
ENSMUSP00000136756  RVDRLLNEL..WEE......QDKDSHAKNE.........EDSDLG..RHTSS..........................
ENSMUSP00000029766  ---------..---......----------.........-----L..LPPEN..........................
ENSMUSP00000139822  ---------..---......----------.........KSSSSE..SLSEK..........................
ENSMUSP00000104523  ---------..---......----------.........------..-----..........................
ENSMUSP00000071368  ESRELLSRL..EEQ......EAKKLKLEKD.........CAATAE..Q----..........................
ENSMUSP00000120630  HSSLI----..---......--DIESVPTY.........KWKRQV..TQRNP..........................
ENSMUSP00000108868  ---------..---......----------.........------..--KEN..........................
ENSMUSP00000073866  ---------..---......----------.........------..-----..........................
ENSMUSP00000031624  ESRELLSRL..EEQ......EAKKLKLEKD.........CAATAE..QD---..........................
ENSMUSP00000115092  ---------..---......----------.........------..-----..........................
ENSMUSP00000116215  ---------..---......----------.........------..-----..........................
ENSMUSP00000073399  QARELLSVL..EEQ......EA--------.........------..-----..........................
ENSMUSP00000106227  RARELLSLL..E--......----------.........------..-----..........................
ENSMUSP00000106225  RARELLSVL..---......----------.........------..-----..........................
ENSMUSP00000106229  RARELLSLL..E--......----------.........------..-----..........................
ENSMUSP00000136434  RARELLSVL..---......----------.........------..-----..........................
ENSMUSP00000106226  RARELLSVL..ED-......----------.........------..-----..........................
ENSMUSP00000076380  RARELLSVL..---......----------.........------..-----..........................
ENSMUSP00000106241  RARELLSVL..E--......----------.........------..-----..........................
ENSMUSP00000106228  RARELLSVL..ED-......----------.........------..-----..........................
ENSMUSP00000134203  RARELLSVL..ED-......----------.........------..-----..........................
ENSMUSP00000036997  RARELLSVL..ED-......----------.........------..-----..........................
ENSMUSP00000136735  QARELLSVL..EEQ......----------.........------..-----..........................
ENSMUSP00000123036  H--------..---......----------.........------..-----..........................
ENSMUSP00000109099  H--------..---......----------.........------..-----..........................
ENSMUSP00000109100  H--------..---......----------.........------..-----..........................
ENSMUSP00000109103  H--------..---......----------.........------..-----..........................
ENSMUSP00000031501  QA-------..---......----------.........------..-----..........................
ENSMUSP00000032648  ---------..---......----------.........------..-----..........................
ENSMUSP00000109096  ---------..---......----------.........------..-----..........................
ENSMUSP00000115401  ---------..---......----------.........------..-----..........................
ENSMUSP00000120949  ---------..---......----------.........------..-----..........................
ENSMUSP00000134312  ---------..---......----------.........------..-----..........................
ENSMUSP00000117681  ---------..---......----------.........------..-----..........................


                                                                                                    
                                                                                                    
d1nvus_               ..............................................................................
ENSMUSP00000067786  ..............................................................................
ENSMUSP00000138589  ..............................................................................
ENSMUSP00000044866  ..............................................................................
ENSMUSP00000138793  ..............................................................................
ENSMUSP00000109526  repaaapvpvlasspvvapapelepvpeppqepepslalapelepavsqslelesapvptpalepsws..........
ENSMUSP00000028170  repaaapvpvlasspvvapapelepvpeppqepepslalapelepavsqslelesapvptpalepsws..........
ENSMUSP00000097812  repaaapvpvlasspvvapapelepvpeppqepepslalapelepavsqslelesapvptpalepsws..........
ENSMUSP00000129652  ..............................................................................
ENSMUSP00000031276  ..............................................................................
ENSMUSP00000027760  ..............................................................................
ENSMUSP00000107490  ..............................................................................
ENSMUSP00000107488  ..............................................................................
ENSMUSP00000116892  ..............................................................................
ENSMUSP00000034912  ..............................................................................
ENSMUSP00000096930  ..............................................................................
ENSMUSP00000028525  tyttirvpvaasvkevisavadklgsgegliivkmnsggekvvlksndvsvfttltingrlfacpreqfdsltp....
ENSMUSP00000099759  tyttirvpvaasvkevisavadklgsgegliivkmnsggekvvlksndvsvfttltingrlfacpreqfdsltp....
ENSMUSP00000088336  tyttirvpvaasvkevisavadklgsgegliivkmnsggekvvlksndvsvfttltingrlfacpreqfdsltp....
ENSMUSP00000114119  krgdqilevngqnfeniqlskameilrnnthlsitvktnlfvfkelltrlseekrngaphlpkigdikkasrysipdl
ENSMUSP00000113778  krgdqilevngqnfeniqlskameilrnnthlsitvktnlfvfkelltrlseekrngaphlpkigdikkasrysipdl
ENSMUSP00000090829  ..............................................................................
ENSMUSP00000065619  ..............................................................................
ENSMUSP00000128947  ..............................................................................
ENSMUSP00000092114  krgdqvmevngqnfenitlakaleilrnnthlaltvktnifvfkellsrteqeksgvphipkiaekksnrhsiqdvpg
ENSMUSP00000104522  krgdqvmevngqnfenitlakaleilrnnthlaltvktnifvfkellsrteqeksgvphipkiaekksnrhsiqdvpg
ENSMUSP00000099804  krgdqvmevngqnfenitlakaleilrnnthlaltvktnifvfkellsrteqeksgvphipkiaekksnrhsiqdvpg
ENSMUSP00000098766  krgdqvmevngqnfenitlakaleilrnnthlaltvktnifvfkellsrteqeksgvphipkiaekksnrhsiqdvpg
ENSMUSP00000105313  syisvkakvsstaqeilkvvaeklqraeedlalvaitfsgekhefqpndlaisksleasgriyvyrkdladtln....
ENSMUSP00000132244  ..............................................................................
ENSMUSP00000135238  dkvpydicrpdhsvltlhlpvtasvrevmaalahedhwtkgqvlvkvnsagdvvglqpdargvatslglnerlfvvdp
ENSMUSP00000116426  dkvpydicrpdhsvltlhlpvtasvrevmaalahedhwtkgqvlvkvnsagdvvglqpdargvatslglnerlfvvdp
ENSMUSP00000092828  ..............................................................................
ENSMUSP00000129393  ..............................................................................
ENSMUSP00000099593  ..............................................................................
ENSMUSP00000136423  ..............................................................................
ENSMUSP00000117631  ..............................................................................
ENSMUSP00000099936  ..............................................................................
ENSMUSP00000088680  ..............................................................................
ENSMUSP00000092703  ..............................................................................
ENSMUSP00000035726  ..............................................................................
ENSMUSP00000134167  ..............................................................................
ENSMUSP00000090828  ..............................................................................
ENSMUSP00000134592  ..............................................................................
ENSMUSP00000118148  dkvpydicrpdhsvltlhlpvtasvrevmaalahedhwtkgqvlvkvnsagdvvglqpdargvatslglnerlfvvdp
ENSMUSP00000133449  ..............................................................................
ENSMUSP00000134027  ..............................................................................
ENSMUSP00000041135  ..............................................................................
ENSMUSP00000109104  ..............................................................................
ENSMUSP00000129873  ..............................................................................
ENSMUSP00000120126  dkvpydicrpdhsvltlhlpvtasvrevmaalahedhwtkgqvlvkvnsagdvvglqpdargvatslglnerlfvvdp
ENSMUSP00000124183  ..............................................................................
ENSMUSP00000032811  ..............................................................................
ENSMUSP00000125137  ..............................................................................
ENSMUSP00000103103  syvtirsrlsasvqdilgsvteklqyseepaeredalilvavassgekvllqptedcvfttlginshlfactrdsyea
ENSMUSP00000092200  ..............................................................................
ENSMUSP00000123718  ..............................................................................
ENSMUSP00000041082  ..............................................................................
ENSMUSP00000124908  ..............................................................................
ENSMUSP00000140055  ..............................................................................
ENSMUSP00000140342  ..............................................................................
ENSMUSP00000140230  ..............................................................................
ENSMUSP00000027886  ..............................................................................
ENSMUSP00000139618  ..............................................................................
ENSMUSP00000063872  ..............................................................................
ENSMUSP00000130581  ..............................................................................
ENSMUSP00000139645  ..............................................................................
ENSMUSP00000108790  ..............................................................................
ENSMUSP00000088563  ..............................................................................
ENSMUSP00000132533  ..............................................................................
ENSMUSP00000048451  ..............................................................................
ENSMUSP00000108789  ..............................................................................
ENSMUSP00000135317  ..............................................................................
ENSMUSP00000115747  lphhkerqytiasalpkpcffedf......................................................
ENSMUSP00000050586  lphhkerqytiasalpkpcffedf......................................................
ENSMUSP00000121635  ..............................................................................
ENSMUSP00000039186  ..............................................................................
ENSMUSP00000130604  ..............................................................................
ENSMUSP00000138360  ..............................................................................
ENSMUSP00000138330  ..............................................................................
ENSMUSP00000136756  ..............................................................................
ENSMUSP00000029766  ..............................................................................
ENSMUSP00000139822  ..............................................................................
ENSMUSP00000104523  ..............................................................................
ENSMUSP00000071368  ..............................................................................
ENSMUSP00000120630  ..............................................................................
ENSMUSP00000108868  ..............................................................................
ENSMUSP00000073866  ..............................................................................
ENSMUSP00000031624  ..............................................................................
ENSMUSP00000115092  ..............................................................................
ENSMUSP00000116215  ..............................................................................
ENSMUSP00000073399  ..............................................................................
ENSMUSP00000106227  ..............................................................................
ENSMUSP00000106225  ..............................................................................
ENSMUSP00000106229  ..............................................................................
ENSMUSP00000136434  ..............................................................................
ENSMUSP00000106226  ..............................................................................
ENSMUSP00000076380  ..............................................................................
ENSMUSP00000106241  ..............................................................................
ENSMUSP00000106228  ..............................................................................
ENSMUSP00000134203  ..............................................................................
ENSMUSP00000036997  ..............................................................................
ENSMUSP00000136735  ..............................................................................
ENSMUSP00000123036  ..............................................................................
ENSMUSP00000109099  ..............................................................................
ENSMUSP00000109100  ..............................................................................
ENSMUSP00000109103  ..............................................................................
ENSMUSP00000031501  ..............................................................................
ENSMUSP00000032648  ..............................................................................
ENSMUSP00000109096  ..............................................................................
ENSMUSP00000115401  ..............................................................................
ENSMUSP00000120949  ..............................................................................
ENSMUSP00000134312  ..............................................................................
ENSMUSP00000117681  ..............................................................................


                                                                                                    
                                                                                                    
d1nvus_               ..............................................................................
ENSMUSP00000067786  ..............................................................................
ENSMUSP00000138589  ..............................................................................
ENSMUSP00000044866  ..............................................................................
ENSMUSP00000138793  ..............................................................................
ENSMUSP00000109526  ..............................................................................
ENSMUSP00000028170  ..............................................................................
ENSMUSP00000097812  ..............................................................................
ENSMUSP00000129652  ..............................................................................
ENSMUSP00000031276  ..............................................................................
ENSMUSP00000027760  ..............................................................................
ENSMUSP00000107490  ..............................................................................
ENSMUSP00000107488  ..............................................................................
ENSMUSP00000116892  ..............................................................................
ENSMUSP00000034912  ..............................................................................
ENSMUSP00000096930  ..............................................................................
ENSMUSP00000028525  ..............................................................................
ENSMUSP00000099759  ..............................................................................
ENSMUSP00000088336  ..............................................................................
ENSMUSP00000114119  avdveqviglekvnkkskantvggrnklkkildktrisilpqkpyndigigqsqddsivglrqtkhipaalpvsgtls
ENSMUSP00000113778  avdveqviglekvnkkskantvggrnklkkildktrisilpqkpyndigigqsqddsivglrqtkhipaalpvsgtls
ENSMUSP00000090829  ..............................................................................
ENSMUSP00000065619  ..............................................................................
ENSMUSP00000128947  ..............................................................................
ENSMUSP00000092114  dmeqapqekgnkkikantvsggrnkirkildktrfsilppklfsdgglsqsqddsivgtrhcrhslaimpipgtlsss
ENSMUSP00000104522  dmeqapqekgnkkikantvsggrnkirkildktrfsilppklfsdgglsqsqddsivgtrhcrhslaimpipgtlsss
ENSMUSP00000099804  dmeqapqekgnkkikantvsggrnkirkildktrfsilppklfsdgglsqsqddsivgtrhcrhslaimpipgtlsss
ENSMUSP00000098766  dmeqapqekgnkkikantvsggrnkirkildktrfsilppklfsdgglsqsqddsivgtrhcrhslaimpipgtlsss
ENSMUSP00000105313  ..............................................................................
ENSMUSP00000132244  ..............................................................................
ENSMUSP00000135238  qevheltp......................................................................
ENSMUSP00000116426  qevheltp......................................................................
ENSMUSP00000092828  ..............................................................................
ENSMUSP00000129393  ..............................................................................
ENSMUSP00000099593  ..............................................................................
ENSMUSP00000136423  ..............................................................................
ENSMUSP00000117631  ..............................................................................
ENSMUSP00000099936  ..............................................................................
ENSMUSP00000088680  ..............................................................................
ENSMUSP00000092703  ..............................................................................
ENSMUSP00000035726  ..............................................................................
ENSMUSP00000134167  ..............................................................................
ENSMUSP00000090828  ..............................................................................
ENSMUSP00000134592  ..............................................................................
ENSMUSP00000118148  qevheltp......................................................................
ENSMUSP00000133449  ..............................................................................
ENSMUSP00000134027  ..............................................................................
ENSMUSP00000041135  ..............................................................................
ENSMUSP00000109104  ..............................................................................
ENSMUSP00000129873  ..............................................................................
ENSMUSP00000120126  qevheltp......................................................................
ENSMUSP00000124183  ..............................................................................
ENSMUSP00000032811  ..............................................................................
ENSMUSP00000125137  ..............................................................................
ENSMUSP00000103103  lvp...........................................................................
ENSMUSP00000092200  ..............................................................................
ENSMUSP00000123718  ..............................................................................
ENSMUSP00000041082  ..............................................................................
ENSMUSP00000124908  ..............................................................................
ENSMUSP00000140055  ..............................................................................
ENSMUSP00000140342  ..............................................................................
ENSMUSP00000140230  ..............................................................................
ENSMUSP00000027886  ..............................................................................
ENSMUSP00000139618  ..............................................................................
ENSMUSP00000063872  ..............................................................................
ENSMUSP00000130581  ..............................................................................
ENSMUSP00000139645  ..............................................................................
ENSMUSP00000108790  ..............................................................................
ENSMUSP00000088563  ..............................................................................
ENSMUSP00000132533  ..............................................................................
ENSMUSP00000048451  ..............................................................................
ENSMUSP00000108789  ..............................................................................
ENSMUSP00000135317  ..............................................................................
ENSMUSP00000115747  ..............................................................................
ENSMUSP00000050586  ..............................................................................
ENSMUSP00000121635  ..............................................................................
ENSMUSP00000039186  ..............................................................................
ENSMUSP00000130604  ..............................................................................
ENSMUSP00000138360  ..............................................................................
ENSMUSP00000138330  ..............................................................................
ENSMUSP00000136756  ..............................................................................
ENSMUSP00000029766  ..............................................................................
ENSMUSP00000139822  ..............................................................................
ENSMUSP00000104523  ..............................................................................
ENSMUSP00000071368  ..............................................................................
ENSMUSP00000120630  ..............................................................................
ENSMUSP00000108868  ..............................................................................
ENSMUSP00000073866  ..............................................................................
ENSMUSP00000031624  ..............................................................................
ENSMUSP00000115092  ..............................................................................
ENSMUSP00000116215  ..............................................................................
ENSMUSP00000073399  ..............................................................................
ENSMUSP00000106227  ..............................................................................
ENSMUSP00000106225  ..............................................................................
ENSMUSP00000106229  ..............................................................................
ENSMUSP00000136434  ..............................................................................
ENSMUSP00000106226  ..............................................................................
ENSMUSP00000076380  ..............................................................................
ENSMUSP00000106241  ..............................................................................
ENSMUSP00000106228  ..............................................................................
ENSMUSP00000134203  ..............................................................................
ENSMUSP00000036997  ..............................................................................
ENSMUSP00000136735  ..............................................................................
ENSMUSP00000123036  ..............................................................................
ENSMUSP00000109099  ..............................................................................
ENSMUSP00000109100  ..............................................................................
ENSMUSP00000109103  ..............................................................................
ENSMUSP00000031501  ..............................................................................
ENSMUSP00000032648  ..............................................................................
ENSMUSP00000109096  ..............................................................................
ENSMUSP00000115401  ..............................................................................
ENSMUSP00000120949  ..............................................................................
ENSMUSP00000134312  ..............................................................................
ENSMUSP00000117681  ..............................................................................


                                                                                                    
                                                                                                    
d1nvus_               ..............................................................................
ENSMUSP00000067786  ..............................................................................
ENSMUSP00000138589  ..............................................................................
ENSMUSP00000044866  ..............................................................................
ENSMUSP00000138793  ..............................................................................
ENSMUSP00000109526  ..............................................................................
ENSMUSP00000028170  ..............................................................................
ENSMUSP00000097812  ..............................................................................
ENSMUSP00000129652  ..............................................................................
ENSMUSP00000031276  ..............................................................................
ENSMUSP00000027760  ..............................................................................
ENSMUSP00000107490  ..............................................................................
ENSMUSP00000107488  ..............................................................................
ENSMUSP00000116892  ..............................................................................
ENSMUSP00000034912  ..............................................................................
ENSMUSP00000096930  ..............................................................................
ENSMUSP00000028525  ..............................................................................
ENSMUSP00000099759  ..............................................................................
ENSMUSP00000088336  ..............................................................................
ENSMUSP00000114119  ssnpdllqshhrildfsttpdlpdqvlrvfkadqqsryimiskdttakevviqairefavtatpeqyslcevsvtpeg
ENSMUSP00000113778  ssnpdllqshhrildfsttpdlpdqvlrvfkadqqsryimiskdttakevviqairefavtatpeqyslcevsvtpeg
ENSMUSP00000090829  ..............................................................................
ENSMUSP00000065619  ..............................................................................
ENSMUSP00000128947  ..............................................................................
ENSMUSP00000092114  spdllqpttsmldfsnpsdipdqvirvfkadqqscyiiiskdttakevvcqavqefgltgasdtyslcevsvtpegvi
ENSMUSP00000104522  spdllqpttsmldfsnpsdipdqvirvfkadqqscyiiiskdttakevvcqavqefgltgasdtyslcevsvtpegvi
ENSMUSP00000099804  spdllqpttsmldfsnpsdipdqvirvfkadqqscyiiiskdttakevvcqavqefgltgasdtyslcevsvtpegvi
ENSMUSP00000098766  spdllqpttsmldfsnpsdipdqvirvfkadqqscyiiiskdttakevvcqavqefgltgasdtyslcevsvtpegvi
ENSMUSP00000105313  ..............................................................................
ENSMUSP00000132244  ..............................................................................
ENSMUSP00000135238  ..............................................................................
ENSMUSP00000116426  ..............................................................................
ENSMUSP00000092828  ..............................................................................
ENSMUSP00000129393  ..............................................................................
ENSMUSP00000099593  ..............................................................................
ENSMUSP00000136423  ..............................................................................
ENSMUSP00000117631  ..............................................................................
ENSMUSP00000099936  ..............................................................................
ENSMUSP00000088680  ..............................................................................
ENSMUSP00000092703  ..............................................................................
ENSMUSP00000035726  ..............................................................................
ENSMUSP00000134167  ..............................................................................
ENSMUSP00000090828  ..............................................................................
ENSMUSP00000134592  ..............................................................................
ENSMUSP00000118148  ..............................................................................
ENSMUSP00000133449  ..............................................................................
ENSMUSP00000134027  ..............................................................................
ENSMUSP00000041135  ..............................................................................
ENSMUSP00000109104  ..............................................................................
ENSMUSP00000129873  ..............................................................................
ENSMUSP00000120126  ..............................................................................
ENSMUSP00000124183  ..............................................................................
ENSMUSP00000032811  ..............................................................................
ENSMUSP00000125137  ..............................................................................
ENSMUSP00000103103  ..............................................................................
ENSMUSP00000092200  ..............................................................................
ENSMUSP00000123718  ..............................................................................
ENSMUSP00000041082  ..............................................................................
ENSMUSP00000124908  ..............................................................................
ENSMUSP00000140055  ..............................................................................
ENSMUSP00000140342  ..............................................................................
ENSMUSP00000140230  ..............................................................................
ENSMUSP00000027886  ..............................................................................
ENSMUSP00000139618  ..............................................................................
ENSMUSP00000063872  ..............................................................................
ENSMUSP00000130581  ..............................................................................
ENSMUSP00000139645  ..............................................................................
ENSMUSP00000108790  ..............................................................................
ENSMUSP00000088563  ..............................................................................
ENSMUSP00000132533  ..............................................................................
ENSMUSP00000048451  ..............................................................................
ENSMUSP00000108789  ..............................................................................
ENSMUSP00000135317  ..............................................................................
ENSMUSP00000115747  ..............................................................................
ENSMUSP00000050586  ..............................................................................
ENSMUSP00000121635  ..............................................................................
ENSMUSP00000039186  ..............................................................................
ENSMUSP00000130604  ..............................................................................
ENSMUSP00000138360  ..............................................................................
ENSMUSP00000138330  ..............................................................................
ENSMUSP00000136756  ..............................................................................
ENSMUSP00000029766  ..............................................................................
ENSMUSP00000139822  ..............................................................................
ENSMUSP00000104523  ..............................................................................
ENSMUSP00000071368  ..............................................................................
ENSMUSP00000120630  ..............................................................................
ENSMUSP00000108868  ..............................................................................
ENSMUSP00000073866  ..............................................................................
ENSMUSP00000031624  ..............................................................................
ENSMUSP00000115092  ..............................................................................
ENSMUSP00000116215  ..............................................................................
ENSMUSP00000073399  ..............................................................................
ENSMUSP00000106227  ..............................................................................
ENSMUSP00000106225  ..............................................................................
ENSMUSP00000106229  ..............................................................................
ENSMUSP00000136434  ..............................................................................
ENSMUSP00000106226  ..............................................................................
ENSMUSP00000076380  ..............................................................................
ENSMUSP00000106241  ..............................................................................
ENSMUSP00000106228  ..............................................................................
ENSMUSP00000134203  ..............................................................................
ENSMUSP00000036997  ..............................................................................
ENSMUSP00000136735  ..............................................................................
ENSMUSP00000123036  ..............................................................................
ENSMUSP00000109099  ..............................................................................
ENSMUSP00000109100  ..............................................................................
ENSMUSP00000109103  ..............................................................................
ENSMUSP00000031501  ..............................................................................
ENSMUSP00000032648  ..............................................................................
ENSMUSP00000109096  ..............................................................................
ENSMUSP00000115401  ..............................................................................
ENSMUSP00000120949  ..............................................................................
ENSMUSP00000134312  ..............................................................................
ENSMUSP00000117681  ..............................................................................


                                                            200              210           220      
                                                              |                |             |      
d1nvus_               .....................................EWHISRPGHIET.......FDLLTLH....PIEIARQLTLL
ENSMUSP00000067786  .....................................EWHISRPGHIET.......FDLLTLH....PIEIARQLTLL
ENSMUSP00000138589  .....................................EWHISRTGQFET.......FDLMTLH....PIEIARQLTLL
ENSMUSP00000044866  .....................................EWHISRTGQFET.......FDLMTLH....PIEIARQLTLL
ENSMUSP00000138793  .....................................EWHISRTGQFET.......FDLMTLH....PIEIARQLTLL
ENSMUSP00000109526  .....................................LPEATENGLTEK.......PHLLLFP....PDLVAEQFTLM
ENSMUSP00000028170  .....................................LPEATENGLTEK.......PHLLLFP....PDLVAEQFTLM
ENSMUSP00000097812  .....................................LPEATENGLTEK.......PHLLLFP....PDLVAEQFTLM
ENSMUSP00000129652  .....................................VLKTKPQSIQRD.......IMTVCSD....PYTLAQQLTHI
ENSMUSP00000031276  .....................................VLKTKPQSIQRD.......IMTVCSD....PYTLAQQLTHI
ENSMUSP00000027760  .....................................LEEEEELESGGS.......AEFTNFS....EDLVAEQLTYM
ENSMUSP00000107490  .....................................LEEEEELESGGS.......AEFTNFS....EDLVAEQLTYM
ENSMUSP00000107488  .....................................LEEEEELESGGS.......AEFTNFS....EDLVAEQLTYM
ENSMUSP00000116892  .....................................CPKAEC------.......--FETLS....AMELAEQITLL
ENSMUSP00000034912  .....................................---ILMTEGVKT.......EPFENHP....ALEIAEQLTLL
ENSMUSP00000096930  .....................................CPKAEC------.......--FETLS....AMELAEQITLL
ENSMUSP00000028525  .....................................LPEQEGPTTGTV.......GTFELMS....SKDLAYQMTTY
ENSMUSP00000099759  .....................................LPEQEGPTTGTV.......GTFELMS....SKDLAYQMTTY
ENSMUSP00000088336  .....................................LPEQEGPTTGTV.......GTFELMS....SKDLAYQMTTY
ENSMUSP00000114119  vikqrrlpdqlskladriqlsgryylknnmetetlcsDEDAQELLRESQ.......ISLLQLS....TVEVATQLSMR
ENSMUSP00000113778  vikqrrlpdqlskladriqlsgryylknnmetetlcsDEDAQELLRESQ.......ISLLQLS....TVEVATQLSMR
ENSMUSP00000090829  .....................................--TKPPASIHRE.......LLGVCSD....PYTLAQQLTHV
ENSMUSP00000065619  .....................................--TKPPASIHRE.......LLGVCSD....PYTLAQQLTHV
ENSMUSP00000128947  .....................................VLKTKPQSIQRD.......IMTVCSD....PYTLAQQLTHI
ENSMUSP00000092114  ..kqrrlpdqfskladriqlngryylknnmetetlcsDEDAQELLKESQ.......LSMLQLS....TIEVATQLSMR
ENSMUSP00000104522  ..kqrrlpdqfskladriqlngryylknnmetetlcsDEDAQELLKESQ.......LSMLQLS....TIEVATQLSMR
ENSMUSP00000099804  ..kqrrlpdqfskladriqlngryylknnmetetlcsDEDAQELLKESQ.......LSMLQLS....TIEVATQLSMR
ENSMUSP00000098766  ..kqrrlpdqfskladriqlngryylknnmetetlcsDEDAQELLKESQ.......LSMLQLS....TIEVATQLSMR
ENSMUSP00000105313  .....................................PLAENEESQQRS.......MRILGMN....TWDLALELMSF
ENSMUSP00000132244  .....................................VLKAKPPAAQKD.......ILGVCSD....PLVLAQQLTHI
ENSMUSP00000135238  .....................................HPEQLGPTLGSS.......EMLDLVS....AKDLAGQLTDH
ENSMUSP00000116426  .....................................HPEQLGPTLGSS.......EMLDLVS....AKDLAGQLTDH
ENSMUSP00000092828  .....................................DWMRRVTQRKKVskrgkacLLFDHLE....PIELAEHLTFL
ENSMUSP00000129393  .....................................DWMRRVTQRKKVskrgkacLLFDHLE....PIELAEHLTFL
ENSMUSP00000099593  .....................................------KKRKVS.......LLFDHLE....PEELSEHLTYL
ENSMUSP00000136423  .....................................------KKRKVS.......LLFDHLE....PEELSEHLTYL
ENSMUSP00000117631  .....................................QPLAARGVAARP.......GTLHDFH....SHEIAEQLTLL
ENSMUSP00000099936  .....................................QPLAARGVAARP.......GTLHDFH....SHEIAEQLTLL
ENSMUSP00000088680  .....................................QPLAARGVAARP.......GTLHDFH....SHEIAEQLTLL
ENSMUSP00000092703  .....................................QPLAARGVAARP.......GTLHDFH....SHEIAEQLTLL
ENSMUSP00000035726  .....................................DCVEEEGPSSEG.......PELLDFS....VDDVAEQLTLM
ENSMUSP00000134167  .....................................------KKRKVS.......LLFDHLE....PEELSEHLTYL
ENSMUSP00000090828  .....................................--TKPPASIHRE.......LLGVCSD....PYTLAQQLTHV
ENSMUSP00000134592  .....................................------KKRKVS.......LLFDHLE....PEELSEHLTYL
ENSMUSP00000118148  .....................................HPEQLGPTLGSS.......EMLDLVS....AKDLAGQLTDH
ENSMUSP00000133449  .....................................------KKRKVS.......LLFDHLE....PEELSEHLTYL
ENSMUSP00000134027  .....................................------KKRKVS.......LLFDHLE....PEELSEHLTYL
ENSMUSP00000041135  .....................................---VEQKKRKMS.......LLFDHLE....PMELAEHLTYL
ENSMUSP00000109104  .....................................---VEQKKRKMS.......LLFDHLE....PMELAEHLTYL
ENSMUSP00000129873  .....................................---VEQKKRKMS.......LLFDHLE....PMELAEHLTYL
ENSMUSP00000120126  .....................................HPEQLGPTLGSS.......EMLDLVS....AKDLAGQLTDH
ENSMUSP00000124183  .....................................SPGLGKK-RKVS.......LLFDHLE....TEELAQHLTYL
ENSMUSP00000032811  .....................................SPGLGKK-RKVS.......LLFDHLE....TEELAQHLTYL
ENSMUSP00000125137  .....................................SPGLGKK-RKVS.......LLFDHLE....TEELAQHLTYL
ENSMUSP00000103103  .....................................LPEEVQVSPGD-.......TEIHRVE....PEDVANHLTAF
ENSMUSP00000092200  .....................................SPGLGKK-RKVS.......LLFDHLE....TEELAQHLTYL
ENSMUSP00000123718  .....................................LP-GLGKKRKVS.......LLFDHLE....TEELAQHLTYL
ENSMUSP00000041082  .....................................-----------P.......TDVLVFL....ADHLAEQLTLL
ENSMUSP00000124908  .....................................SPGLGKK-RKVS.......LLFDHLE....TEELAQHLTYL
ENSMUSP00000140055  .....................................GSELKKSFDAVV.......FDVLKVT....PEEYAGQITLM
ENSMUSP00000140342  .....................................GSELKKSFDAVV.......FDVLKVT....PEEYAGQITLM
ENSMUSP00000140230  .....................................GSELKKSFDAVV.......FDVLKVT....PEEYAGQITLM
ENSMUSP00000027886  .....................................GSELKKSFDAVV.......FDVLKVT....PEEYAGQITLM
ENSMUSP00000139618  .....................................GSELKKSFDAVV.......FDVLKVT....PEEYAGQITLM
ENSMUSP00000063872  .....................................GSELKKSFDAVV.......FDVLKVT....PEEYAGQITLM
ENSMUSP00000130581  .....................................GSELKKSFDAVV.......FDVLKVT....PEEYAGQITLM
ENSMUSP00000139645  .....................................GSELKKSFDAVV.......FDVLKVT....PEEYAGQITLM
ENSMUSP00000108790  .....................................CDYASKSYDAVV.......FDVLKVT....PEEFASQITLM
ENSMUSP00000088563  .....................................CDYASKSYDAVV.......FDVLKVT....PEEFASQITLM
ENSMUSP00000132533  .....................................------------.......-------....------QITLM
ENSMUSP00000048451  .....................................CDYASKSYDAVV.......FDVLKVT....PEEFA------
ENSMUSP00000108789  .....................................CDYASKSYDAVV.......FDVLKVT....PEEFASQITLM
ENSMUSP00000135317  .....................................------------.......-------....-----------
ENSMUSP00000115747  .....................................YGPYAKASEKGP.......YFLTEYS....TNQLFTQLTLL
ENSMUSP00000050586  .....................................YGPYAKASEKGP.......YFLTEYS....TNQLFTQLTLL
ENSMUSP00000121635  .....................................---VEQKKRKMS.......LLFDHLE....PMELAEHLTYL
ENSMUSP00000039186  .....................................YPE---------.......-------....-----------
ENSMUSP00000130604  .....................................--------GISK.......ELIDLQPliqfPEEVASILTEQ
ENSMUSP00000138360  .....................................--------GISK.......ELIDLQPliqfPEEVASILTEQ
ENSMUSP00000138330  .....................................--------GISK.......ELIDLQPliqfPEEVASILTEQ
ENSMUSP00000136756  .....................................DPE---------.......-------....-----------
ENSMUSP00000029766  .....................................KPLETAMLKHAK.......ELFTNHD....ARVIAQHMLSV
ENSMUSP00000139822  .....................................GSELKKSFDAVV.......FDVLKVT....PEEYAGQITLM
ENSMUSP00000104523  .....................................------------.......-------....-----------
ENSMUSP00000071368  .....................................------------.......-------....-----------
ENSMUSP00000120630  .....................................---VEQKKRKMS.......LLFDHLE....PMELAEHLTY-
ENSMUSP00000108868  .....................................RPLEVALLRKVK.......ELLSEVD....ARTLARHVTKV
ENSMUSP00000073866  .....................................--LEVALLRKVK.......ELLSEVD....ARTLARHVTKV
ENSMUSP00000031624  .....................................------------.......-------....-----------
ENSMUSP00000115092  .....................................------------.......-------....-----------
ENSMUSP00000116215  .....................................------------.......-------....-----------
ENSMUSP00000073399  .....................................------------.......-------....-----------
ENSMUSP00000106227  .....................................------------.......-------....-----------
ENSMUSP00000106225  .....................................------------.......-------....-----------
ENSMUSP00000106229  .....................................------------.......-------....-----------
ENSMUSP00000136434  .....................................------------.......-------....-----------
ENSMUSP00000106226  .....................................------------.......-------....-----------
ENSMUSP00000076380  .....................................------------.......-------....-----------
ENSMUSP00000106241  .....................................------------.......-------....-----------
ENSMUSP00000106228  .....................................------------.......-------....-----------
ENSMUSP00000134203  .....................................------------.......-------....-----------
ENSMUSP00000036997  .....................................------------.......-------....-----------
ENSMUSP00000136735  .....................................------------.......-------....-----------
ENSMUSP00000123036  .....................................------------.......-------....-----------
ENSMUSP00000109099  .....................................------------.......-------....-----------
ENSMUSP00000109100  .....................................------------.......-------....-----------
ENSMUSP00000109103  .....................................------------.......-------....-----------
ENSMUSP00000031501  .....................................------------.......-------....-----------
ENSMUSP00000032648  .....................................------------.......-------....-----------
ENSMUSP00000109096  .....................................------------.......-------....-----------
ENSMUSP00000115401  .....................................------------.......-------....-----------
ENSMUSP00000120949  .....................................------------.......-------....-----------
ENSMUSP00000134312  .....................................------------.......-------....-----------
ENSMUSP00000117681  .....................................------------.......-------....-----------


                       230       240                                 250                            
                         |         |                                   |                            
d1nvus_               ESDLYRAVQPSELVGS..............VWT...KE.........DKE......................IN.SPN
ENSMUSP00000067786  ESDLYRAVQPSELVGS..............VWT...KE.........DKE......................IN.SPN
ENSMUSP00000138589  ESDLYRKVQPSELVGS..............VWT...KE.........DKE......................IN.SPN
ENSMUSP00000044866  ESDLYRKVQPSELVGS..............VWT...KE.........DKE......................IN.SPN
ENSMUSP00000138793  ESDLYRKVQPSELVGS..............VWT...KE.........DKE......................IN.SPN
ENSMUSP00000109526  DAELFKKVVPYHCLGS..............IWSqrdKK.........GKE......................HL.APT
ENSMUSP00000028170  DAELFKKVVPYHCLGS..............IWSqrdKK.........GKE......................HL.APT
ENSMUSP00000097812  DAELFKKVVPYHCLGS..............IWSqrdKK.........GKE......................HL.APT
ENSMUSP00000129652  ELERLNYIGPEEFVQA..............FVQ...KDpldndkscySER......................KK.TRN
ENSMUSP00000031276  ELERLNYIGPEEFVQA..............FVQ...KDpldndkscySER......................KK.TRN
ENSMUSP00000027760  DAQLFKKVVPHHCLGC..............IWSqrdKK.........ENK......................HL.APT
ENSMUSP00000107490  DAQLFKKVVPHHCLGC..............IWSqrdKK.........ENK......................HL.APT
ENSMUSP00000107488  DAQLFKKVVPHHCLGC..............IWSqrdKK.........ENK......................HL.APT
ENSMUSP00000116892  DHIVFRSIPYEEFLGQ..............GWM...KL.........DKN......................ER.TPY
ENSMUSP00000034912  DHLVFKSIPYEEFFGQ..............GWM...KA.........EKY......................ER.TPY
ENSMUSP00000096930  DHIVFRSIPYEEFLGQ..............GWM...KL.........DKN......................ER.TPY
ENSMUSP00000028525  DWELFNCVHELELIYH..............TFG...RH.........NFK......................KT.TAN
ENSMUSP00000099759  DWELFNCVHELELIYH..............TFG...RH.........NFK......................KT.TAN
ENSMUSP00000088336  DWELFNCVHELELIYH..............TFG...RH.........NFK......................KT.TAN
ENSMUSP00000114119  NFELFRNIEPTEYIDD..............LF-...KL.........KSK......................TS.CAN
ENSMUSP00000113778  NFELFRNIEPTEYIDD..............LF-...KL.........KSK......................TS.CAN
ENSMUSP00000090829  ELERLRHIGPEEFVQA..............FVN...KDplagtkp..RFS......................DK.TNN
ENSMUSP00000065619  ELERLRHIGPEEFVQA..............FVN...KDplagtkp..RFS......................DK.TNN
ENSMUSP00000128947  ELERLNYIGPEEFVQA..............FVQ...KDpldndkscySER......................KK.TRN
ENSMUSP00000092114  DFDLFRNIEPTEYIDD..............LF-...KL.........DSK......................TG.NTH
ENSMUSP00000104522  DFDLFRNIEPTEYIDD..............LF-...KL.........DSK......................TG.NTH
ENSMUSP00000099804  DFDLFRNIEPTEYIDD..............LF-...KL.........DSK......................TG.NTH
ENSMUSP00000098766  DFDLFRNIEPTEYIDD..............LF-...KL.........DSK......................TG.NTH
ENSMUSP00000105313  DWSLFNSIHEQELIYF..............TFS...RQ.........GNG......................EN.TVN
ENSMUSP00000132244  ELERVNSIRPEDLMQI..............ISH...MDsldnhrcr.GDM......................TK.TFS
ENSMUSP00000135238  DWNLFNRIHQVELIHY..............VLG...PQ.........HLR......................DVtTAN
ENSMUSP00000116426  DWNLFNRIHQVELIHY..............VLG...PQ.........HLR......................DVtTAN
ENSMUSP00000092828  EHKSFRRISFTDYQSY..............VI-...-H.........GCL......................EN.NPT
ENSMUSP00000129393  EHKSFRRISFTDYQSY..............VI-...-H.........GCL......................EN.NPT
ENSMUSP00000099593  EFKSFRRISFSDYQNY..............LV-...-N.........SCV......................KE.NPT
ENSMUSP00000136423  EFKSFRRISFSDYQNY..............LV-...-N.........SCV......................KE.NPT
ENSMUSP00000117631  DAELFYKIEIPEVL--..............LWA...KE.........QNE......................EK.SPN
ENSMUSP00000099936  DAELFYKIEIPEVL--..............LWA...KE.........QNE......................EK.SPN
ENSMUSP00000088680  DAELFYKIEIPEVL--..............LWA...KE.........QNE......................EK.SPN
ENSMUSP00000092703  DAELFYKIEIPEVL--..............LWA...KE.........QNE......................EK.SPN
ENSMUSP00000035726  DVELFLRVRSCECLGS..............MWS...QR.........DRPgaa...................GI.SPT
ENSMUSP00000134167  EFKSFRRISFSDYQNY..............LV-...-N.........SCV......................KE.NPT
ENSMUSP00000090828  ELERLRHIGPEEFVQA..............FVN...KDplagtkp..RFS......................DK.TNN
ENSMUSP00000134592  EFKSFRRISFSDYQNY..............LV-...-N.........SCV......................KE.NPT
ENSMUSP00000118148  DWNLFNRIHQVQEH--..............---...--.........-LR......................DVtTAN
ENSMUSP00000133449  EFKSFRRISFSDYQNY..............LV-...-N.........SCV......................KE.NPT
ENSMUSP00000134027  EFKSFRRISFSDYQNY..............LV-...-N.........SCV......................KE.NPT
ENSMUSP00000041135  EYRSFCKILFQDYHSF..............VT-...-H.........GCT......................VD.NPV
ENSMUSP00000109104  EYRSFCKILFQDYHSF..............VT-...-H.........GCT......................VD.NPV
ENSMUSP00000129873  EYRSFCKILFQDYHSF..............VT-...-H.........GCT......................VD.NPV
ENSMUSP00000120126  DWNLFNRIHQVELIHY..............VLG...PQ.........HLR......................DVtTAN
ENSMUSP00000124183  EFRSFQAITPQDLRGY..............VL-...-Q.........GSV......................RG.CPA
ENSMUSP00000032811  EFRSFQAITPQDLRGY..............VL-...-Q.........GSV......................RG.CPA
ENSMUSP00000125137  EFRSFQAITPQDLRGY..............VL-...-Q.........GSV......................RG.CPA
ENSMUSP00000103103  HWELFRCVHELEFVDY..............VFH...GE.........RGR......................RE.TAN
ENSMUSP00000092200  EFRSFQAITPQDLRGY..............VL-...-Q.........GSV......................RG.CPA
ENSMUSP00000123718  EFRSFQAITPQDLRGY..............VL-...-Q.........GSV......................RG.CPA
ENSMUSP00000041082  DAELFLNLIPSQCLGG..............LWGhrdRP.........GHS......................HL.CPS
ENSMUSP00000124908  EFRSFQAI--------..............---...-T.........GSV......................RG.CPA
ENSMUSP00000140055  DVPVFKAIQPDELSSC..............GWN...KK.........EKY......................SS.APN
ENSMUSP00000140342  DVPVFKAIQPDELSSC..............GWN...KK.........EKY......................SS.APN
ENSMUSP00000140230  DVPVFKAIQPDELSSC..............GWN...KK.........EKY......................SS.APN
ENSMUSP00000027886  DVPVFKAIQPDELSSC..............GWN...KK.........EKY......................SS.APN
ENSMUSP00000139618  DVPVFKAIQPDELSSC..............GWN...KK.........EKY......................SS.APN
ENSMUSP00000063872  DVPVFKAIQPDELSSC..............GWN...KK.........EKY......................SS.APN
ENSMUSP00000130581  DVPVFKAIQPDELSSC..............GWN...KK.........EKY......................SS.APN
ENSMUSP00000139645  DVPVFKAIQPDELSSC..............GWN...KK.........EKY......................SS.APN
ENSMUSP00000108790  DIPVFKAIQPEELASC..............GWS...KK.........EKH......................SL.APN
ENSMUSP00000088563  DIPVFKAIQPEELASC..............GWS...KK.........EKH......................SL.APN
ENSMUSP00000132533  DVPVFKAIQPDELSSC..............GWN...KK.........EKY......................SS.APN
ENSMUSP00000048451  -----------ELASC..............GWS...KK.........EKH......................SL.APN
ENSMUSP00000108789  DIPVFKAIQPEELASC..............GWS...KK.........EKH......................SL.APN
ENSMUSP00000135317  ----------------..............---...--.........---......................--.---
ENSMUSP00000115747  QQELFQKCHPVHFLNSralgvmdksaaipkA--...--.........--Ssseslsaktcslflpny.....VQ.DKY
ENSMUSP00000050586  QQELFQKCHPVHFLNSralgvmdksaaipkA--...--.........--Ssseslsaktcslflpny.....VQ.DKY
ENSMUSP00000121635  EYRSFCKILFQDYHSF..............VT-...-H.........GCT......................VD.NPV
ENSMUSP00000039186  ----------------..............---...--.........---......................--.---
ENSMUSP00000130604  EQNIYRRVLPMDYLCF..............LTR...DL.........SSPecqrslprlkasisesiltsqsGE.HNA
ENSMUSP00000138360  EQNIYRRVLPMDYLCF..............LTR...DL.........SSPecqrslprlkasisesiltsqsGE.HNA
ENSMUSP00000138330  EQNIYRRVLPMDYLCF..............LTR...DL.........SSPecqrslprlkasisesiltsqsGE.HNA
ENSMUSP00000136756  ----------------..............---...--.........---......................--.---
ENSMUSP00000029766  DCKVARILEVSEDR--..............---...-K.........RSM......................GV.SSG
ENSMUSP00000139822  DVPVFKAIQPDELSSC..............GWN...KK.........EKY......................SS.APN
ENSMUSP00000104523  ----------------..............---...--.........---......................--.---
ENSMUSP00000071368  ----------------..............---...--.........---......................--.---
ENSMUSP00000120630  ----------------..............---...--.........---......................--.---
ENSMUSP00000108868  DCLVARILGVTKEMQT..............LMG...VRwgmell...TLP......................HG.RQL
ENSMUSP00000073866  DCLVARILGVTKEMQT..............LMG...VRwgmell...TLP......................HG.RQL
ENSMUSP00000031624  ----------------..............---...--.........---......................--.---
ENSMUSP00000115092  ----------------..............---...--.........---......................--.---
ENSMUSP00000116215  ----------------..............---...--.........---......................--.---
ENSMUSP00000073399  ----------------..............---...--.........---......................--.---
ENSMUSP00000106227  ----------------..............---...--.........---......................--.---
ENSMUSP00000106225  ----------------..............---...--.........---......................--.---
ENSMUSP00000106229  ----------------..............---...--.........---......................--.---
ENSMUSP00000136434  ----------------..............---...--.........---......................--.---
ENSMUSP00000106226  ----------------..............---...--.........---......................--.---
ENSMUSP00000076380  ----------------..............---...--.........---......................--.---
ENSMUSP00000106241  ----------------..............---...--.........---......................--.---
ENSMUSP00000106228  ----------------..............---...--.........---......................--.---
ENSMUSP00000134203  ----------------..............---...--.........---......................--.---
ENSMUSP00000036997  ----------------..............---...--.........---......................--.---
ENSMUSP00000136735  ----------------..............---...--.........---......................--.---
ENSMUSP00000123036  ----------------..............---...--.........---......................--.---
ENSMUSP00000109099  ----------------..............---...--.........---......................--.---
ENSMUSP00000109100  ----------------..............---...--.........---......................--.---
ENSMUSP00000109103  ----------------..............---...--.........---......................--.---
ENSMUSP00000031501  ----------------..............---...--.........---......................--.---
ENSMUSP00000032648  ----------------..............---...--.........---......................--.---
ENSMUSP00000109096  ----------------..............---...--.........---......................--.---
ENSMUSP00000115401  ----------------..............---...--.........---......................--.---
ENSMUSP00000120949  ----------------..............---...--.........---......................--.---
ENSMUSP00000134312  ----------------..............---...--.........---......................--.---
ENSMUSP00000117681  ----------------..............---...--.........---......................--.---


                                    260       270                       280       290        300    
                                      |         |                         |         |          |    
d1nvus_               LL............KMIRHTTNLTLWFEKCIVETE..N..............LEERVAVVSRIIEILQVFQE.LNNFN
ENSMUSP00000067786  LL............KMIRHTTNLTLWFEKCIVETE..N..............LEERVAVVSRIIEILQVFQE.LNNFN
ENSMUSP00000138589  LL............KMIRHTTNLTLWFEKCIVEAE..N..............FEERVAVLSRIVEILQVFQD.LNNFN
ENSMUSP00000044866  LL............KMIRHTTNLTLWFEKCIVEAE..N..............FEERVAVLSRIVEILQVFQD.LNNFN
ENSMUSP00000138793  LL............KMIRHTTNLTLWFEKCIVEAE..N..............FEERVAVLSRIVEILQVFQD.LNNFN
ENSMUSP00000109526  IR............ATVAQFNNVANCVITTCLGDQsmK..............APDRARVVEHWIEVARECRA.LKNFS
ENSMUSP00000028170  IR............ATVAQFNNVANCVITTCLGDQsmK..............APDRARVVEHWIEVARECRA.LKNFS
ENSMUSP00000097812  IR............ATVAQFNNVANCVITTCLGDQsmK..............APDRARVVEHWIEVARECRA.LKNFS
ENSMUSP00000129652  LE............AYVEWFNRLSYLVATEICMPV..K..............KKHRARMIEYFIDVARECFN.IGNFN
ENSMUSP00000031276  LE............AYVEWFNRLSYLVATEICMPV..K..............KKHRARMIEYFIDVARECFN.IGNFN
ENSMUSP00000027760  IR............ATISQFNTLTKCVVSTVLGSKelK..............TQQRARVIEKWINIAHECRI.LKNFS
ENSMUSP00000107490  IR............ATISQFNTLTKCVVSTVLGSKelK..............TQQRARVIEKWINIAHECRI.LKNFS
ENSMUSP00000107488  IR............ATISQFNTLTKCVVSTVLGSKelK..............TQQRARVIEKWINIAHECRI.LKNFS
ENSMUSP00000116892  IM............KTSQHFNEMSNLVASQIMNYA..D..............ISSRANAIEKWVAVADICRC.LHNYN
ENSMUSP00000034912  IM............KTTKHFNHVSNFIASEIIRNE..D..............ISARASAIEKWVAVADICRC.LHNYN
ENSMUSP00000096930  IM............KTSQHFNEMSNLVASQIMNYA..D..............ISSRANAIEKWVAVADICRC.LHNYN
ENSMUSP00000028525  LD............LFLRRFNEIQFWVVTEVCLCS..Q..............LSKRVQLLKKFIKIAAHCKE.YKNLN
ENSMUSP00000099759  LD............LFLRRFNEIQFWVVTEVCLCS..Q..............LSKRVQLLKKFIKIAAHCKE.YKNLN
ENSMUSP00000088336  LD............LFLRRFNEIQFWVVTEVCLCS..Q..............LSKRVQLLKKFIKIAAHCKE.YKNLN
ENSMUSP00000114119  LK............KFEEVINQETFWVASEILRET..N..............QLKRMKIIKHFIKIALHCRE.CKNFN
ENSMUSP00000113778  LK............KFEEVINQETFWVASEILRET..N..............QLKRMKIIKHFIKIALHCRE.CKNFN
ENSMUSP00000090829  VE............AYVKWFNRLCYLVATEICMPA..K..............KKQRAQVIEFFIDVARECFN.IGNFN
ENSMUSP00000065619  VE............AYVKWFNRLCYLVATEICMPA..K..............KKQRAQVIEFFIDVARECFN.IGNFN
ENSMUSP00000128947  LE............AYVEWFNRLSYLVATEICMPV..K..............KKHRARMIEYFIDVARECFN.IGNFN
ENSMUSP00000092114  LK............QFEDIVNQETFWVASEILSES..N..............QLKRMKIIKHFIKIALHCRE.CKNFN
ENSMUSP00000104522  LK............QFEDIVNQETFWVASEILSES..N..............QLKRMKIIKHFIKIALHCRE.CKNFN
ENSMUSP00000099804  LK............QFEDIVNQETFWVASEILSES..N..............QLKRMKIIKHFIKIALHCRE.CKNFN
ENSMUSP00000098766  LK............QFEDIVNQETFWVASEILSES..N..............QLKRMKIIKHFIKIALHCRE.CKNFN
ENSMUSP00000105313  LS............LLLQRCNEVQLWVATEILLCS..Q..............LGKRVQLVKKFIKIAAHCKA.QQNLN
ENSMUSP00000132244  LE............AYDNWFNCLSMLVATEVCRVV..K..............KKHRTRMLEFFIDVARECFN.IGNFN
ENSMUSP00000135238  LE............RFMRRFNELQYWVATELCLCP..V..............PGSRAQLLRKFIKLAAHLKE.QKNLN
ENSMUSP00000116426  LE............RFMRRFNELQYWVATELCLCP..V..............PGSRAQLLRKFIKLAAHLKE.QKNLN
ENSMUSP00000092828  LE............RSIALFNGISKWVQLMVLSKP..S..............AQQRAEVITKFINVAQKLLQ.LKNFN
ENSMUSP00000129393  LE............RSIALFNGISKWVQLMVLSKP..S..............AQQRAEVITKFINVAQKLLQ.LKNFN
ENSMUSP00000099593  ME............RSIALCNGISQWVQLMVLSRP..T..............PQLRAEVFIKFIHVAQKLHQ.LQNFN
ENSMUSP00000136423  ME............RSIALCNGISQWVQLMVLSRP..T..............PQLRAEVFIKFIHVAQKLHQ.LQNFN
ENSMUSP00000117631  LT............QFTEHFNNMSYWVRSIIMLQE..K..............AQDRERLLLKFIKIMKHLRK.LNNFN
ENSMUSP00000099936  LT............QFTEHFNNMSYWVRSIIMLQE..K..............AQDRERLLLKFIKIMKHLRK.LNNFN
ENSMUSP00000088680  LT............QFTEHFNNMSYWVRSIIMLQE..K..............AQDRERLLLKFIKIMKHLRK.LNNFN
ENSMUSP00000092703  LT............QFTEHFNNMSYWVRSIIMLQE..K..............AQDRERLLLKFIKIMKHLRK.LNNFN
ENSMUSP00000035726  VR............ATVAQFNTVTGCVLGSVLAAPglA..............ASQRAQRIEKWIRIAQRCRE.LRNFS
ENSMUSP00000134167  ME............RSIALCNGISQWVQLMVLSRP..T..............PQLRAEVFIKFIHVAQKLHQ.LQNFN
ENSMUSP00000090828  VE............AYVKWFNRLCYLVATEICMPA..K..............KKQRAQVIEFFIDVARECFN.IGNFN
ENSMUSP00000134592  ME............RSIALCNGISQWVQLMVLSRP..T..............PQLRAEVFIKFIHVAQKLHQ.LQNFN
ENSMUSP00000118148  LE............RFMRRFNELQYWVATELCLCP..V..............PGSRAQLLRKFIKLAAHLKE.QKNLN
ENSMUSP00000133449  ME............RSIALCNGISQWVQLMVLSRP..T..............PQLRAEVFIKFIHVAQKLHQ.LQNFN
ENSMUSP00000134027  ME............RSIALCNGISQWVQLMVLSRP..T..............PQLRAEVFIKFIHVAQKLHQ.LQNFN
ENSMUSP00000041135  LE............RFISLFNSVSQWVQLMILSKP..T..............ATQRALVITHFVHVAERLLQ.LQNFN
ENSMUSP00000109104  LE............RFISLFNSVSQWVQLMILSKP..T..............ATQRALVITHFVHVAERLLQ.LQNFN
ENSMUSP00000129873  LE............RFISLFNSVSQWVQLMILSKP..T..............ATQRALVITHFVHVAERLLQ.LQNFN
ENSMUSP00000120126  LE............RFMRRFNELQYWVATELCLCP..V..............PGSRAQLLRKFIKLAAHLKE.QKNLN
ENSMUSP00000124183  LE............GSVGLSNSVSRWVQVMVLSRP..G..............PAQRAQVLDKFIRVAQRLHQ.LQNFN
ENSMUSP00000032811  LE............GSVGLSNSVSRWVQVMVLSRP..G..............PAQRAQVLDKFIRVAQRLHQ.LQNFN
ENSMUSP00000125137  LE............GSVGLSNSVSRWVQVMVLSRP..G..............PAQRAQVLDKFIRVAQRLHQ.LQNFN
ENSMUSP00000103103  LE............LLLQRCSEVTHWVATEVLLCE..A..............PGKRVQLLKKFIKIAAICKQ.NQDLL
ENSMUSP00000092200  LE............GSVGLSNSVSRWVQVMVLSRP..G..............PAQRAQVLDKFIRVAQRLHQ.LQNFN
ENSMUSP00000123718  LE............GSVGLSNSVSRWVQVMVLSRP..G..............PAQRAQVLDKFIRVAQRLHQ.LQNFN
ENSMUSP00000041082  VR............ATVTQFNKVAGAVVSSVLGAT..SigegprevtvrplrPPQRARLLEKWIRVAEECRL.LRNFS
ENSMUSP00000124908  LE............GSVGLSNSVSRWVQVMVLSRP..G..............PAQRAQVLDKFIRVAQRLHQ.LQNFN
ENSMUSP00000140055  AV............AFTRRFNHVSFWVVREILHAQ..T..............LKIRAEVLSHYIKTAKKLYE.LNNLH
ENSMUSP00000140342  AV............AFTRRFNHVSFWVVREILHAQ..T..............LKIRAEVLSHYIKTAKKLYE.LNNLH
ENSMUSP00000140230  AV............AFTRRFNHVSFWVVREILHAQ..T..............LKIRAEVLSHYIKTAKKLYE.LNNLH
ENSMUSP00000027886  AV............AFTRRFNHVSFWVVREILHAQ..T..............LKIRAEVLSHYIKTAKKLYE.LNNLH
ENSMUSP00000139618  AV............AFTRRFNHVSFWVVREILHAQ..T..............LKIRAEVLSHYIKTAKKLYE.LNNLH
ENSMUSP00000063872  AV............AFTRRFNHVSFWVVREILHAQ..T..............LKIRAEVLSHYIKTAKKLYE.LNNLH
ENSMUSP00000130581  AV............AFTRRFNHVSFWVVREILHAQ..T..............LKIRAEVLSHYIKTAKKLYE.LNNLH
ENSMUSP00000139645  AV............AFTRRFNHVSFWVVREILHAQ..T..............LKIRAEVLSHYIKTAKKLYE.LNNLH
ENSMUSP00000108790  VV............AFTRRFNQVSFWVVREILTAQ..T..............LKIRAEILSHFVKIAKKLLE.LNNLH
ENSMUSP00000088563  VV............AFTRRFNQVSFWVVREILTAQ..T..............LKIRAEILSHFVKIAKKLLE.LNNLH
ENSMUSP00000132533  AV............AFTRRFNHVSFWVVREILHAQ..T..............LKIRAEVLSHYIKTAKKLYE.LNNLH
ENSMUSP00000048451  VV............AFTRRFNQVSFWVVREILTAQ..T..............LKIRAEILSHFVKIAKKLLE.LNNLH
ENSMUSP00000108789  VV............AFTRRFNQVSFWVVREILTAQ..T..............LKIRAEILSHFVKIAKKLLE.LNNLH
ENSMUSP00000135317  --............---RRFNELQYWVATELCLCP..V..............PGSRAQLLRKFIKLAAHLKE.QKNLN
ENSMUSP00000115747  LL............QLLRNADDVSTWVAAEIVTSH..T..............SKLQVNLLSKFLLIAKSCYE.QRNFA
ENSMUSP00000050586  LL............QLLRNADDVSTWVAAEIVTSH..T..............SKLQVNLLSKFLLIAKSCYE.QRNFA
ENSMUSP00000121635  LE............RFISLFNSVSQWVQLMILSKP..T..............ATQRALVITHFVHVA-----.-----
ENSMUSP00000039186  --............---------------------..-..............--------------------.-----
ENSMUSP00000130604  LE............DLVMRFNEVSSWVTWLILTAG..S..............MEEKREVFSYLVHVAKCCWN.MGNYN
ENSMUSP00000138360  LE............DLVMRFNEVSSWVTWLILTAG..S..............MEEKREVFSYLVHVAKCCWN.MGNYN
ENSMUSP00000138330  LE............DLVMRFNEVSSWVTWLILTAG..S..............MEEKREVFSYLVHVAKCCWN.MGNYN
ENSMUSP00000136756  --............---------------------..-..............--------------------.-----
ENSMUSP00000029766  LElitlphgrqlrlDIIERHNTMAIGIAVDILGCTg.T..............LENRAGTLNKIIQVAVELKDaMGDLY
ENSMUSP00000139822  AV............AFTRRFNHVSFWVVREILHAQ..T..............LKIRAEVLSHYIKTA-----.-----
ENSMUSP00000104523  --............---------------------..-..............--------------------.-----
ENSMUSP00000071368  --............---------------------..-..............--------------------.-----
ENSMUSP00000120630  --............---------------------..-..............--------------------.-----
ENSMUSP00000108868  RL............DLLERFHTMSIMLAVDILGCTg.S..............AEERAALLHKTIQLAAELRGtMGNMF
ENSMUSP00000073866  RL............DLLERFHTMSIMLAVDILGCTg.S..............AEERAALLHKTIQLAAELRGtMGNMF
ENSMUSP00000031624  --............---------------------..-..............--------------------.-----
ENSMUSP00000115092  --............---------------------..-..............--------------------.-----
ENSMUSP00000116215  --............---------------------..-..............--------------------.-----
ENSMUSP00000073399  --............---------------------..-..............--------------------.-----
ENSMUSP00000106227  --............---------------------..-..............--------------------.-----
ENSMUSP00000106225  --............---------------------..-..............--------------------.-----
ENSMUSP00000106229  --............---------------------..-..............--------------------.-----
ENSMUSP00000136434  --............---------------------..-..............--------------------.-----
ENSMUSP00000106226  --............---------------------..-..............--------------------.-----
ENSMUSP00000076380  --............---------------------..-..............--------------------.-----
ENSMUSP00000106241  --............---------------------..-..............--------------------.-----
ENSMUSP00000106228  --............---------------------..-..............--------------------.-----
ENSMUSP00000134203  --............---------------------..-..............--------------------.-----
ENSMUSP00000036997  --............---------------------..-..............--------------------.-----
ENSMUSP00000136735  --............---------------------..-..............--------------------.-----
ENSMUSP00000123036  --............---------------------..-..............--------------------.-----
ENSMUSP00000109099  --............---------------------..-..............--------------------.-----
ENSMUSP00000109100  --............---------------------..-..............--------------------.-----
ENSMUSP00000109103  --............---------------------..-..............--------------------.-----
ENSMUSP00000031501  --............---------------------..-..............--------------------.-----
ENSMUSP00000032648  --............---------------------..-..............--------------------.-----
ENSMUSP00000109096  --............---------------------..-..............--------------------.-----
ENSMUSP00000115401  --............---------------------..-..............--------------------.-----
ENSMUSP00000120949  --............---------------------..-..............--------------------.-----
ENSMUSP00000134312  --............---------------------..-..............--------------------.-----
ENSMUSP00000117681  --............---------------------..-..............--------------------.-----


                         310       320       330       340          350                             
                           |         |         |         |            |                             
d1nvus_               GVLEVVSAMNSSPVYRLDHTFEQIPSRQKKILEEAHELS.E..DHYKKYLAKL.........................
ENSMUSP00000067786  GVLEVVSAMNSSPVYRLDHTFEQIPSRQKKILEEAHELS.E..DHYKKYLAKL.........................
ENSMUSP00000138589  GVLEIVSAVNSVSVYRLDHTFEALQERKRRILDDAVELS.Q..DHFKKYLVKL.........................
ENSMUSP00000044866  GVLEIVSAVNSVSVYRLDHTFEALQERKRRILDDAVELS.Q..DHFKKYLVKL.........................
ENSMUSP00000138793  GVLEIVSAVNSVSVYRLDHTFEALQERKRRILDDAVELS.Q..DHFKKYLVKL.........................
ENSMUSP00000109526  SLYAILSALQSNAIHRLKKTWEEVSRDSFRVFQKLSEIFsDe.NNYSLSRELLikegtskfatlemnprraqrrqke.
ENSMUSP00000028170  SLYAILSALQSNAIHRLKKTWEEVSRDSFRVFQKLSEIFsDe.NNYSLSRELLikegtskfatlemnprraqrrqke.
ENSMUSP00000097812  SLYAILSALQSNAIHRLKKTWEEVSRDSFRVFQKLSEIFsDe.NNYSLSRELLikegtskfatlemnprraqrrqke.
ENSMUSP00000129652  SLMAIISGMNMSPVSRLKKTWAKVK---TAKFDILEHQMdPs.SNFYNYRTAL.........................
ENSMUSP00000031276  SLMAIISGMNMSPVSRLKKTWAKVK---TAKFDILEHQMdPs.SNFYNYRTAL.........................
ENSMUSP00000027760  SLRAIVSALQSNSIYRLKKAWAAVPKDRMLMFEELSDIFsDh.NNHLTSRELLmkegtskfanldssvkenqkrtqrr
ENSMUSP00000107490  SLRAIVSALQSNSIYRLKKAWAAVPKDRMLMFEELSDIFsDh.NNHLTSRELLmkegtskfanldssvkenqkrtqrr
ENSMUSP00000107488  SLRAIVSALQSNSIYRLKKAWAAVPKDRMLMFEELSDIFsDh.NNHLTSRELLmkegtskfanldssvkenqkrtqrr
ENSMUSP00000116892  GVLEITSALNRSAIYRLKKTWAKVSKQTKALMDKLQKTVsSe.GRFKNLRETL.........................
ENSMUSP00000034912  AVLEITSSINRSAIFRLKKTWLKVSKQTKSLLDKLQKLVsSd.GRFKNLRESL.........................
ENSMUSP00000096930  GVLEITSALNRSAIYRLKKTWAKVSKQTKALMDKLQKTVsSe.GRFKNLRETL.........................
ENSMUSP00000028525  SFFAIVMGLSNVAVSRLALTWEKLPSKFKKFYAEFESLMdPs.RNHRAYRLTA.........................
ENSMUSP00000099759  SFFAIVMGLSNVAVSRLALTWEKLPSKFKKFYAEFESLMdPs.RNHRAYRLTA.........................
ENSMUSP00000088336  SFFAIVMGLSNVAVSRLALTWEKLPSKFKKFYAEFESLMdPs.RNHRAYRLTA.........................
ENSMUSP00000114119  SMFAIISGLNLAPVARLRTTWEKLPNKYEKLFQDLQDLFdPs.RNMAKYRNVL.........................
ENSMUSP00000113778  SMFAIISGLNLAPVARLRTTWEKLPNKYEKLFQDLQDLFdPs.RNMAKYRNVL.........................
ENSMUSP00000090829  SLMAIISGMNMSPVSRLKKTWAKVK---TAKFFILEHQMdPt.GNFCNYRTAL.........................
ENSMUSP00000065619  SLMAIISGMNMSPVSRLKKTWAKVK---TAKFFILEHQMdPt.GNFCNYRTAL.........................
ENSMUSP00000128947  SLMAIISGMNMSPVSRLKKTWAKVK---TAKFDILEHQMdPs.SNFYNYRTAL.........................
ENSMUSP00000092114  SMFAIISGLNLAPVARLRGTWEKLPSKYEKHLQDLQDLFdPs.RNMAKYRNIL.........................
ENSMUSP00000104522  SMFAIISGLNLAPVARLRGTWEKLPSKYEKHLQDLQDLFdPs.RNMAKYRNIL.........................
ENSMUSP00000099804  SMFAIISGLNLAPVARLRGTWEKLPSKYEKHLQDLQDLFdPs.RNMAKYRNIL.........................
ENSMUSP00000098766  SMFAIISGLNLAPVARLRGTWEKLPSKYEKHLQDLQDLFdPs.RNMAKYRNIL.........................
ENSMUSP00000105313  SFFAIVMGLNTASVSRLSQTWEKIPGKFKKLFSELESLTdPs.LNHKAYRDAF.........................
ENSMUSP00000132244  SMMAIISGMNLSPVARLKKTWSKVK---TAKFDVLEHHMdPs.SNFCNYRTAL.........................
ENSMUSP00000135238  SFFAVMFGLSNSAISRLAHTWERLPHKVRKLYSALERLLdPs.WNHRVYRLAL.........................
ENSMUSP00000116426  SFFAVMFGLSNSAISRLAHTWERLPHKVRKLYSALERLLdPs.WNHRVYRLAL.........................
ENSMUSP00000092828  TLMAVVGGLSHSSISRLKDTHSHLSSEVTKNWNEMTELVsSn.GNYCNYRKAF.........................
ENSMUSP00000129393  TLMAVVGGLSHSSISRLKDTHSHLSSEVTKNWNEMTELVsSn.GNYCNYRKAF.........................
ENSMUSP00000099593  TLMAVIGGLCHSSISRLKETSSHVPHEINKVLGEMTELLsSc.RNYDNYRRAY.........................
ENSMUSP00000136423  TLMAVIGGLCHSSISRLKETSSHVPHEINKVLGEMTELLsSc.RNYDNYRRAY.........................
ENSMUSP00000117631  SYLAILSALDSAPIRRLEW-----QRQTSEGLAEYCTLIdSs.SSFRAYRAAL.........................
ENSMUSP00000099936  SYLAILSALDSAPIRRLEW-----QRQTSEGLAEYCTLIdSs.SSFRAYRAAL.........................
ENSMUSP00000088680  SYLAILSALDSAPIRRLEW-----QRQTSEGLAEYCTLIdSs.SSFRAYRAAL.........................
ENSMUSP00000092703  SYLAILSALDSAPIRRLEW-----QRQTSEGLAEYCTLIdSs.SSFRAYRAAL.........................
ENSMUSP00000035726  SLRAILSALQSNPIYRLKRSWGAVSREPLSVFRKLSQIFsDe.DNHLSSRAILsqeettedddcpsgslp........
ENSMUSP00000134167  TLMAVIGGLCHSSISRLKETSSHVPHEINKVLGEMTELLsSc.RNYDNYRRAY.........................
ENSMUSP00000090828  SLMAIISGMNMSPVSRLKKTWAKVK---TAKFFILEHQMdPt.GNFCNYRTAL.........................
ENSMUSP00000134592  TLMAVIGGLCHSSISRLKETSSHVPHEINKVLGEMTELLsSc.RNYDNYRRAY.........................
ENSMUSP00000118148  SFFAVMFGLSNSAISRLAHTWERLPHKVRKLYSALERLLdPs.WNHRVYRLAL.........................
ENSMUSP00000133449  TLMAVIGGLCHSSISRLKETSSHVPHEINKVLGEMTELLsSc.RNYDNYRRAY.........................
ENSMUSP00000134027  TLMAVIGGLCHSSISRLKETSSHVPHEINKVLGEMTELLsSc.RNYDNYRRAY.........................
ENSMUSP00000041135  TLMAVVGGLSHSSISRLKETHSHVSPDTIKLWEGLTELVtAt.GNYSNYRRRL.........................
ENSMUSP00000109104  TLMAVVGGLSHSSISRLKETHSHVSPDTIKLWEGLTELVtAt.GNYSNYRRRL.........................
ENSMUSP00000129873  TLMAVVGGLSHSSISRLKETHSHVSPDTIKLWEGLTELVtAt.GNYSNYRRRL.........................
ENSMUSP00000120126  SFFAVMFGLSNSAISRLAHTWED----------------.Ps.WNHRVYRLAL.........................
ENSMUSP00000124183  TLMAVTGGLCHSAISRLKDSHVHLSPDSTKALLELTELLsSh.NNYAHYRRTW.........................
ENSMUSP00000032811  TLMAVTGGLCHSAISRLKDSHVHLSPDSTKALLELTELLsSh.NNYAHYRRTW.........................
ENSMUSP00000125137  TLMAVTGGLCHSAISRLKDSHVHLSPDSTKALLELTELLsSh.NNYAHYRRTW.........................
ENSMUSP00000103103  SFYAVVMGLDNAAVSRLRLTWEKLPGKFKNLFRKFEGLTdPc.RNHKSYREVI.........................
ENSMUSP00000092200  TLMAVTGGLCHSAISRLKDSHVHLSPDSTKALLELTELLsSh.NNYAHYRRTW.........................
ENSMUSP00000123718  TLMAVTGGLCHSAISRLKDSHVHLSPDSTKALLELTELLsSh.NNYAHYRRTW.........................
ENSMUSP00000041082  SVYAVVSALQSSPIHRLRAAWGETTRDSLRVFSSLCQIFsEe.DNYSQSRELL.........................
ENSMUSP00000124908  TLMAVTGGLCHSAISRLKDSHVHLSPDSTKALLELTELLsSh.NNYAHYRRTW.........................
ENSMUSP00000140055  ALMAVVSGLQSAPIFRLTKTWALLSRKDKTTFEKLEYVMsKe.DNYKRLRDYI.........................
ENSMUSP00000140342  ALMAVVSGLQSAPIFRLTKTWALLSRKDKTTFEKLEYVMsKe.DNYKRLRDYI.........................
ENSMUSP00000140230  ALMAVVSGLQSAPIFRLTKTWALLSRKDKTTFEKLEYVMsKe.DNYKRLRDYI.........................
ENSMUSP00000027886  ALMAVVSGLQSAPIFRLTKTWALLSRKDKTTFEKLEYVMsKe.DNYKRLRDYI.........................
ENSMUSP00000139618  ALMAVVSGLQSAPIFRLTKTWALLSRKDKTTFEKLEYVMsKe.DNYKRLRDYI.........................
ENSMUSP00000063872  ALMAVVSGLQSAPIFRLTKTWALLSRKDKTTFEKLEYVMsKe.DNYKRLRDYI.........................
ENSMUSP00000130581  ALMAVVSGLQSAPIFRLTKTWALLSRKDKTTFEKLEYVMsKe.DNYKRLRDYI.........................
ENSMUSP00000139645  ALMAVVSGLQSAPIFRLTKTWALLSRKDKTTFEKLEYVMsKe.DNYKRLRDYI.........................
ENSMUSP00000108790  SLMSVVSALQSAPIFRLTKTWALLNRKDKTTFEKLDYLMsKe.DNYKRTRDYI.........................
ENSMUSP00000088563  SLMSVVSALQSAPIFRLTKTWALLNRKDKTTFEKLDYLMsKe.DNYKRTRDYI.........................
ENSMUSP00000132533  ALMAVVSGLQSAPIFRLTKTWALLSRKDKTTFEKLEYVMsKe.DNYKRLRDYI.........................
ENSMUSP00000048451  SLMSVVSALQSAPIFRLTKTWALLNRKDKTTFEKLDYLMsKe.DNYKRTRDYI.........................
ENSMUSP00000108789  SLMSVVSALQSAPIFRLTKTWALLNRKDKTTFEKLDYLMsKe.DNYKRTRDYI.........................
ENSMUSP00000135317  SFFAVMFGLSNSAISRLAHTWERLPHKVRKLYSALERLLdPs.WNHRVYRLAL.........................
ENSMUSP00000115747  TAMQILGGLEHLAV-RQSPAWRILPAKIAEVMEELKAVEvFl.KSDSLCLMEG.........................
ENSMUSP00000050586  TAMQILGGLEHLAV-RQSPAWRILPAKIAEVMEELKAVEvFl.KSDSLCLMEG.........................
ENSMUSP00000121635  ---------------------------------------.-..----------.........................
ENSMUSP00000039186  ---------------------------------------.-..----------.........................
ENSMUSP00000130604  AVMEFLAGLRSRKVL---KMWQFMDQSDIETMRSLKDAMaQh.ESSVEYKKVV.........................
ENSMUSP00000138360  AVMEFLAGLRSRKVL---KMWQFMDQSDIETMRSLKDAMaQh.ESSVEYKKVV.........................
ENSMUSP00000138330  AVMEFLAGLRSRKVL---KMWQFMDQSDIETMRSLKDAMaQh.ESSVEYKKVV.........................
ENSMUSP00000136756  ---------------------------------------.-..----------.........................
ENSMUSP00000029766  AFSAIMKALEMPQITRLEKTWTALRHHYTQTAILYEKQLkPfsK---------.........................
ENSMUSP00000139822  ---------------------------------------.-..----------.........................
ENSMUSP00000104523  ---------------------------------------.-..----------.........................
ENSMUSP00000071368  ---------------------------------------.-..----------.........................
ENSMUSP00000120630  ---------------------------------------.-..----------.........................
ENSMUSP00000108868  SFAAVMGALEMAQISRLEQTWMTLRQRHTEGAILYEK--.-..----------.........................
ENSMUSP00000073866  SFAAVMGALEMAQISRLEQTWMTLRQRHTEGAILYEK--.-..----------.........................
ENSMUSP00000031624  ---------------------------------------.-..----------.........................
ENSMUSP00000115092  ---------------------------------------.-..----------.........................
ENSMUSP00000116215  ---------------------------------------.-..----------.........................
ENSMUSP00000073399  ---------------------------------------.-..----------.........................
ENSMUSP00000106227  ---------------------------------------.-..----------.........................
ENSMUSP00000106225  ---------------------------------------.-..----------.........................
ENSMUSP00000106229  ---------------------------------------.-..----------.........................
ENSMUSP00000136434  ---------------------------------------.-..----------.........................
ENSMUSP00000106226  ---------------------------------------.-..----------.........................
ENSMUSP00000076380  ---------------------------------------.-..----------.........................
ENSMUSP00000106241  ---------------------------------------.-..----------.........................
ENSMUSP00000106228  ---------------------------------------.-..----------.........................
ENSMUSP00000134203  ---------------------------------------.-..----------.........................
ENSMUSP00000036997  ---------------------------------------.-..----------.........................
ENSMUSP00000136735  ---------------------------------------.-..----------.........................
ENSMUSP00000123036  ---------------------------------------.-..----------.........................
ENSMUSP00000109099  ---------------------------------------.-..----------.........................
ENSMUSP00000109100  ---------------------------------------.-..----------.........................
ENSMUSP00000109103  ---------------------------------------.-..----------.........................
ENSMUSP00000031501  ---------------------------------------.-..----------.........................
ENSMUSP00000032648  ---------------------------------------.-..----------.........................
ENSMUSP00000109096  ---------------------------------------.-..----------.........................
ENSMUSP00000115401  ---------------------------------------.-..----------.........................
ENSMUSP00000120949  ---------------------------------------.-..----------.........................
ENSMUSP00000134312  ---------------------------------------.-..----------.........................
ENSMUSP00000117681  ---------------------------------------.-..----------.........................


                                                    360       370       380                         
                                                      |         |         |                         
d1nvus_               ....RSI....NP...................PCVPFFGIYLTNILKTEEGNPEVLKR....................
ENSMUSP00000067786  ....RSI....NP...................PCVPFFGIYLTNILKTEEGNPEVLRR....................
ENSMUSP00000138589  ....KSI....NP...................PCVPFFGIYLTNILKTEEGNSDFLKR....................
ENSMUSP00000044866  ....KSI....NP...................PCVPFFGIYLTNILKTEEGNSDFLKR....................
ENSMUSP00000138793  ....KSI....NP...................PCVPFFGIYLTNILKTEEGNSDFLKR....................
ENSMUSP00000109526  ....TGV....IQ...................GTVPYLGTFLTDLVMLDTAMKDYL--....................
ENSMUSP00000028170  ....TGV....IQ...................GTVPYLGTFLTDLVMLDTAMKDYL--....................
ENSMUSP00000097812  ....TGV....IQ...................GTVPYLGTFLTDLVMLDTAMKDYL--....................
ENSMUSP00000129652  ....RGA....AQrsltahssrek........IVIPFFSLLIKDIYFLNEGCVNRL--....................
ENSMUSP00000031276  ....RGA....AQrsltahssrek........IVIPFFSLLIKDIYFLNEGCVNRL--....................
ENSMUSP00000027760  lqlqK--....-Dmgvmq..............GTVPYLGTFLTDLTMLDTALQDYI--....................
ENSMUSP00000107490  lqlqK--....-Dmgvmq..............GTVPYLGTFLTDLTMLDTALQDYI--....................
ENSMUSP00000107488  lqlqK--....-Dmgvmq..............GTVPYLGTFLTDLTMLDTALQDYI--....................
ENSMUSP00000116892  ....KNC....NP...................PAVPYLGMYLTDLAFIEEGTPNFT--....................
ENSMUSP00000034912  ....RNC....DP...................PCVPYLGMYLTDLVFIEEGTPNYT--....................
ENSMUSP00000096930  ....KNC....NP...................PAVPYLGMYLTDLAFIEEGTPNFT--....................
ENSMUSP00000028525  ....AKL....EP...................PLIPFMPLLIKDMTFTHEGNKTFI--....................
ENSMUSP00000099759  ....AKL....EP...................PLIPFMPLLIKDMTFTHEGNKTFI--....................
ENSMUSP00000088336  ....AKL....EP...................PLIPFMPLLIKDMTFTHEGNKTFI--....................
ENSMUSP00000114119  ....SGQnl..QP...................PVIPLFPVIKKDLTFLHEGNDSKV--....................
ENSMUSP00000113778  ....SGQnl..QP...................PVIPLFPVIKKDLTFLHEGNDSKV--....................
ENSMUSP00000090829  ....RGA....AHrsltahssrek........IVIPFFSLLIKDIYFLNEGCANRL--....................
ENSMUSP00000065619  ....RGA....AHrsltahssrek........IVIPFFSLLIKDIYFLNEGCANRL--....................
ENSMUSP00000128947  ....RGA....AQrsltahssrek........IVIPFFSLLIKDIYFLNEGCVNRL--....................
ENSMUSP00000092114  ....SSQsm..QP...................PIIPLFPVVKKDMTFLHEGNDSKV--....................
ENSMUSP00000104522  ....SSQsm..QP...................PIIPLFPVVKKDMTFLHEGNDSKV--....................
ENSMUSP00000099804  ....SSQsm..QP...................PIIPLFPVVKKDMTFLHEGNDSKV--....................
ENSMUSP00000098766  ....SSQsm..QP...................PIIPLFPVVKKDMTFLHEGNDSKV--....................
ENSMUSP00000105313  ....KKM....KP...................PKIPFMPLLLKDVTFIHEGNKTFL--....................
ENSMUSP00000132244  ....QGA....TQrsqtanssrek........IVIPVFNLFVKDIYFLHKIHTNHL--....................
ENSMUSP00000135238  ....TKL....SP...................PVIPFMPLLLKDVTFIHEGNHTLV--....................
ENSMUSP00000116426  ....TKL....SP...................PVIPFMPLLLKDVTFIHEGNHTLV--....................
ENSMUSP00000092828  ....ADC....DG...................FKIPILGVHLKDLIAVHVIFPDWM--....................
ENSMUSP00000129393  ....ADC....DG...................FKIPILGVHLKDLIAVHVIFPDWM--....................
ENSMUSP00000099593  ....GEC....TH...................FKIPILGVHLKDLISLYEAMPDYL--....................
ENSMUSP00000136423  ....GEC....TH...................FKIPILGVHLKDLISLYEAMPDYL--....................
ENSMUSP00000117631  ....SEV....EP...................PCIPYLGLILQDLTFVHLGNPDYI--....................
ENSMUSP00000099936  ....SEV....EP...................PCIPYLGLILQDLTFVHLGNPDYI--....................
ENSMUSP00000088680  ....SEV....EP...................PCIPYLGLILQDLTFVHLGNPDYI--....................
ENSMUSP00000092703  ....SEV....EP...................PCIPYLGLILQDLTFVHLGNPDYI--....................
ENSMUSP00000035726  ....SKL....PP...................GPVPYLGTFLTDLVMLDTALPDTL--....................
ENSMUSP00000134167  ....GEC....TH...................FKIPILGVHLKDLISLYEAMPDYL--....................
ENSMUSP00000090828  ....RGA....AHrsltahssrek........IVIPFFSLLIKDIYFLNEGCANRL--....................
ENSMUSP00000134592  ....GEC....TH...................FKIPILGVHLKDLISLYEAMPDYL--....................
ENSMUSP00000118148  ....TKL....SP...................PVIPFMPLLLKDVTFIHEGNHTLV--....................
ENSMUSP00000133449  ....GEC....TH...................FKIPILGVHLKDLISLYEAMPDYL--....................
ENSMUSP00000134027  ....GEC....TH...................FKIPILGVHLKDLISLYEAMPDYL--....................
ENSMUSP00000041135  ....AAC....VG...................FRFPILGVHLKDLVALQLALPDWL-D....................
ENSMUSP00000109104  ....AAC....VG...................FRFPILGVHLKDLVALQLALPDWL-D....................
ENSMUSP00000129873  ....AAC....VG...................FRFPILGVHLKDLVALQLALPDWL-D....................
ENSMUSP00000120126  ....TKL....SP...................PVIPFMPLLLKDVTFIHEGNHTLV--....................
ENSMUSP00000124183  ....AGC....TG...................FRLPVLGVHLKDLVSLYEAHPDRL--....................
ENSMUSP00000032811  ....AGC....TG...................FRLPVLGVHLKDLVSLYEAHPDRL--....................
ENSMUSP00000125137  ....AGC....TG...................FRLPVLGVHLKDLVSLYEAHPDRL--....................
ENSMUSP00000103103  ....SKM....KP...................PLIPFVPLILKDLTFLHEGSKTLV--....................
ENSMUSP00000092200  ....AGC....TG...................FRLPVLGVHLKDLVSLYEAHPDRL--....................
ENSMUSP00000123718  ....AGC....TG...................FRLPVLGVHLKDLVSLYEAHPDRL--....................
ENSMUSP00000041082  ....MQEv...KPqppvephskkaprsgfrggGVVPYLGTFLKDLVMLDAASKDEL--....................
ENSMUSP00000124908  ....AGC....TG...................FRLPVLGVHLKDLVSLYEAHPDRL--....................
ENSMUSP00000140055  ....SSLk...MT...................PCIPYLGIYLSDLTYIDSAYPST---....................
ENSMUSP00000140342  ....SSLk...MT...................PCIPYLGIYLSDLTYIDSAYPST---....................
ENSMUSP00000140230  ....SSLk...MT...................PCIPYLGIYLSDLTYIDSAYPST---....................
ENSMUSP00000027886  ....SSLk...MT...................PCIPYLGIYLSDLTYIDSAYPST---....................
ENSMUSP00000139618  ....SSLk...MT...................PCIPYLGIYLSDLTYIDSAYPST---....................
ENSMUSP00000063872  ....SSLk...MT...................PCIPYLGIYLSDLTYIDSAYPST---....................
ENSMUSP00000130581  ....SSLk...MT...................PCIPYLGIYLSDLTYIDSAYPST---....................
ENSMUSP00000139645  ....SSLk...MT...................PCIPYLGIYLSDLTYIDSAYPST---....................
ENSMUSP00000108790  ....RSLk...MV...................PSIPYLGIYLLDLIYIDSAYPA----....................
ENSMUSP00000088563  ....RSLk...MV...................PSIPYLGIYLLDLIYIDSAYPA----....................
ENSMUSP00000132533  ....SSLk...MT...................PCIPYLGIYLSDLTYIDSAYPST---....................
ENSMUSP00000048451  ....RSLk...MV...................PSIPYLGIYLLDLIYIDSAYPA----....................
ENSMUSP00000108789  ....RSLk...MV...................PSIPYLGMSLSYFIINFPGN------....................
ENSMUSP00000135317  ....TKL....SP...................PVIPFMPLLLKDVTFIHEGNHTLV--....................
ENSMUSP00000115747  ....RRFr...AQ...................PTLPSAHLLAMHIQQLETGGFTMT--....................
ENSMUSP00000050586  ....RRFr...AQ...................PTLPSAHLLAMHIQQLETGGFTMT--....................
ENSMUSP00000121635  ....---....--...................--------------------------....................
ENSMUSP00000039186  ....---....--...................--------------------------....................
ENSMUSP00000130604  ....TRAlhipGC...................KVVPFCGVFLKELCEVLDGASGLLKLcpryssqeealefvadysgq
ENSMUSP00000138360  ....TRAlhipGC...................KVVPFCGVFLKELCEVLDGASGLLKLcpryssqeealefvadysgq
ENSMUSP00000138330  ....TRAlhipGC...................KVVPFCGVFLKELCEVLDGASGLLKLcpryssqeealefvadysgq
ENSMUSP00000136756  ....---....--...................--------------------------....................
ENSMUSP00000029766  ....---....--...................--------------ILHEGRESTY--....................
ENSMUSP00000139822  ....---....--...................--------------------------....................
ENSMUSP00000104523  ....---....--...................--------------------------....................
ENSMUSP00000071368  ....---....--...................--------------------------....................
ENSMUSP00000120630  ....---....--...................--------------------------....................
ENSMUSP00000108868  ....---....--...................--------------------------....................
ENSMUSP00000073866  ....---....--...................--------------------------....................
ENSMUSP00000031624  ....---....--...................--------------------------....................
ENSMUSP00000115092  ....---....--...................--------------------------....................
ENSMUSP00000116215  ....---....--...................--------------------------....................
ENSMUSP00000073399  ....---....--...................--------------------------....................
ENSMUSP00000106227  ....---....--...................--------------------------....................
ENSMUSP00000106225  ....---....--...................--------------------------....................
ENSMUSP00000106229  ....---....--...................--------------------------....................
ENSMUSP00000136434  ....---....--...................--------------------------....................
ENSMUSP00000106226  ....---....--...................--------------------------....................
ENSMUSP00000076380  ....---....--...................--------------------------....................
ENSMUSP00000106241  ....---....--...................--------------------------....................
ENSMUSP00000106228  ....---....--...................--------------------------....................
ENSMUSP00000134203  ....---....--...................--------------------------....................
ENSMUSP00000036997  ....---....--...................--------------------------....................
ENSMUSP00000136735  ....---....--...................--------------------------....................
ENSMUSP00000123036  ....---....--...................--------------------------....................
ENSMUSP00000109099  ....---....--...................--------------------------....................
ENSMUSP00000109100  ....---....--...................--------------------------....................
ENSMUSP00000109103  ....---....--...................--------------------------....................
ENSMUSP00000031501  ....---....--...................--------------------------....................
ENSMUSP00000032648  ....---....--...................--------------------------....................
ENSMUSP00000109096  ....---....--...................--------------------------....................
ENSMUSP00000115401  ....---....--...................--------------------------....................
ENSMUSP00000120949  ....---....--...................--------------------------....................
ENSMUSP00000134312  ....---....--...................----------KDLVMLDAASKDEL--....................
ENSMUSP00000117681  ....---....--...................--------------------------....................


                                 390       400       410                                            
                                   |         |         |                                            
d1nvus_               .......HGKE..LINFSKRRKVAEITGEIQQYQ.........NQP....Y...C.L.....................
ENSMUSP00000067786  .......HGKE..LINFSKRRRVAEITGEIQQYQ.........NQP....Y...C.L.....................
ENSMUSP00000138589  .......KGKD..LINFSKRRKVAEITGEIQQYQ.........NQP....Y...C.L.....................
ENSMUSP00000044866  .......KGKD..LINFSKRRKVAEITGEIQQYQ.........NQP....Y...C.L.....................
ENSMUSP00000138793  .......KGKD..LINFSKRRKVAEITGEIQQYQ.........NQP....Y...C.L.....................
ENSMUSP00000109526  .......-YGR..LINFEKRRKEFEVIAQIKLLQ.........SACnn..Y...S.I.....................
ENSMUSP00000028170  .......-YGR..LINFEKRRKEFEVIAQIKLLQ.........SACnn..Y...S.I.....................
ENSMUSP00000097812  .......-YGR..LINFEKRRKEFEVIAQIKLLQ.........SACnn..Y...S.I.....................
ENSMUSP00000129652  .......-PNG..HVNFEKFWELAKQVSEFMTWK.........QVE....C...P.F.....................
ENSMUSP00000031276  .......-PNG..HVNFEKFWELAKQVSEFMTWK.........QVE....C...P.F.....................
ENSMUSP00000027760  .......-EGG..LINFEKRRREFEVIAQIKLLQ.........SACns..Y...C.M.....................
ENSMUSP00000107490  .......-EGG..LINFEKRRREFEVIAQIKLLQ.........SACns..Y...C.M.....................
ENSMUSP00000107488  .......-EGG..LINFEKRRREFEVIAQIKLLQ.........SACns..Y...C.M.....................
ENSMUSP00000116892  .......-EEG..LVNFSKMRMISHIIREIRQFQ.........QTA....Y...R.I.....................
ENSMUSP00000034912  .......-EDG..LVNFSKMRMISHIIREIRQFQ.........QTT....Y...K.I.....................
ENSMUSP00000096930  .......-EEG..LVNFSKMRMISHIIREIRQFQ.........QTA....Y...R.I.....................
ENSMUSP00000028525  .......--DN..LVNFEKMRMIANTARTVRYYR.........SQP....F...N.P.....................
ENSMUSP00000099759  .......--DN..LVNFEKMRMIANTARTVRYYR.........SQP....F...N.P.....................
ENSMUSP00000088336  .......--DN..LVNFEKMRMIANTARTVRYYR.........SQP....F...N.P.....................
ENSMUSP00000114119  .......--DG..LVNFEKLRMIAKEIRHVGRMA.........SVN....M...D.Palmfrtrkkkwrslgslsqgs
ENSMUSP00000113778  .......--DG..LVNFEKLRMIAKEIRHVGRMA.........SVN....M...D.Palmfrtrkkkwrslgslsqgs
ENSMUSP00000090829  .......-PNG..HVNFEKFLELAKQVGEFITWK.........QVE....C...P.F.....................
ENSMUSP00000065619  .......-PNG..HVNFEKFLELAKQVGEFITWK.........QVE....C...P.F.....................
ENSMUSP00000128947  .......-PNG..HVNFEKFWELAKQVSEFMTWK.........QVE....C...P.F.....................
ENSMUSP00000092114  .......--DG..LVNFEKLRMIAKEIRHIIRMT.........SAN....M...D.Pammfrqrslsqgstnsnmldv
ENSMUSP00000104522  .......--DG..LVNFEKLRMIAKEIRHIIRMT.........SAN....M...D.Pammfrqrkkrwrslgslsqgs
ENSMUSP00000099804  .......--DG..LVNFEKLRMIAKEIRHIIRMT.........SAN....M...D.Pammfrqrslsqgstnsnmldv
ENSMUSP00000098766  .......--DG..LVNFEKLRMIAKEIRHIIRMT.........SAN....M...D.Pammfrqrkkrwrslgslsqgs
ENSMUSP00000105313  .......--DN..LVNFEKLHMIADTVRTLRHCR.........TNQfgsdV...S.P.....................
ENSMUSP00000132244  .......-PNG..HINFKKFWEISRQIHEFMTWT.........QVE....C...P.F.....................
ENSMUSP00000135238  .......--EN..LINFEKMRMMARAVRMLHHCR.........SHSt...A...P.Lsplrsrvshihedsqgsrist
ENSMUSP00000116426  .......--EN..LINFEKMRMMARAVRMLHHCR.........SHSt...A...P.Lsplrsrvshihedsqgsrist
ENSMUSP00000092828  .......-EEN..KVNVVKMHQLSVTLSELVSLQ.........NAS....H...H.L.....................
ENSMUSP00000129393  .......-EEN..KVNVVKMHQLSVTLSELVSLQ.........NAS....H...H.L.....................
ENSMUSP00000099593  .......-EDG..KVNVQKLLALYNHINELVQLQ.........EMA....P...P.L.....................
ENSMUSP00000136423  .......-EDG..KVNVQKLLALYNHINELVQLQ.........EMA....P...P.L.....................
ENSMUSP00000117631  .......--DG..KVNFSKRWQQFNILDSMRCFQ.........QAH....Y...E.I.....................
ENSMUSP00000099936  .......--DG..KVNFSKRWQQFNILDSMRCFQ.........QAH....Y...E.I.....................
ENSMUSP00000088680  .......--DG..KVNFSKRWQQFNILDSMRCFQ.........QAH....Y...E.I.....................
ENSMUSP00000092703  .......--DG..KVNFSKRWQQFNILDSMRCFQ.........QAH....Y...E.I.....................
ENSMUSP00000035726  .......-KGN..LINFEKRRKEWEILARIQQLQ.........QRCqr..Y...S.L.....................
ENSMUSP00000134167  .......-EDG..KVNVQKLLALYNHINELVQLQ.........EMA....P...P.L.....................
ENSMUSP00000090828  .......-PNG..HVNFEKFLELAKQVGEFITWK.........QVE....C...P.F.....................
ENSMUSP00000134592  .......-EDG..KVNVQKLLALYNHINELVQLQ.........EMA....P...P.L.....................
ENSMUSP00000118148  .......--EN..LINFEKMRMMARAVRMLHHCR.........SHSt...A...P.Lsplrsrvshihedsqgsrist
ENSMUSP00000133449  .......-EDG..KVNVQKLLALYNHINELVQLQ.........EMA....P...P.L.....................
ENSMUSP00000134027  .......-EDG..KVNVQKLLALYNHINELVQLQ.........EMA....P...P.L.....................
ENSMUSP00000041135  .......PGRT..RLNGAKMRQLFCILEELAMVT.........SLR....P...P.V.....................
ENSMUSP00000109104  .......PGRT..RLNGAKMRQLFCILEELAMVT.........SLR....P...P.V.....................
ENSMUSP00000129873  .......PGRT..RLNGAKMRQLFCILEELAMVT.........SLR....P...P.V.....................
ENSMUSP00000120126  .......--EN..LINFEKMRMMARAVRMLHHCR.........SHSt...A...P.Lsplrsrvshihedsqgsrist
ENSMUSP00000124183  .......-PDG..RLHLPKLNSLYLRLQELMALQ.........GQH....P...P.C.....................
ENSMUSP00000032811  .......-PDG..RLHLPKLNSLYLRLQELMALQ.........GQH....P...P.C.....................
ENSMUSP00000125137  .......-PDG..RLHLPKLNSLYLRLQELMALQ.........GQH....P...P.C.....................
ENSMUSP00000103103  .......--DG..LVNIEKLHSVAEKVRTIRKYR.........SRP....L...C.L.....................
ENSMUSP00000092200  .......-PDG..RLHLPKLNSLYLRLQELMALQ.........GQH....P...P.C.....................
ENSMUSP00000123718  .......-PDG..RLHLPKLNSLYLRLQELMALQ.........GQH....P...P.C.....................
ENSMUSP00000041082  .......-ENG..YINFDKRRKEFAILSELLRLQ.........KECrg..Y...D.L.....................
ENSMUSP00000124908  .......-PDG..RLHLPKLNSLYLRLQELMALQ.........GQH....P...P.C.....................
ENSMUSP00000140055  .......---GsiLENEQRSNLMNNILRIISDLQ.........QSCe...Y...D.I.....................
ENSMUSP00000140342  .......---GsiLENEQRSNLMNNILRIISDLQ.........QSCe...Y...D.I.....................
ENSMUSP00000140230  .......---GsiLENEQRSNLMNNILRIISDLQ.........QSCe...Y...D.I.....................
ENSMUSP00000027886  .......---GsiLENEQRSNLMNNILRIISDLQ.........QSCe...Y...D.I.....................
ENSMUSP00000139618  .......---GsiLENEQRSNLMNNILRIISDLQ.........QSCe...Y...D.I.....................
ENSMUSP00000063872  .......---GsiLENEQRSNLMNNILRIISDLQ.........QSCe...Y...D.I.....................
ENSMUSP00000130581  .......---GsiLENEQRSNLMNNILRIISDLQ.........QSCe...Y...D.I.....................
ENSMUSP00000139645  .......---GsiLENEQRSNLMNNILRIISDLQ.........QSCe...Y...D.I.....................
ENSMUSP00000108790  .......-SGSi.MENEQRSNQMNNILRIIADLQ.........VSCs...Y...DhL.....................
ENSMUSP00000088563  .......-SGSi.MENEQRSNQMNNILRIIADLQ.........VSCs...Y...DhL.....................
ENSMUSP00000132533  .......---GsiLENEQRSNLMNNILRIISDLQ.........QSCe...Y...D.I.....................
ENSMUSP00000048451  .......-SGSi.MENEQRSNQMNNILRIIADLQ.........VSCs...Y...DhL.....................
ENSMUSP00000108789  .......----..---------------------.........---....-...-.-.....................
ENSMUSP00000135317  .......--EN..LINFEKMRMMARAVRMLHHCR.........SHSt...A...P.Lsplrsrvshihedsqgsrist
ENSMUSP00000115747  .......--NG..AHRWSKLRNIAKVASQVHAFQ.........ENP....Y...T.F.....................
ENSMUSP00000050586  .......--NG..AHRWSKLRNIAKVASQVHAFQ.........ENP....Y...T.F.....................
ENSMUSP00000121635  .......----..---------------------.........---....-...-.-.....................
ENSMUSP00000039186  .......----..---------------------.........---....-...-.-.....................
ENSMUSP00000130604  dnflqrvGQNG..LKNSEKELTVNSIFQVIRSCSrslemeeedS--....AsegS.G.....................
ENSMUSP00000138360  dnflqrvGQNG..LKNSEKELTVNSIFQVIRSCSrslemeeedS--....AsegS.G.....................
ENSMUSP00000138330  dnflqrvGQNG..LKNSEKELTVNSIFQVIRSCSrslemeeedS--....AsegS.G.....................
ENSMUSP00000136756  .......----..---------------------.........---....-...-.-.....................
ENSMUSP00000029766  .......----..---------------------.........-VP....A...S.N.....................
ENSMUSP00000139822  .......----..---------------------.........---....-...-.-.....................
ENSMUSP00000104523  .......----..---------------------.........---....-...-.-.....................
ENSMUSP00000071368  .......----..---------------------.........---....-...-.-.....................
ENSMUSP00000120630  .......----..---------------------.........---....-...-.-.....................
ENSMUSP00000108868  .......----..---------------------.........---....-...-.-.....................
ENSMUSP00000073866  .......----..---------------------.........---....-...-.-.....................
ENSMUSP00000031624  .......----..---------------------.........---....-...-.-.....................
ENSMUSP00000115092  .......----..---------------------.........---....-...-.-.....................
ENSMUSP00000116215  .......----..---------------------.........---....-...-.-.....................
ENSMUSP00000073399  .......----..---------------------.........---....-...-.-.....................
ENSMUSP00000106227  .......----..---------------------.........---....-...-.-.....................
ENSMUSP00000106225  .......----..---------------------.........---....-...-.-.....................
ENSMUSP00000106229  .......----..---------------------.........---....-...-.-.....................
ENSMUSP00000136434  .......----..---------------------.........---....-...-.-.....................
ENSMUSP00000106226  .......----..---------------------.........---....-...-.-.....................
ENSMUSP00000076380  .......----..---------------------.........---....-...-.-.....................
ENSMUSP00000106241  .......----..---------------------.........---....-...-.-.....................
ENSMUSP00000106228  .......----..---------------------.........---....-...-.-.....................
ENSMUSP00000134203  .......----..---------------------.........---....-...-.-.....................
ENSMUSP00000036997  .......----..---------------------.........---....-...-.-.....................
ENSMUSP00000136735  .......----..---------------------.........---....-...-.-.....................
ENSMUSP00000123036  .......----..---------------------.........---....-...-.-.....................
ENSMUSP00000109099  .......----..---------------------.........---....-...-.-.....................
ENSMUSP00000109100  .......----..---------------------.........---....-...-.-.....................
ENSMUSP00000109103  .......----..---------------------.........---....-...-.-.....................
ENSMUSP00000031501  .......----..---------------------.........---....-...-.-.....................
ENSMUSP00000032648  .......----..---------------------.........---....-...-.-.....................
ENSMUSP00000109096  .......----..---------------------.........---....-...-.-.....................
ENSMUSP00000115401  .......----..---------------------.........---....-...-.-.....................
ENSMUSP00000120949  .......----..---------------------.........---....-...-.-.....................
ENSMUSP00000134312  .......-ENG..YINFDKRRKK-----------.........-ECrg..Y...D.L.....................
ENSMUSP00000117681  .......----..---------------------.........---....-...-.-.....................


                                                        420       430       440       450           
                                                          |         |         |         |           
d1nvus_               .................................RVESDIKRFFENLNPMGNSMEKEFTDYLFNKSLEIEPRN....PK
ENSMUSP00000067786  .................................RVEPDIKRFFENLNPMGNSMEKEFTDYLFNKSLEIEPRH....PK
ENSMUSP00000138589  .................................RTEPEMRRFFENLNPMGILSEKEFTDYLFNKSLEIEPRNc...KQ
ENSMUSP00000044866  .................................RTEPEMRRFFENLNPMGILSEKEFTDYLFNKSLEIEPRNc...KQ
ENSMUSP00000138793  .................................RTEPEMRRFFENLNPMGILSEKEFTDYLFNKSLEIEPRNc...KQ
ENSMUSP00000109526  .................................APEEHFGTWFRAMERL-------SEAESYTLSCELEPPSesa.SN
ENSMUSP00000028170  .................................APEEHFGTWFRAMERL-------SEAESYTLSCELEPPSesa.SN
ENSMUSP00000097812  .................................APEEHFGTWFRAMERL-------SEAESYTLSCELEPPSesa.SN
ENSMUSP00000129652  .................................ERDRKVLQYLLSVPVF-------SEDALYLASYESEGPE....NN
ENSMUSP00000031276  .................................ERDRKVLQYLLSVPVF-------SEDALYLASYESEGPE....NN
ENSMUSP00000027760  .................................GPDQKFIQWFQRQQLL-------SEEESYALSCEIEAAA....DA
ENSMUSP00000107490  .................................GPDQKFIQWFQRQQLL-------SEEESYALSCEIEAAA....DA
ENSMUSP00000107488  .................................GPDQKFIQWFQRQQLL-------SEEESYALSCEIEAAA....DA
ENSMUSP00000116892  .................................DQQPKVIQYLLDKALV------IDEDSLYELSLKIEPR-....--
ENSMUSP00000034912  .................................DPQPKVIQYLLDESFM------LDEESLYESSLLIEPK-....--
ENSMUSP00000096930  .................................DQQPKVIQYLLDKALV------IDEDSLYELSLKIEPR-....--
ENSMUSP00000028525  .................................DAAQANKNHQDVRSYVRQLNVIDNQRTLSQMSHRLEPR-....--
ENSMUSP00000099759  .................................DAAQANKNHQDVRSYVRQLNVIDNQRTLSQMSHRLEPR-....--
ENSMUSP00000088336  .................................DAAQANKNHQDVRSYVRQLNVIDNQRTLSQMSHRLEPR-....--
ENSMUSP00000114119  anatvldvaqtgghkkrvrrssflnakklyedaQMARKVKQYLSNLELE------MDEESLQTLSLQCEPAT....ST
ENSMUSP00000113778  anatvldvaqtgghkkrvrrssflnakklyedaQMARKVKQYLSNLELE------MDEESLQTLSLQCEPAT....ST
ENSMUSP00000090829  .................................EQDPSITHYLYTAPIF-------SEDGLYLASYESESPE....SQ
ENSMUSP00000065619  .................................EQDPSITHYLYTAPIF-------SEDGLYLASYESESPE....SQ
ENSMUSP00000128947  .................................ERDRKVLQYLLSVPVF-------SEDALYLASYESEGPE....NN
ENSMUSP00000092114  .........qggahkkrarrssllnakklyedaQMARKVKQYLSSLDID------TDEEKFQMMSLQWEPAY....G-
ENSMUSP00000104522  .tnsnmldvqggahkkrarrssllnakklyedaQMARKVKQYLSSLDID------TDEEKFQMMSLQWEPAY....G-
ENSMUSP00000099804  .........qggahkkrarrssllnakklyedaQMARKVKQYLSSLDID------TDEEKFQMMSLQWEPAY....G-
ENSMUSP00000098766  .tnsnmldvqggahkkrarrssllnakklyedaQMARKVKQYLSSLDID------TDEEKFQMMSLQWEPAY....G-
ENSMUSP00000105313  .................................KEQQELKSYVNHLYVI------DSQQALFELSHRLEPR-....--
ENSMUSP00000132244  .................................EKDKKIQSYVLTAPIY-------SEEALFIASFESEGPE....NH
ENSMUSP00000135238  .........................cseqslstRSPASTWAYVQQLK------VIDNQRELSRLSRELEP--....--
ENSMUSP00000116426  .........................cseqslstRSPASTWAYVQQLK------VIDNQRELSRLSRELEP--....--
ENSMUSP00000092828  .................................EPNMDLINLLTLSLDLYH-----TEDDIYKLSLVLEPRNsksqPT
ENSMUSP00000129393  .................................EPNMDLINLLTLSLDLYH-----TEDDIYKLSLVLEPRNsksqPT
ENSMUSP00000099593  .................................DANKDLVHLLTLSLDLYY-----TEDEIYELSYAREPRNh...RA
ENSMUSP00000136423  .................................DANKDLVHLLTLSLDLYY-----TEDEIYELSYAREPRNh...RA
ENSMUSP00000117631  .................................RRNDDIINFFNDFSDH------LAEEALWELSLKIKPRN....--
ENSMUSP00000099936  .................................RRNDDIINFFNDFSDH------LAEEALWELSLKIKPRN....--
ENSMUSP00000088680  .................................RRNDDIINFFNDFSDH------LAEEALWELSLKIKPRN....--
ENSMUSP00000092703  .................................RRNDDIINFFNDFSDH------LAEEALWELSLKIKPRN....--
ENSMUSP00000035726  .................................SPRPPILAALRAQRQL-------SEEQSYRVSRVIEPPA....AS
ENSMUSP00000134167  .................................DANKDLVHLLTLSLDLYY-----TEDEIYELSYAREPRN....HR
ENSMUSP00000090828  .................................EQDPSITHYLYTAPIF-------SEDGLYLASYESESPE....SQ
ENSMUSP00000134592  .................................DANKDLVHLLTLSLDLYY-----TEDEIYELSYAREPRN....HR
ENSMUSP00000118148  .........................cseqslstRSPASTWAYVQQLK------VIDNQRELSRLSRELEP--....--
ENSMUSP00000133449  .................................DANKDLVHLLTLSLDLYY-----TEDEIYELSYAREPRN....HR
ENSMUSP00000134027  .................................DANKDLVHLLTLSLDLYY-----TEDEIYELSYAREPRN....HR
ENSMUSP00000041135  .................................QANPDLLSLLTVSLDQYQ-----TEDELYQLSLQREPRS....KS
ENSMUSP00000109104  .................................QANPDLLSLLTVSLDQYQ-----TEDELYQLSLQREPRS....KS
ENSMUSP00000129873  .................................QANPDLLSLLTVSLDQYQ-----TEDELYQLSLQREPRS....KS
ENSMUSP00000120126  .........................cseqslstRSPASTWAYVQQLK------VIDNQRELSRLSRELEP--....--
ENSMUSP00000124183  .................................SANEDLLHLLTLSLDLFY-----TEDEIYELSYAREPRCp...KS
ENSMUSP00000032811  .................................SANEDLLHLLTLSLDLFY-----TEDEIYELSYAREPRCp...KS
ENSMUSP00000125137  .................................SANEDLLHLLTLSLDLFY-----TEDEIYELSYAREPRCp...KS
ENSMUSP00000103103  .................................DMEASPHHLQTKAYVR-QFQVIDNQNHLFELSYKLE---....--
ENSMUSP00000092200  .................................SANEDLLHLLTLSLDLFY-----TEDEIYELSYAREPRCp...KS
ENSMUSP00000123718  .................................SANEDLLHLLTLSLDLFY-----TEDEIYELSYAREPRCp...KS
ENSMUSP00000041082  .................................RPNSDIQQWLQGLQPL-------TEAQSHRVSCEVEPPGt...SD
ENSMUSP00000124908  .................................SANEDLLHLLTLSLDLFY-----TEDEIYELSYAREPRC....--
ENSMUSP00000140055  .................................PILPHVQKYLNSVQYIEE-LQKFVEDDNYKLSLKIEPG-....--
ENSMUSP00000140342  .................................PILPHVQKYLNSVQYIEE-LQKFVEDDNYKLSLKIEPG-....--
ENSMUSP00000140230  .................................PILPHVQKYLNSVQYIEE-LQKFVEDDNYKLSLKIEPG-....--
ENSMUSP00000027886  .................................PILPHVQKYLNSVQYIEE-LQKFVEDDNYKLSLKIEPG-....--
ENSMUSP00000139618  .................................PILPHVQKYLNSVQYIEE-LQKFVEDDNYKLSLKIEPG-....--
ENSMUSP00000063872  .................................PILPHVQKYLNSVQYIEE-LQKFVEDDNYKLSLKIEPG-....--
ENSMUSP00000130581  .................................PILPHVQKYLNSVQYIEE-LQKFVEDDNYKLSLKIEPG-....--
ENSMUSP00000139645  .................................PILPHVQKYLNSVQYIEE-LQKFVEDDNYKLSLKIEPG-....--
ENSMUSP00000108790  .................................TTLPHVQKYLKSVRYIEE-LQKFVEDDNYKLSLRIEPGS....SS
ENSMUSP00000088563  .................................TTLPHVQKYLKSVRYIEE-LQKFVEDDNYKLSLRIEPGS....SS
ENSMUSP00000132533  .................................PILPHVQKYLNSVQYIEE-LQKFVEDDNYKLSLKIEPG-....--
ENSMUSP00000048451  .................................TTLPHVQKYLKSVRYIEE-LQKFVEDDNYKLSLRIEPGS....SS
ENSMUSP00000108789  .................................---------------------------------------....--
ENSMUSP00000135317  .........................cseqslstRSPASTWAYVQQLK------VIDNQRELSRLSRELEP--....--
ENSMUSP00000115747  .................................SPDPKLQAHLKQ---------------------------....--
ENSMUSP00000050586  .................................SPDPKLQAHLKQ---------------------------....--
ENSMUSP00000121635  .................................---------------------------------------....--
ENSMUSP00000039186  .................................---------------------------------------....--
ENSMUSP00000130604  .................................SRKNSLKDKARWQFIIGD--LLDSENDIFEKSKECDPHG....--
ENSMUSP00000138360  .................................SRKNSLKDKARWQFIIGD--LLDSENDIFEKSKECDPHG....--
ENSMUSP00000138330  .................................SRKNSLKDKARWQFIIGD--LLDSENDIFEKSKECDPHG....--
ENSMUSP00000136756  .................................---------------------------------------....--
ENSMUSP00000029766  .................................VSVPLLMPLVTLMERQAVTFEGTDMWENNDESCEI----....--
ENSMUSP00000139822  .................................---------------------------------------....--
ENSMUSP00000104523  .................................---------------------------------------....--
ENSMUSP00000071368  .................................---------------------------------------....--
ENSMUSP00000120630  .................................---------------------------------------....--
ENSMUSP00000108868  .................................---------------------------------------....--
ENSMUSP00000073866  .................................---------------------------------------....--
ENSMUSP00000031624  .................................---------------------------------------....--
ENSMUSP00000115092  .................................---------------------------------------....--
ENSMUSP00000116215  .................................---------------------------------------....--
ENSMUSP00000073399  .................................---------------------------------------....--
ENSMUSP00000106227  .................................---------------------------------------....--
ENSMUSP00000106225  .................................---------------------------------------....--
ENSMUSP00000106229  .................................---------------------------------------....--
ENSMUSP00000136434  .................................---------------------------------------....--
ENSMUSP00000106226  .................................---------------------------------------....--
ENSMUSP00000076380  .................................---------------------------------------....--
ENSMUSP00000106241  .................................---------------------------------------....--
ENSMUSP00000106228  .................................---------------------------------------....--
ENSMUSP00000134203  .................................---------------------------------------....--
ENSMUSP00000036997  .................................---------------------------------------....--
ENSMUSP00000136735  .................................---------------------------------------....--
ENSMUSP00000123036  .................................---------------------------------------....--
ENSMUSP00000109099  .................................---------------------------------------....--
ENSMUSP00000109100  .................................---------------------------------------....--
ENSMUSP00000109103  .................................---------------------------------------....--
ENSMUSP00000031501  .................................---------------------------------------....--
ENSMUSP00000032648  .................................---------------------------------------....--
ENSMUSP00000109096  .................................---------------------------------------....--
ENSMUSP00000115401  .................................---------------------------------------....--
ENSMUSP00000120949  .................................---------------------------------------....--
ENSMUSP00000134312  .................................RPNSDIQQWLQGLQPL-------TEAQSHRVSCEVEPPGt...SD
ENSMUSP00000117681  .................................---------------------------------------....--


                      460       470       480                 
                        |         |         |                 
d1nvus_               PLPRFPKKYSYPLKSPGVRPS---npr.............
ENSMUSP00000067786  PLPRFPKKYSYPLKSPGVRP----s...............
ENSMUSP00000138589  PPRFPRKSTFSLK-----------spgir...........
ENSMUSP00000044866  PPRFPRKSTFSLK-----------spgir...........
ENSMUSP00000138793  PPRFPRKSTFSLK-----------spgir...........
ENSMUSP00000109526  TLRSKKSTAIVKRWSDR-------qap.............
ENSMUSP00000028170  TLRSKKSTAIVKRWSDR-------qap.............
ENSMUSP00000097812  TLRSKKSTAIVKRWSDR-------qap.............
ENSMUSP00000129652  IEKDRWKSLRS-------------sl..............
ENSMUSP00000031276  IEKDRWKSLRS-------------sl..............
ENSMUSP00000027760  NTTSPKPRKSMVK-----------rls.............
ENSMUSP00000107490  NTTSPKPRKSMVK-----------rls.............
ENSMUSP00000107488  NTTSPKPRKSMVK-----------rls.............
ENSMUSP00000116892  ------------------------................
ENSMUSP00000034912  ------------------------................
ENSMUSP00000096930  ------------------------................
ENSMUSP00000028525  ------------------------r...............
ENSMUSP00000099759  ------------------------r...............
ENSMUSP00000088336  ------------------------r...............
ENSMUSP00000114119  LPKNPGDKKPVKS-----------etspvap.........
ENSMUSP00000113778  LPKNPGDKKPVKS-----------etspvap.........
ENSMUSP00000090829  TEKERWKSL---------------rs..............
ENSMUSP00000065619  TEKERWKSL---------------rs..............
ENSMUSP00000128947  IEKDRWKSLRS-------------sl..............
ENSMUSP00000092114  ------------------------tltknlt.........
ENSMUSP00000104522  ------------------------tltknlt.........
ENSMUSP00000099804  ------------------------tltknlt.........
ENSMUSP00000098766  ------------------------tltknlt.........
ENSMUSP00000105313  ------------------------................
ENSMUSP00000132244  MEKDSWKALRT-------------tl..............
ENSMUSP00000135238  ------------------------................
ENSMUSP00000116426  ------------------------................
ENSMUSP00000092828  SPTTPNKPVVPLEWASEVVPK---p...............
ENSMUSP00000129393  SPTTPNKPVVPLEWASEVVPK---p...............
ENSMUSP00000099593  PPLTPSKPPVVVDWASGVSPKP--d...............
ENSMUSP00000136423  PPLTPSKPPVVVDWASGVSPKP--d...............
ENSMUSP00000117631  ------------------------................
ENSMUSP00000099936  ------------------------................
ENSMUSP00000088680  ------------------------................
ENSMUSP00000092703  ------------------------................
ENSMUSP00000035726  CPS---------------------sp..............
ENSMUSP00000134167  APS---------------------vfkn............
ENSMUSP00000090828  TEKERWKSL---------------rs..............
ENSMUSP00000134592  APS---------------------vfkn............
ENSMUSP00000118148  ------------------------................
ENSMUSP00000133449  APS---------------------vfkn............
ENSMUSP00000134027  APS---------------------vfkn............
ENSMUSP00000041135  SPTSPTS-----------------ct..............
ENSMUSP00000109104  SPTSPTS-----------------ct..............
ENSMUSP00000129873  SPTSPTS-----------------ct..............
ENSMUSP00000120126  ------------------------................
ENSMUSP00000124183  LPPSPFKAPVVVEWAQGVTPKP--d...............
ENSMUSP00000032811  LPPSPFKAPVVVEWAQGVTPKP--d...............
ENSMUSP00000125137  LPPSPFKAPVVVEWAQGVTPKP--d...............
ENSMUSP00000103103  ------------------------an..............
ENSMUSP00000092200  LPPSPFKAPVVVEWAQGVTPKP--d...............
ENSMUSP00000123718  LPPSPFKAPVVVEWAQGVTPKP--d...............
ENSMUSP00000041082  ------------------------spaartprptlvitqw
ENSMUSP00000124908  ------------------------pk..............
ENSMUSP00000140055  ------------------------ast.............
ENSMUSP00000140342  ------------------------ast.............
ENSMUSP00000140230  ------------------------ast.............
ENSMUSP00000027886  ------------------------ast.............
ENSMUSP00000139618  ------------------------ast.............
ENSMUSP00000063872  ------------------------ast.............
ENSMUSP00000130581  ------------------------ast.............
ENSMUSP00000139645  ------------------------ast.............
ENSMUSP00000108790  PRLVSSK-----------------edlag...........
ENSMUSP00000088563  PRLVSSK-----------------edlag...........
ENSMUSP00000132533  ------------------------ast.............
ENSMUSP00000048451  PRLVSSK-----------------edlag...........
ENSMUSP00000108789  ------------------------itcs............
ENSMUSP00000135317  ------------------------................
ENSMUSP00000115747  ------------------------ria.............
ENSMUSP00000050586  ------------------------ria.............
ENSMUSP00000121635  ------------------------................
ENSMUSP00000039186  ------------------------l...............
ENSMUSP00000130604  SEESQKAFDHGTELIP--------wyvls...........
ENSMUSP00000138360  SEESQKAFDHGTELIP--------wyvls...........
ENSMUSP00000138330  SEESQKAFDHGTELIP--------wyvls...........
ENSMUSP00000136756  ------------------------lk..............
ENSMUSP00000029766  LLNHLATARFMAEASESYRMN---a...............
ENSMUSP00000139822  ------------------------................
ENSMUSP00000104523  ------------------------vrlkric.........
ENSMUSP00000071368  ------------------------dasr............
ENSMUSP00000120630  ------------------------................
ENSMUSP00000108868  ------------------------klkpflk.........
ENSMUSP00000073866  ------------------------klkpflk.........
ENSMUSP00000031624  ------------------------asr.............
ENSMUSP00000115092  ------------------------................
ENSMUSP00000116215  ------------------------ggpqdqlknww.....
ENSMUSP00000073399  ------------------------ialnteevvqst....
ENSMUSP00000106227  ------------------------dqe.............
ENSMUSP00000106225  ------------------------edqe............
ENSMUSP00000106229  ------------------------dqe.............
ENSMUSP00000136434  ------------------------edqe............
ENSMUSP00000106226  ------------------------qea.............
ENSMUSP00000076380  ------------------------edqe............
ENSMUSP00000106241  ------------------------dqe.............
ENSMUSP00000106228  ------------------------qeai............
ENSMUSP00000134203  ------------------------qeai............
ENSMUSP00000036997  ------------------------qea.............
ENSMUSP00000136735  ------------------------ea..............
ENSMUSP00000123036  ------------------------ss..............
ENSMUSP00000109099  ------------------------ssl.............
ENSMUSP00000109100  ------------------------ssl.............
ENSMUSP00000109103  ------------------------ssl.............
ENSMUSP00000031501  ------------------------reppsmle........
ENSMUSP00000032648  ------------------------nvpfgdg.........
ENSMUSP00000109096  ------------------------l...............
ENSMUSP00000115401  ------------------------................
ENSMUSP00000120949  ------------------------np..............
ENSMUSP00000134312  S-----------------------paartprptlvitqw.
ENSMUSP00000117681  ------------------------................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0041591 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Ichthyophthirius multifiliis strain G5
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Waddlia chondrophila WSU 86-1044
NoYes   Candidatus Protochlamydia amoebophila UWE25
NoYes   Parachlamydia acanthamoebae UV-7
NoYes   Legionella longbeachae NSW150
NoYes   Legionella pneumophila str. Corby
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Cryptococcus neoformans var. grubii H99
NoYes   Cryptococcus neoformans B-3501A
NoYes   Cryptococcus neoformans JEC21
NoYes   Paracoccidioides brasiliensis Pb01
NoYes   Paracoccidioides brasiliensis Pb03
NoYes   Coccidioides posadasii str. Silveira
NoYes   Coccidioides immitis RMSCC 3703
NoYes   Coccidioides immitis RMSCC 2394
NoYes   Coccidioides immitis H538.4
NoYes   Ajellomyces dermatitidis ER-3
NoYes   Histoplasma capsulatum H143
NoYes   Histoplasma capsulatum H88
NoYes   Histoplasma capsulatum G186AR
NoYes   Aspergillus fumigatus A1163
NoYes   Candida albicans WO-1
NoYes   Saccharomyces cerevisiae UC5
NoYes   Saccharomyces cerevisiae PW5
NoYes   Saccharomyces cerevisiae FL100
NoYes   Saccharomyces cerevisiae CLIB324
NoYes   Saccharomyces cerevisiae CBS7960
NoYes   Saccharomyces cerevisiae YJM269
NoYes   Saccharomyces cerevisiae T7
NoYes   Saccharomyces cerevisiae FostersB
NoYes   Saccharomyces cerevisiae FostersO
NoYes   Saccharomyces cerevisiae Vin13
NoYes   Saccharomyces cerevisiae LalvinQA23
NoYes   Saccharomyces cerevisiae AWRI796
NoYes   Saccharomyces cerevisiae Sigma1278b
NoYes   Saccharomyces cerevisiae W303
NoYes   Saccharomyces cerevisiae JAY291
NoYes   Saccharomyces cerevisiae AWRI1631
NoYes   Saccharomyces cerevisiae YPS163
NoYes   Saccharomyces cerevisiae M22
NoYes   Saccharomyces cerevisiae CLIB215
NoYes   Saccharomyces cerevisiae Y10
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae SGD - Baker's yeast
NoYes   Schizosaccharomyces pombe 972h-
NoYes   Batrachochytrium dendrobatidis JEL423
NoYes   Batrachochytrium dendrobatidis JAM81
NoYes   Legionella pneumophila str. Paris
NoYes   Legionella pneumophila str. Lens
NoYes   Legionella pneumophila subsp. pneumophila LPE509
NoYes   Legionella pneumophila subsp. pneumophila str. Thunder Bay
NoYes   Legionella pneumophila subsp. pneumophila str. Philadelphia 1
NoYes   Legionella pneumophila subsp. pneumophila
NoYes   Legionella pneumophila subsp. pneumophila
NoYes   Legionella pneumophila subsp. pneumophila ATCC 43290
NoYes   Legionella pneumophila 2300/99 Alcoy
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Caenorhabditis elegans 69_215 - Roundworm
NoYes   Saccharomyces cerevisiae 69_4 - Baker's yeast
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Loa loa v3.3 - Eye worm
NoYes   Wuchereria bancrofti v1.0 - Agent of lymphatic filariasis
NoYes   Brugia malayi v1.0 - Agent of lymphatic filariasis
NoYes   Moniliophthora perniciosa FA553
NoYes   Encephalitozoon intestinalis
NoYes   Encephalitozoon cuniculi
NoYes   Air microbial communities Singapore indoor air filters 2 (meta-genome)
NoYes   Atta cephalotes fungus garden (ACEF) (meta-genome)
NoYes   Bath Hot Springs, planktonic community (meta-genome)
NoYes   Dump bottom (Dump bottom) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden bottom (Fungus garden bottom) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 02(H) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formaldehyde enrichment (meta-genome)
NoYes   Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine (MPB hybrid beetle) (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+ (Oak Ridge elevated CO2) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- (Oak Ridge ambient) (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Uniprot 2018_03 genome
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI viral sequences (Viral)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]