SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Ankyrin repeat alignments in Homo sapiens

These alignments are sequences aligned to the 0049331 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1s70b_                             mkmada..........................................................
gi|21361135|ref|NP_002494.2|      gy..............................................................
gi|70780355|ref|NP_065210.2|      ltplhvasfmghlpivknllqrgaspnvsnvkvet.............................
gi|215598574|ref|NP_001135918.1|  ltplhvasfmghlpivknllqrgaspnvsnvkvet.............................
gi|70780353|ref|NP_065208.2|      ltplhvasfmghlpivknllqrgaspnvsnvkvet.............................
gi|70780359|ref|NP_065209.2|      ltplhvasfmghlpivknllqrgaspnvsnvkvet.............................
gi|70780357|ref|NP_000028.3|      ltplhvasfmghlpivknllqrgaspnvsnvkvet.............................
gi|325053666|ref|NP_001191332.1|  ltpihvaafmghvnivsqlmhhgaspnttnvrgetalhmaarsgqaevvrylvqdgaqveakak
gi|325053668|ref|NP_001191333.1|  ltpihvaafmghvnivsqlmhhgaspnttnvrgetalhmaarsgqaevvrylvqdgaqveakak
gi|32967601|ref|NP_066267.2|      ltpihvaafmghvnivsqlmhhgaspnttnvrgetalhmaarsgqaevvrylvqdgaqveakak
gi|188595682|ref|NP_001120965.1|  ltpihvaafmghlnivllllqngaspdvtnirgetalhmaaragqvevvrcllrngalvdarar
gi|52426737|ref|NP_066187.2|      ltpihvaafmghlnivllllqngaspdvtnirgetalhmaaragqvevvrcllrngalvdarar
gi|52426735|ref|NP_001139.3|      ltpihvaafmghlnivllllqngaspdvtnirgetalhmaaragqvevvrcllrngalvdarar
gi|268607595|ref|NP_001161354.1|  alcvpaskghasvvsllidrgaevdhcdkdgmt...............................
gi|62988328|ref|NP_065070.1|      alcvpaskghasvvsllidrgaevdhcdkdgmt...............................
gi|48928017|ref|NP_001001716.1|   rfsagtey........................................................
gi|70780353|ref|NP_065208.2|      tttkkgnt........................................................
gi|70780355|ref|NP_065210.2|      tttkkgnt........................................................
gi|70780359|ref|NP_065209.2|      tttkkgnt........................................................
gi|70780357|ref|NP_000028.3|      tttkkgnt........................................................
gi|215598574|ref|NP_001135918.1|  tttkkgnt........................................................
gi|325053668|ref|NP_001191333.1|  llqreanvdaatkkgnt...............................................
gi|32967601|ref|NP_066267.2|      llqreanvdaatkkgnt...............................................
gi|304434687|ref|NP_710181.2|     plvqaifsgdpeeirmlihktedvntldsekrtplhvaaflgdaeiiellilsgarvnakdnmw
gi|30425444|ref|NP_848605.1|      vt..............................................................
gi|304361757|ref|NP_001182027.1|  vklllsrganinafdkkdrr............................................
gi|304361760|ref|NP_001182028.1|  vklllsrganinafdkkdrr............................................
gi|46519151|ref|NP_060448.1|      laeacsdgdvnavrklldegrsvnehteegesllclacsagyyelaqvllamhanvedrgnkgd
gi|46519154|ref|NP_078944.2|      laeacsdgdvnavrklldegrsvnehteegesllclacsagyyelaqvllamhanvedrgnkgd
gi|157743284|ref|NP_775866.2|     plvqaifsrdveevrsllsqkeninvldqerrt...............................
gi|55741641|ref|NP_065789.1|      palkallekckdvdernecgqt..........................................
gi|10863929|ref|NP_066956.1|      ednhl...........................................................
gi|308044526|ref|NP_001183959.1|  l...............................................................
gi|41327754|ref|NP_065690.2|      qdvdlaldsgasl...................................................
gi|38683816|ref|NP_942592.1|      snhdt...........................................................
gi|38683807|ref|NP_115593.3|      snhdt...........................................................
gi|304434690|ref|NP_001182073.1|  p...............................................................
gi|46519147|ref|NP_060217.1|      s...............................................................
gi|37620163|ref|NP_065741.3|      s...............................................................
gi|304361757|ref|NP_001182027.1|  cleyllrndanpgirdkqgynavhysaayghrlclqliasetpldvlmetsgtdmlsdsdnrat
gi|304361760|ref|NP_001182028.1|  cleyllrndanpgirdkqgynavhysaayghrlclqliasetpldvlmetsgtdmlsdsdnrat
gi|37620163|ref|NP_065741.3|      snhdtaltlacaggheelvsvliardakiehrdkkgft..........................
gi|46519147|ref|NP_060217.1|      snhdtaltlacaggheelvsvliardakiehrdkkgft..........................
gi|68131557|ref|NP_056014.2|      ................................................................
gi|96975023|ref|NP_874362.3|      lheaarqnnvgrmqeligrrvntrarnhvgrvalhwaagagheqavrllleheaavdeedavga
gi|10092619|ref|NP_065390.1|      d...............................................................
gi|38683816|ref|NP_942592.1|      s...............................................................
gi|38683807|ref|NP_115593.3|      s...............................................................
gi|157739945|ref|NP_079461.2|     nikvsrllilgganinyrtevlnnapilcvqs................................
gi|18252778|ref|NP_057234.2|      ................................................................
gi|89363047|ref|NP_004929.2|      nddnvpglqhllgslsnydvnqpnkhgtp...................................
gi|321117514|ref|NP_001189358.1|  ................................................................
gi|223634006|ref|NP_001138682.1|  qgwgh...........................................................
gi|341914599|ref|XP_001714535.3|  rt..............................................................
gi|341915319|ref|XP_001128459.4|  rt..............................................................
gi|34304379|ref|NP_899068.1|      lnwqdyegrt......................................................
gi|225543463|ref|NP_001139381.1|  nvkvsrllilgganvnyrtevlnnapilcvq.................................
gi|34304381|ref|NP_055240.2|      lnwqdyegrt......................................................
gi|225543461|ref|NP_203752.2|     nvkvsrllilgganvnyrtevlnnapilcvq.................................
gi|325053666|ref|NP_001191332.1|  tkgkvrlp........................................................
gi|68131557|ref|NP_056014.2|      t...............................................................
gi|52426735|ref|NP_001139.3|      kgkvrlp.........................................................
gi|4506217|ref|NP_002805.1|       t...............................................................
gi|188595682|ref|NP_001120965.1|  kgkvrlp.........................................................
gi|52426737|ref|NP_066187.2|      p...............................................................
gi|224465233|ref|NP_079033.4|     q...............................................................
gi|164664508|ref|NP_005169.2|     e...............................................................
gi|7705748|ref|NP_057062.1|       vnlnyrtenglsllhlccicggkkshirtlmlkglrpsrltrngft..................
gi|313569861|ref|NP_001186256.1|  vnlnyrtenglsllhlccicggkkshirtlmlkglrpsrltrngft..................
gi|163914396|ref|NP_001106279.1|  vnlnyrtenglsllhlccicggkkshirtlmlkglrpsrltrngft..................
gi|87239981|ref|NP_003738.2|      ................................................................
gi|13376842|ref|NP_079511.1|      ................................................................
gi|7705831|ref|NP_057199.1|       vg..............................................................
gi|255982572|ref|NP_001157637.1|  vg..............................................................
gi|338797777|ref|NP_001229742.1|  ................................................................
gi|338797775|ref|NP_055757.3|     ................................................................
gi|338797766|ref|NP_001229738.1|  ................................................................
gi|338797770|ref|NP_001229740.1|  ................................................................
gi|206597522|ref|NP_001128663.1|  dnaaklhslceavktrdifgllqayadgvdltekiplanghep.....................
gi|4502249|ref|NP_003878.1|       dnaaklhslceavktrdifgllqayadgvdltekiplanghep.....................
gi|304434690|ref|NP_001182073.1|  rt..............................................................
gi|157743284|ref|NP_775866.2|     rkrkwt..........................................................
gi|46094081|ref|NP_060952.2|      ssaklnelleaiksrdllaliqvyaegvelmepllepg..........................
gi|13376842|ref|NP_079511.1|      ................................................................
gi|87239981|ref|NP_003738.2|      ................................................................
gi|156142197|ref|NP_006700.3|     q...............................................................
gi|156142199|ref|NP_079532.5|     q...............................................................
gi|92087060|ref|NP_563616.3|      lveaikqghipelqeyvkykyamdeadekgwfplheavvqpiqqileivldasyktlwefktcd
gi|70995267|ref|NP_775776.2|      ................................................................
gi|219842212|ref|NP_001137357.1|  kqkr............................................................
gi|4505317|ref|NP_002471.1|       kqkr............................................................
gi|116534990|ref|NP_015628.2|     ff..............................................................
gi|282394038|ref|NP_001164160.1|  val.............................................................
gi|282394032|ref|NP_001164157.1|  val.............................................................
gi|282394030|ref|NP_543151.2|     val.............................................................
gi|282394036|ref|NP_001164159.1|  val.............................................................
gi|282394034|ref|NP_001164158.1|  val.............................................................
gi|58331111|ref|NP_061919.1|      a...............................................................
gi|58331113|ref|NP_001009941.1|   a...............................................................
gi|268607595|ref|NP_001161354.1|  qevl............................................................
gi|62988328|ref|NP_065070.1|      qevl............................................................
gi|221307473|ref|NP_001137250.1|  ctpepqrlwtaicnrdllsvleafangqdfgqplpgpdaqapeel...................
gi|19923540|ref|NP_060177.2|      ctpepqrlwtaicnrdllsvleafangqdfgqplpgpdaqapeel...................
gi|140161500|ref|NP_056060.2|     leaartghlpavekllsgkrlssgfgggggggsggggggsgggggglgssshplssllsmw...
gi|224809478|ref|NP_001138997.1|  nknd............................................................
gi|224809468|ref|NP_056392.2|     dr..............................................................
gi|224809470|ref|NP_001138992.1|  dr..............................................................
gi|224809472|ref|NP_001138993.1|  dr..............................................................
gi|224809474|ref|NP_001138994.1|  dr..............................................................
gi|18079216|ref|NP_065815.1|      q...............................................................
gi|224809476|ref|NP_001138995.1|  dr..............................................................
gi|217416347|ref|NP_065804.2|     ................................................................
gi|341915690|ref|XP_003403588.1|  ddsafmep........................................................
gi|239745058|ref|XP_002343353.1|  ddsafmep........................................................
gi|341915688|ref|XP_003403587.1|  ddsafmep........................................................
gi|310118968|ref|XP_003118905.1|  pqyp............................................................
gi|30348954|ref|NP_065825.1|      e...............................................................
gi|310118966|ref|XP_001717815.3|  pqyp............................................................
gi|71274109|ref|NP_004547.2|      ................................................................
gi|110431370|ref|NP_113663.2|     qaarqgeldvlrslhaagllgpslrdpldal.................................
gi|256222430|ref|NP_079466.3|     hyyi............................................................
gi|28626517|ref|NP_056383.1|      vsfeasv.........................................................
gi|53828703|ref|NP_001005365.2|   epryhv..........................................................
gi|239747114|ref|XP_002343914.1|  safmepr.........................................................
gi|153792284|ref|NP_778146.2|     fmepry..........................................................
gi|52856434|ref|NP_001005356.1|   fmepr...........................................................
gi|50511945|ref|NP_690001.3|      leaartgnvalvekllsgrkggilgggsgplplsnllsiw........................
gi|148596917|ref|NP_660278.3|     trepisse........................................................
gi|209977003|ref|NP_001129685.1|  fmepr...........................................................
gi|212549546|ref|NP_001131143.1|  dsafmepr........................................................
gi|256222280|ref|NP_001157787.1|  fpq.............................................................
gi|224282147|ref|NP_001138914.1|  fmepr...........................................................
gi|259155302|ref|NP_001158884.1|  ................................................................
gi|121582655|ref|NP_653299.3|     nrhdq...........................................................
gi|68131557|ref|NP_056014.2|      cl..............................................................
gi|34577122|ref|NP_003989.2|      ................................................................
gi|153791352|ref|NP_001093241.1|  fmepryh.........................................................
gi|103471993|ref|NP_056151.2|     ddystwd.........................................................
gi|134133226|ref|NP_001077007.1|  fmepryh.........................................................
gi|268607514|ref|NP_001161330.1|  vf..............................................................
gi|268607512|ref|NP_001161329.1|  vf..............................................................
gi|30089994|ref|NP_078984.2|      i...............................................................
gi|22208957|ref|NP_078977.2|      ve..............................................................
gi|22208951|ref|NP_665862.1|      kt..............................................................
gi|320202950|ref|NP_001188894.1|  kt..............................................................
gi|37620163|ref|NP_065741.3|      sl..............................................................
gi|46519147|ref|NP_060217.1|      sl..............................................................
gi|38176283|ref|NP_937886.1|      i...............................................................
gi|88953571|ref|XP_933678.1|      afvepr..........................................................
gi|113413200|ref|XP_934799.2|     afvepr..........................................................
gi|268607506|ref|NP_002472.2|     vf..............................................................
gi|118150656|ref|NP_062618.2|     dlkk............................................................
gi|38683816|ref|NP_942592.1|      e...............................................................
gi|38683807|ref|NP_115593.3|      e...............................................................
gi|304434690|ref|NP_001182073.1|  l...............................................................
gi|215598806|ref|NP_543147.2|     lq..............................................................
gi|52486194|ref|NP_003551.2|      iscanca.........................................................
gi|294337038|ref|NP_001135932.2|  wqavlagdvgcvsriladsstglapdsvfdtsdperwrdfrfn.....................
gi|294337037|ref|NP_001135931.2|  wqavlagdvgcvsriladsstglapdsvfdtsdperwrdfrfn.....................
gi|116875852|ref|NP_065822.2|     t...............................................................
gi|117320527|ref|NP_002493.3|     ................................................................
gi|117320540|ref|NP_001070961.1|  ................................................................
gi|117320531|ref|NP_001070962.1|  ................................................................
gi|313760592|ref|NP_001186491.1|  iscanca.........................................................
gi|52486251|ref|NP_001004426.1|   iscanca.........................................................
gi|16975496|ref|NP_219499.1|      rp..............................................................
gi|52426737|ref|NP_066187.2|      f...............................................................
gi|341914805|ref|XP_003403867.1|  rk..............................................................
gi|60115723|ref|NP_001012421.1|   lqk.............................................................
gi|60460920|ref|NP_001012419.1|   lqk.............................................................
gi|156104901|ref|NP_115626.2|     lqk.............................................................
gi|341914105|ref|XP_001715780.3|  gyrvrq..........................................................
gi|149363679|ref|NP_001092275.1|  lqk.............................................................
gi|188595682|ref|NP_001120965.1|  f...............................................................
gi|14249672|ref|NP_116291.1|      v...............................................................
gi|341915999|ref|XP_292717.9|     gyrvrq..........................................................
gi|157743284|ref|NP_775866.2|     hv..............................................................
gi|222537750|ref|NP_001138501.1|  lgk.............................................................
gi|325053666|ref|NP_001191332.1|  r...............................................................
gi|283549153|ref|NP_671728.2|     rk..............................................................
gi|155969701|ref|NP_919288.2|     d...............................................................
gi|312147315|ref|NP_001185879.1|  kvhfnl..........................................................
gi|62177127|ref|NP_055826.1|      vhfnlt..........................................................
gi|90186267|ref|NP_078945.2|      evdltmv.........................................................
gi|134244285|ref|NP_000426.2|     ................................................................
gi|56550047|ref|NP_001008225.1|   kydd............................................................
gi|67906195|ref|NP_775822.3|      l...............................................................
gi|267844887|ref|NP_001136205.2|  et..............................................................
gi|47933346|ref|NP_061901.2|      iv..............................................................
gi|110815813|ref|NP_057460.3|     ................................................................
gi|55770876|ref|NP_004548.3|      d...............................................................
gi|59850762|ref|NP_060473.2|      ydd.............................................................
gi|18254476|ref|NP_543150.1|      qgsw............................................................
gi|310114187|ref|XP_003119912.1|  gd..............................................................
gi|148833508|ref|NP_060087.3|     m...............................................................
gi|7657265|ref|NP_056137.1|       y...............................................................
gi|34304379|ref|NP_899068.1|      sqv.............................................................
gi|34304381|ref|NP_055240.2|      sqv.............................................................
gi|38327522|ref|NP_055206.2|      fl..............................................................
gi|115495445|ref|NP_443723.2|     kt..............................................................
gi|17981699|ref|NP_523240.1|      gne.............................................................
gi|4502751|ref|NP_001253.1|       gne.............................................................
gi|24041035|ref|NP_077719.2|      ................................................................
gi|17864094|ref|NP_064562.1|      ta..............................................................
gi|42734375|ref|NP_597707.1|      ................................................................
gi|13443014|ref|NP_076992.1|      lmgdav..........................................................
gi|271398201|ref|NP_001162003.1|  lmgdav..........................................................
gi|60218887|ref|NP_001012428.1|   dcwa............................................................
gi|58331117|ref|NP_001009943.1|   gp..............................................................
gi|72534772|ref|NP_001026909.1|   lmgdav..........................................................
gi|18254474|ref|NP_543149.1|      yivkgnrkeaariaeeiyggi...........................................
gi|338797779|ref|NP_001229743.1|  ................................................................
gi|116325987|ref|NP_872409.2|     hw..............................................................
gi|17981702|ref|NP_524145.1|      gdrlsg..........................................................
gi|4502753|ref|NP_001791.1|       gdrlsg..........................................................
gi|126723390|ref|NP_597732.1|     er..............................................................
gi|38569426|ref|NP_071379.3|      q...............................................................
gi|38569428|ref|NP_942093.1|      q...............................................................
gi|24308163|ref|NP_061178.1|      ta..............................................................
gi|53832024|ref|NP_001005474.1|   ................................................................
gi|13899229|ref|NP_113607.1|      ................................................................
gi|14149716|ref|NP_060077.1|      l...............................................................
gi|39812133|ref|NP_065082.2|      flk.............................................................
gi|17981694|ref|NP_004927.2|      grraiqv.........................................................
gi|116063534|ref|NP_115515.2|     kdyrevek........................................................
gi|4502749|ref|NP_000068.1|       ar..............................................................
gi|304376272|ref|NP_001182061.1|  ar..............................................................
gi|32483404|ref|NP_852092.1|      kk..............................................................
gi|8051599|ref|NP_057739.1|       kk..............................................................
gi|8051597|ref|NP_002032.2|       kk..............................................................
gi|8051595|ref|NP_057738.1|       kk..............................................................
gi|8051593|ref|NP_005245.2|       kk..............................................................
gi|41327752|ref|NP_659431.5|      mflk............................................................
gi|120587025|ref|NP_057232.2|     htktglkk........................................................
gi|24586688|ref|NP_543139.4|      v...............................................................
gi|110815813|ref|NP_057460.3|     ................................................................
gi|22208964|ref|NP_665879.1|      le..............................................................
gi|157743292|ref|NP_997721.2|     l...............................................................
gi|7706379|ref|NP_057200.1|       le..............................................................
gi|217416350|ref|NP_001136115.1|  r...............................................................
gi|226817313|ref|NP_036441.2|     dhi.............................................................
gi|52426735|ref|NP_001139.3|      nas.............................................................
gi|219842214|ref|NP_001137358.1|  ................................................................
gi|13129098|ref|NP_077000.1|      aairsfph........................................................
gi|21389427|ref|NP_653219.1|      kr..............................................................
gi|271398185|ref|NP_001162002.1|  lmgdav..........................................................
gi|122937241|ref|NP_001073889.1|  tkanlkkf........................................................
gi|341915692|ref|XP_003403589.1|  ddsafmep........................................................
gi|320202942|ref|NP_001188512.1|  yivkgnrkeaariaeeiyggi...........................................
gi|116063534|ref|NP_115515.2|     tssptdc.........................................................
gi|18640738|ref|NP_570124.1|      a...............................................................
gi|50897294|ref|NP_001002920.1|   epryhv..........................................................
gi|116534990|ref|NP_015628.2|     de..............................................................
gi|154354990|ref|NP_055730.2|     rdlgk...........................................................
gi|341914820|ref|XP_003403870.1|  elqk............................................................
gi|19718741|ref|NP_542164.2|      ................................................................
gi|23510377|ref|NP_694856.1|      v...............................................................
gi|64464726|ref|NP_055973.2|      v...............................................................
gi|28605137|ref|NP_736606.1|      la..............................................................
gi|289629249|ref|NP_001166206.1|  vsfeasv.........................................................
gi|13376842|ref|NP_079511.1|      rg..............................................................
gi|87239981|ref|NP_003738.2|      r...............................................................
gi|41281709|ref|NP_640332.1|      ................................................................
gi|194018403|ref|NP_001123453.1|  eetfl...........................................................
gi|41350198|ref|NP_060174.2|      kdpsr...........................................................
gi|169403957|ref|NP_079209.3|     ................................................................
gi|169403959|ref|NP_001108588.1|  ................................................................
gi|157504499|ref|NP_940873.2|     ................................................................
gi|156142184|ref|NP_057550.3|     dgpccshpsavlgvqqtleemdferg......................................
gi|38569426|ref|NP_071379.3|      niitka..........................................................
gi|38569428|ref|NP_942093.1|      niitka..........................................................
gi|70995241|ref|NP_060134.2|      ................................................................
gi|209969812|ref|NP_001129663.1|  v...............................................................
gi|258613875|ref|NP_056308.3|     v...............................................................
gi|12746412|ref|NP_075526.1|      hqlaaqgemlylatrieqenv...........................................
gi|320461689|ref|NP_569059.3|     tkifsllqpdkeeed.................................................
gi|4758606|ref|NP_004508.1|       q...............................................................
gi|62420873|ref|NP_001014794.1|   q...............................................................
gi|62420875|ref|NP_001014795.1|   q...............................................................
gi|157266328|ref|NP_000456.2|     k...............................................................
gi|154091032|ref|NP_653191.2|     ................................................................
gi|134948558|ref|NP_056023.3|     k...............................................................
gi|134948605|ref|NP_001077094.1|  k...............................................................
gi|323362985|ref|NP_001190985.1|  k...............................................................
gi|4506499|ref|NP_003712.1|       s...............................................................
gi|21956645|ref|NP_665807.1|      cdke............................................................
gi|94721248|ref|NP_001035535.1|   cdhple..........................................................
gi|156104862|ref|NP_859063.3|     l...............................................................
gi|56676397|ref|NP_037407.4|      k...............................................................
gi|41055989|ref|NP_059990.2|      wmkledfqkhldgkdenfaa............................................
gi|304434690|ref|NP_001182073.1|  ................................................................
gi|19924156|ref|NP_604389.1|      rgnevsalpatldcdn................................................
gi|256574792|ref|NP_001157915.1|  ................................................................
gi|20270347|ref|NP_620152.1|      lrds............................................................
gi|31317252|ref|NP_065791.1|      lykmikskt.......................................................
gi|320461543|ref|NP_001073933.2|  psl.............................................................
gi|21314682|ref|NP_061116.2|      srdeqnllq.......................................................
gi|47933348|ref|NP_001001483.1|   ................................................................
gi|267844887|ref|NP_001136205.2|  dss.............................................................
gi|187608777|ref|NP_038460.4|     kgsk............................................................
gi|34304383|ref|NP_775748.2|      ................................................................
gi|256574784|ref|NP_001157912.1|  ta..............................................................
gi|8923516|ref|NP_060343.1|       rilvlte.........................................................
gi|17505200|ref|NP_062815.2|      reqdwdqhldkl....................................................
gi|38257146|ref|NP_940683.1|      nv..............................................................
gi|321267560|ref|NP_001155907.2|  sd..............................................................
gi|183396785|ref|NP_001116856.1|  na..............................................................
gi|183396783|ref|NP_001116855.1|  na..............................................................
gi|21071037|ref|NP_060215.4|      na..............................................................
gi|183396787|ref|NP_001116857.1|  na..............................................................
gi|299473797|ref|NP_001177408.1|  gtrtf...........................................................
gi|284413734|ref|NP_653309.3|     avergls.........................................................
gi|341915472|ref|XP_003403627.1|  t...............................................................
gi|341915476|ref|XP_003403594.1|  t...............................................................
gi|14150169|ref|NP_115736.1|      knifd...........................................................
gi|256574792|ref|NP_001157915.1|  s...............................................................
gi|67906195|ref|NP_775822.3|      rpdi............................................................
gi|28461129|ref|NP_064715.1|      t...............................................................
gi|166235148|ref|NP_036515.4|     esid............................................................
gi|148664246|ref|NP_665872.2|     ryhq............................................................
gi|76563940|ref|NP_005451.2|      vkegqisllphlaadnld..............................................
gi|257467559|ref|NP_001004441.2|  segns...........................................................
gi|226437606|ref|NP_001139813.1|  gns.............................................................
gi|188219549|ref|NP_115666.2|     cpsvvkkm........................................................
gi|13540606|ref|NP_110440.1|      snkd............................................................
gi|89941470|ref|NP_001034977.1|   ha..............................................................
gi|62953116|ref|NP_001017523.1|   c...............................................................
gi|4885643|ref|NP_005417.1|       lldsslege.......................................................
gi|112799849|ref|NP_001026855.2|  lldsslege.......................................................
gi|65786661|ref|NP_001018082.1|   n...............................................................
gi|56090539|ref|NP_001007534.1|   dhirqgdleqvgr...................................................
gi|118498337|ref|NP_056197.2|     hrql............................................................
gi|187608516|ref|NP_036419.3|     ly..............................................................
gi|194097375|ref|NP_872414.3|     ................................................................
gi|320202962|ref|NP_001189332.1|  rilvlte.........................................................
gi|31581522|ref|NP_004903.2|      fgsdlqytnrvdkvvinpyfglgapdyskiqipkqekwqrsmssvtedkerq............
gi|37221182|ref|NP_919437.1|      fgsdlqytnrvdkvvinpyfglgapdyskiqipkqekwqrsmssvtedkerq............
gi|37221184|ref|NP_919438.1|      fgsdlqytnrvdkvvinpyfglgapdyskiqipkqekwqrsmssvtedkerq............
gi|37221187|ref|NP_919436.1|      fgsdlqytnrvdkvvinpyfglgapdyskiqipkqekwqrsmssvtedkerq............
gi|121114287|ref|NP_056131.2|     l...............................................................
gi|194097377|ref|NP_001123487.1|  ................................................................
gi|300796386|ref|NP_665803.2|     n...............................................................
gi|218563749|ref|NP_085152.2|     ................................................................
gi|296179431|ref|NP_068765.3|     atvseea.........................................................
gi|215820635|ref|NP_001135974.1|  l...............................................................
gi|63003907|ref|NP_006654.2|      l...............................................................
gi|168229256|ref|NP_689576.4|     alreeepwa.......................................................
gi|148596953|ref|NP_061877.1|     k...............................................................
gi|7661880|ref|NP_055531.1|       da..............................................................
gi|21735483|ref|NP_659505.1|      rrhdedvpdflmhklta...............................................
gi|32171201|ref|NP_859077.1|      evdg............................................................
gi|341915877|ref|XP_001134442.4|  whh.............................................................
gi|75750529|ref|NP_057636.2|      lsmierrkr.......................................................
gi|68131557|ref|NP_056014.2|      gk..............................................................
gi|38348298|ref|NP_940895.1|      ................................................................
gi|319803120|ref|NP_001188386.1|  aq..............................................................
gi|57863263|ref|NP_938207.2|      aq..............................................................
gi|57863261|ref|NP_112562.3|      aq..............................................................
gi|341914329|ref|XP_001717391.3|  whh.............................................................
gi|51972284|ref|NP_001004354.1|   rifq............................................................
gi|41393573|ref|NP_054749.2|      hisivkhlrhsawpptllqmvhtlasngansiwehslldpaqvqsgrrkanpqdkvhpiksefi
gi|146231998|ref|NP_001078923.1|  hisivkhlrhsawpptllqmvhtlasngansiwehslldpaqvqsgrrkanpqdkvhpiksefi
gi|313102999|ref|NP_001186197.1|  l...............................................................
gi|41872507|ref|NP_003637.2|      l...............................................................
gi|313102997|ref|NP_001186196.1|  l...............................................................
gi|313103001|ref|NP_963291.2|     l...............................................................
gi|41872522|ref|NP_963290.1|      l...............................................................
gi|13899267|ref|NP_113626.1|      v...............................................................
gi|157688564|ref|NP_001099010.1|  l...............................................................
gi|18390333|ref|NP_569058.1|      aikq............................................................
gi|4758156|ref|NP_004708.1|       edha............................................................
gi|206725420|ref|NP_001128685.1|  akdlskq.........................................................
gi|206725415|ref|NP_631940.2|     akdlskq.........................................................
gi|24308163|ref|NP_061178.1|      pr..............................................................
gi|17149832|ref|NP_476511.1|      akdlskq.........................................................
gi|74315348|ref|NP_542435.2|      hdgqnttipllleiarqtdslkelvna.....................................
gi|74315350|ref|NP_061197.4|      hdgqnttipllleiarqtdslkelvna.....................................
gi|74315352|ref|NP_542436.2|      hdgqnttipllleiarqtdslkelvna.....................................
gi|74315354|ref|NP_542437.2|      hdgqnttipllleiarqtdslkelvna.....................................
gi|21237786|ref|NP_055591.2|      akdlskq.........................................................
gi|124517699|ref|NP_689558.4|     gpe.............................................................
gi|206725422|ref|NP_001128686.1|  akdlskq.........................................................
gi|17149830|ref|NP_476510.1|      akdlskq.........................................................
gi|17864094|ref|NP_064562.1|      gnfkrcinlwkyaldmqqsnldplspmtassllsfaelfsfmlq....................
gi|54607077|ref|NP_075392.2|      awmlsasdgkwdsleglltcep..........................................
gi|31982881|ref|NP_078968.3|      n...............................................................
gi|20336214|ref|NP_037399.2|      ................................................................
gi|57863304|ref|NP_056340.2|      kaflsshcyna.....................................................
gi|304361757|ref|NP_001182027.1|  ................................................................
gi|304361760|ref|NP_001182028.1|  ................................................................
gi|313102995|ref|NP_001186195.1|  li..............................................................
gi|20127551|ref|NP_057197.2|      ctddyy..........................................................
gi|38683799|ref|NP_149112.1|      cd..............................................................
gi|166795254|ref|NP_110443.3|     yp..............................................................
gi|18496983|ref|NP_056341.1|      n...............................................................
gi|313851097|ref|NP_001186499.1|  n...............................................................
gi|155969701|ref|NP_919288.2|     al..............................................................
gi|30089932|ref|NP_821066.1|      aseesrilvltelle.................................................
gi|156104878|ref|NP_055720.3|     ................................................................
gi|294459971|ref|NP_001170902.1|  iyy.............................................................
gi|22547184|ref|NP_067638.3|      diyy............................................................
gi|7661962|ref|NP_055585.1|       q...............................................................
gi|117956371|ref|NP_001071154.1|  ................................................................
gi|95147559|ref|NP_787069.3|      laakrdfm........................................................
gi|16418357|ref|NP_443087.1|      eqqer...........................................................
gi|170650694|ref|NP_001116244.1|  q...............................................................
gi|150378537|ref|NP_001092877.1|  g...............................................................
gi|80978934|ref|NP_055729.2|      llrata..........................................................
gi|5730102|ref|NP_004612.2|       ld..............................................................
gi|80978930|ref|NP_001032208.1|   llrata..........................................................
gi|269315852|ref|NP_997237.2|     plh.............................................................
gi|255982572|ref|NP_001157637.1|  ................................................................
gi|7705831|ref|NP_057199.1|       ................................................................
gi|148806877|ref|NP_597704.1|     llrat...........................................................
gi|156104893|ref|NP_597703.2|     llr.............................................................
gi|117956373|ref|NP_001071153.1|  llr.............................................................
gi|221136914|ref|NP_001137472.1|  llr.............................................................
gi|166851846|ref|NP_001071133.2|  llra............................................................
gi|339275867|ref|NP_001229858.1|  ................................................................
gi|90991702|ref|NP_078928.3|      aa..............................................................
gi|71274172|ref|NP_001025041.1|   t...............................................................
gi|22547180|ref|NP_671737.1|      rdiyy...........................................................
gi|4507687|ref|NP_003296.1|       ................................................................
gi|6912736|ref|NP_036603.1|       f...............................................................
gi|110227613|ref|NP_114152.3|     ll..............................................................
gi|194733735|ref|NP_001124170.1|  ld..............................................................
gi|209863030|ref|NP_001129429.1|  n...............................................................
gi|209863028|ref|NP_001129428.1|  n...............................................................
gi|209863026|ref|NP_001129427.1|  n...............................................................
gi|7706747|ref|NP_057263.1|       n...............................................................
gi|209863024|ref|NP_003297.1|     n...............................................................
gi|262399375|ref|NP_001161048.1|  s...............................................................
gi|262399379|ref|NP_001161049.1|  s...............................................................
gi|9966865|ref|NP_065122.1|       s...............................................................
gi|25777624|ref|NP_742024.1|      d...............................................................
gi|54112401|ref|NP_056030.1|      ih..............................................................
gi|157743267|ref|NP_001099046.1|  haw.............................................................
gi|110815813|ref|NP_057460.3|     vpvvngtsfdensfaar...............................................
gi|269847874|ref|NP_073739.3|     vfhlil..........................................................
gi|75750531|ref|NP_060314.2|      gtmrrmalsmi.....................................................
gi|7657265|ref|NP_056137.1|       nlytflylvcistktqcseedqckinkq....................................
gi|75750529|ref|NP_057636.2|      kae.............................................................
gi|257467636|ref|NP_055646.2|     kkql............................................................
gi|222352179|ref|NP_001138435.1|  gldvdagqp.......................................................
gi|222352177|ref|NP_001138434.1|  gldvdagqp.......................................................
gi|222352175|ref|NP_001138433.1|  gldvdagqp.......................................................
gi|222352173|ref|NP_004998.3|     gldvdagqp.......................................................
gi|61742817|ref|NP_001013424.1|   ................................................................
gi|239744064|ref|XP_001714838.2|  lrattdedl.......................................................
gi|222352168|ref|NP_001138432.1|  vwdgwkeflmgcllgq................................................
gi|29826341|ref|NP_055914.2|      r...............................................................
gi|284005535|ref|NP_001164637.1|  r...............................................................
gi|284005543|ref|NP_001164639.1|  r...............................................................
gi|284005537|ref|NP_001164638.1|  r...............................................................
gi|4507685|ref|NP_003295.1|       ntlne...........................................................
gi|15042961|ref|NP_149417.1|      leaedkmthril....................................................
gi|312839866|ref|NP_001186166.1|  leaedkmthril....................................................
gi|312839869|ref|NP_001186167.1|  leaedkmthril....................................................
gi|312839871|ref|NP_001186168.1|  leaedkmthril....................................................
gi|312839873|ref|NP_001186169.1|  leaedkmthril....................................................
gi|109150425|ref|NP_060559.2|     el..............................................................
gi|109150435|ref|NP_001035869.1|  el..............................................................
gi|257467636|ref|NP_055646.2|     kl..............................................................
gi|294459965|ref|NP_001170899.1|  yyr.............................................................
gi|209863032|ref|NP_001129430.1|  n...............................................................
gi|148664230|ref|NP_055929.1|     tak.............................................................
gi|114842396|ref|NP_694960.2|     gne.............................................................
gi|294459977|ref|NP_001170904.1|  yyr.............................................................
gi|22748713|ref|NP_689539.1|      valavrynrvgilrrilrtlrdfpaeerarvldrrgcsr.........................
gi|224465235|ref|NP_001138999.1|  kq..............................................................
gi|98985804|ref|NP_478104.2|      adw.............................................................
gi|17981696|ref|NP_511042.1|      gl..............................................................
gi|260763963|ref|NP_001120979.2|  ................................................................
gi|27477049|ref|NP_543144.1|      icvntilywv......................................................
gi|260763966|ref|NP_001077376.2|  ................................................................
gi|260763960|ref|NP_060405.4|     ................................................................
gi|75750531|ref|NP_060314.2|      hc..............................................................


                                                           10        20                             
                                                            |         |                             
d1s70b_                             ...............------KQKRNEQLKRWIGSETDLEPPV.....................
gi|21361135|ref|NP_002494.2|      ...............----------------------------.....................
gi|70780355|ref|NP_065210.2|      ...............PLHMAARAGHTEVAKYLLQNKAKVNA--.....................
gi|215598574|ref|NP_001135918.1|  ...............PLHMAARAGHTEVAKYLLQNKAKVNA--.....................
gi|70780353|ref|NP_065208.2|      ...............PLHMAARAGHTEVAKYLLQNKAKVNA--.....................
gi|70780359|ref|NP_065209.2|      ...............PLHMAARAGHTEVAKYLLQNKAKVNA--.....................
gi|70780357|ref|NP_000028.3|      ...............PLHMAARAGHTEVAKYLLQNKAKVNA--.....................
gi|325053666|ref|NP_001191332.1|  ...........ddqtPLHISARLGKADIVQQLLQQGASPNA--.....................
gi|325053668|ref|NP_001191333.1|  ...........ddqtPLHISARLGKADIVQQLLQQGASPNA--.....................
gi|32967601|ref|NP_066267.2|      ...........ddqtPLHISARLGKADIVQQLLQQGASPNA--.....................
gi|188595682|ref|NP_001120965.1|  ..........eeqtp-LHIASRLGKTEIVQLLLQHMAHPDA--.....................
gi|52426737|ref|NP_066187.2|      ..........eeqtp-LHIASRLGKTEIVQLLLQHMAHPDA--.....................
gi|52426735|ref|NP_001139.3|      ..........eeqtp-LHIASRLGKTEIVQLLLQHMAHPDA--.....................
gi|268607595|ref|NP_001161354.1|  ...............PLLVAAYEGHVDVVDLLLEGGADVDHTDnngrtpllaaasmghasvvnt
gi|62988328|ref|NP_065070.1|      ...............PLLVAAYEGHVDVVDLLLEGGADVDHTDnngrtpllaaasmghasvvnt
gi|48928017|ref|NP_001001716.1|   ...............----------------------------.....................
gi|70780353|ref|NP_065208.2|      ...............ALHIAALAGQDEVVRELVNYGANVNA--.....................
gi|70780355|ref|NP_065210.2|      ...............ALHIAALAGQDEVVRELVNYGANVNA--.....................
gi|70780359|ref|NP_065209.2|      ...............ALHIAALAGQDEVVRELVNYGANVNA--.....................
gi|70780357|ref|NP_000028.3|      ...............ALHIAALAGQDEVVRELVNYGANVNA--.....................
gi|215598574|ref|NP_001135918.1|  ...............ALHIAALAGQDEVVRELVNYGANVNA--.....................
gi|325053668|ref|NP_001191333.1|  ...............ALHIASLAGQAEVVKVLVTNGANVNA--.....................
gi|32967601|ref|NP_066267.2|      ...............ALHIASLAGQAEVVKVLVTNGANVNA--.....................
gi|304434687|ref|NP_710181.2|     .............ltPLHRAVASRSEEAVQVLIKHSADVNA--.....................
gi|30425444|ref|NP_848605.1|      ...............PLHFLVAQGSVEQVRLLLAHEVDVDC--.....................
gi|304361757|ref|NP_001182027.1|  ...............AIHWAAYMGHIEVVKLLVSHGAEVTC--.....................
gi|304361760|ref|NP_001182028.1|  ...............AIHWAAYMGHIEVVKLLVSHGAEVTC--.....................
gi|46519151|ref|NP_060448.1|      .............itPLMAASSGGYLDIVKLLLLHDADVNS--.....................
gi|46519154|ref|NP_078944.2|      .............itPLMAASSGGYLDIVKLLLLHDADVNS--.....................
gi|157743284|ref|NP_775866.2|     ...............PLHAAAYVGDVPILQLLLMSGANVNAKDtlwltplhraaasrnekvlgl
gi|55741641|ref|NP_065789.1|      ...............PLMIAAEQGNLEIVKELIKNGANCNL--.....................
gi|10863929|ref|NP_066956.1|      ...............-LIKAVQNEDVDLVQQLLEGGANVNFQ-.....................
gi|308044526|ref|NP_001183959.1|  ...............--AEACSDGDVNAVRKLLDEGRSVNEHTeegesllclacsagyyelaqv
gi|41327754|ref|NP_065690.2|      ...............-LHLAVEAGQEECAKWLLLNNANPNL--.....................
gi|38683816|ref|NP_942592.1|      ...............ALTLACAGGHEELVQTLLERGASIEH--.....................
gi|38683807|ref|NP_115593.3|      ...............ALTLACAGGHEELVQTLLERGASIEH--.....................
gi|304434690|ref|NP_001182073.1|  ...............PLVQAIFSGDPEEIRMLIHKTEDVNT--.....................
gi|46519147|ref|NP_060217.1|      ...............ALTLACYKGHLDMVRFLLEAGADQEH--.....................
gi|37620163|ref|NP_065741.3|      ...............ALTLACYKGHLDMVRFLLEAGADQEH--.....................
gi|304361757|ref|NP_001182027.1|  .............isPLHLAAYHGHHQALEVLVQSLLDLDV--.....................
gi|304361760|ref|NP_001182028.1|  .............isPLHLAAYHGHHQALEVLVQSLLDLDV--.....................
gi|37620163|ref|NP_065741.3|      ...............PLILAATAGHVGVVEILLDKGGDIEAQ-.....................
gi|46519147|ref|NP_060217.1|      ...............PLILAATAGHVGVVEILLDKGGDIEAQ-.....................
gi|68131557|ref|NP_056014.2|      ...............-LVQAIFNGDPDEVRALIFKKEDVNF--.....................
gi|96975023|ref|NP_874362.3|      ....ltearlcfgmnALLLSAWFGHLRILQILVNSGAKIHC--.....................
gi|10092619|ref|NP_065390.1|      ...............----------------------------.....................
gi|38683816|ref|NP_942592.1|      ...............-LAEACSEGDVNAVRKLLIEGRSVNEHTeegesllclacsagyyelaqv
gi|38683807|ref|NP_115593.3|      ...............-LAEACSEGDVNAVRKLLIEGRSVNEHTeegesllclacsagyyelaqv
gi|157739945|ref|NP_079461.2|     ...............------HLGYTEMVALLLEFGANVDA--.....................
gi|18252778|ref|NP_057234.2|      ...............PLIKAIKDGDEEALKTMIKEGKNLAE--.....................
gi|89363047|ref|NP_004929.2|      ...............PLLIAAGCGNIQILQLLIKRGSRIDV--.....................
gi|321117514|ref|NP_001189358.1|  ...............PLIKAIKDGDEEALKTMIKEGKNLAE--.....................
gi|223634006|ref|NP_001138682.1|  ...............-LLQAVWRGPAGLVTQLLRQGASVEE--.....................
gi|341914599|ref|XP_001714535.3|  ...............ALHFAVGRNHLSAVDFLLKHKARVDV--.....................
gi|341915319|ref|XP_001128459.4|  ...............ALHFAVGRNHLSAVDFLLKHKARVDV--.....................
gi|34304379|ref|NP_899068.1|      ...............PLHFAVADGNVTVVDVLTSYESCNITS-.....................
gi|225543463|ref|NP_001139381.1|  ...............-----SHLGHEEVVTLLLEFGACLDG--.....................
gi|34304381|ref|NP_055240.2|      ...............PLHFAVADGNVTVVDVLTSYESCNITS-.....................
gi|225543461|ref|NP_203752.2|     ...............-----SHLGHEEVVTLLLEFGACLDG--.....................
gi|325053666|ref|NP_001191332.1|  ...............ALHIAARKDDTKAAALLLQNDNNADV--.....................
gi|68131557|ref|NP_056014.2|      ...............PIHAAATNGHSECLRLLIGNAEPQNA--.....................
gi|52426735|ref|NP_001139.3|      ...............ALHIAARKDDTKSAALLLQNDHNADVQ-.....................
gi|4506217|ref|NP_002805.1|       ...............----------------------------.....................
gi|188595682|ref|NP_001120965.1|  ...............ALHIAARKDDTKSAALLLQNDHNADVQ-.....................
gi|52426737|ref|NP_066187.2|      ...............ALHIAARKDDTKSAALLLQNDHNADVQ-.....................
gi|224465233|ref|NP_079033.4|     ...............-LYFSARQGELQKVLLMLVDGIDPNF--.....................
gi|164664508|ref|NP_005169.2|     ...............----------------------------.....................
gi|7705748|ref|NP_057062.1|       ...............ALHLAVYKDNAELITSLLHSGADIQQ--.....................
gi|313569861|ref|NP_001186256.1|  ...............ALHLAVYKDNAELITSLLHSGADIQQ--.....................
gi|163914396|ref|NP_001106279.1|  ...............ALHLAVYKDNAELITSLLHSGADIQQ--.....................
gi|87239981|ref|NP_003738.2|      ...............-LLQAAREADLAKVKKTLALEIINFK--.....................
gi|13376842|ref|NP_079511.1|      ...............-LLQAAREADVTRIKKHLSLEMVNFK--.....................
gi|7705831|ref|NP_057199.1|       ...............---LAAREGNVKVLRKLLKKGRSVDV--.....................
gi|255982572|ref|NP_001157637.1|  ...............---LAAREGNVKVLRKLLKKGRSVDV--.....................
gi|338797777|ref|NP_001229742.1|  ...............-LLVAAYKGQTENVVQLINKGARVAV--.....................
gi|338797775|ref|NP_055757.3|     ...............-LLVAAYKGQTENVVQLINKGARVAV--.....................
gi|338797766|ref|NP_001229738.1|  ...............-LLVAAYKGQTENVVQLINKGARVAV--.....................
gi|338797770|ref|NP_001229740.1|  ...............-LLVAAYKGQTENVVQLINKGARVAV--.....................
gi|206597522|ref|NP_001128663.1|  ...............----------------------------.....................
gi|4502249|ref|NP_003878.1|       ...............----------------------------.....................
gi|304434690|ref|NP_001182073.1|  ...............PLHASVINGHTLCLRLLLEIADNPEA--.....................
gi|157743284|ref|NP_775866.2|     ...............PLHAAAASGHTDSLHLLIDSGERADI--.....................
gi|46094081|ref|NP_060952.2|      ...............----------------------------.....................
gi|13376842|ref|NP_079511.1|      ...............-LFEACRNGDVERVKRLVTPEKVNSRD-.....................
gi|87239981|ref|NP_003738.2|      ...............-LLEACRNGDVSRVKRLVDAANVNAKD-.....................
gi|156142197|ref|NP_006700.3|     ...............-LYLSVKQGELQKVILMLLDNLDPNFQ-.....................
gi|156142199|ref|NP_079532.5|     ...............-LYLSVKQGELQKVILMLLDNLDPNFQ-.....................
gi|92087060|ref|NP_563616.3|      ............getPLTLAVKAGLVENVRTLLEKGVWPNT--.....................
gi|70995267|ref|NP_775776.2|      ...............--FWAARRGNLALLKLLLNSGRVDVDC-.....................
gi|219842212|ref|NP_001137357.1|  ...............----------NEQLKRWIGSETDLEPPV.....................
gi|4505317|ref|NP_002471.1|       ...............----------NEQLKRWIGSETDLEPPV.....................
gi|116534990|ref|NP_015628.2|     ...............-LHYAAAEGQIELMEKITRDSSLEVL--.....................
gi|282394038|ref|NP_001164160.1|  ...............--------GNAARALDLLRRRPEQVD--.....................
gi|282394032|ref|NP_001164157.1|  ...............--------GNAARALDLLRRRPEQVD--.....................
gi|282394030|ref|NP_543151.2|     ...............--------GNAARALDLLRRRPEQVD--.....................
gi|282394036|ref|NP_001164159.1|  ...............--------GNAARALDLLRRRPEQVD--.....................
gi|282394034|ref|NP_001164158.1|  ...............--------GNAARALDLLRRRPEQVD--.....................
gi|58331111|ref|NP_061919.1|      ...............----------------------------.....................
gi|58331113|ref|NP_001009941.1|   ...............----------------------------.....................
gi|268607595|ref|NP_001161354.1|  ...............--------------QLLVKAGAHVNS--.....................
gi|62988328|ref|NP_065070.1|      ...............--------------QLLVKAGAHVNS--.....................
gi|221307473|ref|NP_001137250.1|  ...............----------------------------.....................
gi|19923540|ref|NP_060177.2|      ...............----------------------------.....................
gi|140161500|ref|NP_056060.2|     ...............----------------------------.....................
gi|224809478|ref|NP_001138997.1|  ...............----------------------------.....................
gi|224809468|ref|NP_056392.2|     ...............----------------------------.....................
gi|224809470|ref|NP_001138992.1|  ...............----------------------------.....................
gi|224809472|ref|NP_001138993.1|  ...............----------------------------.....................
gi|224809474|ref|NP_001138994.1|  ...............----------------------------.....................
gi|18079216|ref|NP_065815.1|      ...............----AVKAEDVGTAQRLLQRPRPGKAKLlgst.................
gi|224809476|ref|NP_001138995.1|  ...............----------------------------.....................
gi|217416347|ref|NP_065804.2|     ...............-LILAVKNGDVTGVQKLVAKVKATKTKLlgst.................
gi|341915690|ref|XP_003403588.1|  ...............----------------------------.....................
gi|239745058|ref|XP_002343353.1|  ...............----------------------------.....................
gi|341915688|ref|XP_003403587.1|  ...............----------------------------.....................
gi|310118968|ref|XP_003118905.1|  ...............----------------------------.....................
gi|30348954|ref|NP_065825.1|      ...............-LVKAAANGDVAKVEDLLKRPDVDVN--.....................
gi|310118966|ref|XP_001717815.3|  ...............----------------------------.....................
gi|71274109|ref|NP_004547.2|      ...............----------------------------.....................
gi|110431370|ref|NP_113663.2|     ...............PVHHAARAGKLHCLRFLVEEAALPAAA-.....................
gi|256222430|ref|NP_079466.3|     ...............----------------------------.....................
gi|28626517|ref|NP_056383.1|      ...............----------------------------.....................
gi|53828703|ref|NP_001005365.2|   ...............----------------------------.....................
gi|239747114|ref|XP_002343914.1|  ...............----------------------------.....................
gi|153792284|ref|NP_778146.2|     ...............----------------------------.....................
gi|52856434|ref|NP_001005356.1|   ...............----------------------------.....................
gi|50511945|ref|NP_690001.3|      ...............----------------------------.....................
gi|148596917|ref|NP_660278.3|     ...............----------------------------.....................
gi|209977003|ref|NP_001129685.1|  ...............----------------------------.....................
gi|212549546|ref|NP_001131143.1|  ...............----------------------------.....................
gi|256222280|ref|NP_001157787.1|  ...............----------------------------.....................
gi|224282147|ref|NP_001138914.1|  ...............----------------------------.....................
gi|259155302|ref|NP_001158884.1|  ...............----------------------------.....................
gi|121582655|ref|NP_653299.3|     ...............----------------------------.....................
gi|68131557|ref|NP_056014.2|      ...............--------------ELLVGNGADVNM--.....................
gi|34577122|ref|NP_003989.2|      ...............----------------------------.....................
gi|153791352|ref|NP_001093241.1|  ...............----------------------------.....................
gi|103471993|ref|NP_056151.2|     ...............----------------------------.....................
gi|134133226|ref|NP_001077007.1|  ...............----------------------------.....................
gi|268607514|ref|NP_001161330.1|  ...............----------------------------.....................
gi|268607512|ref|NP_001161329.1|  ...............----------------------------.....................
gi|30089994|ref|NP_078984.2|      ...............--QAAVAAGDVHTVRKMLEQGYSPNG--.....................
gi|22208957|ref|NP_078977.2|      ...............----------------------------.....................
gi|22208951|ref|NP_665862.1|      ...............----------------------------.....................
gi|320202950|ref|NP_001188894.1|  ...............----------------------------.....................
gi|37620163|ref|NP_065741.3|      ...............--AEACSDGDVNAVRKLLDEGRSVNE--.....................
gi|46519147|ref|NP_060217.1|      ...............--AEACSDGDVNAVRKLLDEGRSVNE--.....................
gi|38176283|ref|NP_937886.1|      ...............--QAAVAAGDVHTVRKMLEQGYSPNG--.....................
gi|88953571|ref|XP_933678.1|      ...............----------------------------.....................
gi|113413200|ref|XP_934799.2|     ...............----------------------------.....................
gi|268607506|ref|NP_002472.2|     ...............----------------------------.....................
gi|118150656|ref|NP_062618.2|     ...............----------------------------.....................
gi|38683816|ref|NP_942592.1|      ...............----------------------------.....................
gi|38683807|ref|NP_115593.3|      ...............----------------------------.....................
gi|304434690|ref|NP_001182073.1|  ...............----------------------------.....................
gi|215598806|ref|NP_543147.2|     ...............---NALYTGDLARLQELFPPHSTADLLLesraaeprwsshq........
gi|52486194|ref|NP_003551.2|      ...............----------------------------.....................
gi|294337038|ref|NP_001135932.2|  ...............-------------------------IRA.....................
gi|294337037|ref|NP_001135931.2|  ...............-------------------------IRA.....................
gi|116875852|ref|NP_065822.2|     ...............-LMPMVMADQHRSVSELLSNSKFDVN--.....................
gi|117320527|ref|NP_002493.3|     ...............----------------------------.....................
gi|117320540|ref|NP_001070961.1|  ...............----------------------------.....................
gi|117320531|ref|NP_001070962.1|  ...............----------------------------.....................
gi|313760592|ref|NP_001186491.1|  ...............----------------------------.....................
gi|52486251|ref|NP_001004426.1|   ...............----------------------------.....................
gi|16975496|ref|NP_219499.1|      ...............----------------------------.....................
gi|52426737|ref|NP_066187.2|      ...............--LRAARAGNLDKVVEYLKGGIDINT--.....................
gi|341914805|ref|XP_003403867.1|  ...............----------------------------.....................
gi|60115723|ref|NP_001012421.1|   ...............----------------------------.....................
gi|60460920|ref|NP_001012419.1|   ...............----------------------------.....................
gi|156104901|ref|NP_115626.2|     ...............----------------------------.....................
gi|341914105|ref|XP_001715780.3|  ...............----------------------------.....................
gi|149363679|ref|NP_001092275.1|  ...............----------------------------.....................
gi|188595682|ref|NP_001120965.1|  ...............--LRAARAGNLDKVVEYLKGGIDINT--.....................
gi|14249672|ref|NP_116291.1|      ...............----------------------------.....................
gi|341915999|ref|XP_292717.9|     ...............----------------------------.....................
gi|157743284|ref|NP_775866.2|     ...............----------------------------.....................
gi|222537750|ref|NP_001138501.1|  ...............----------------------------.....................
gi|325053666|ref|NP_001191332.1|  ...............----AARAGHLEKALDYIKNGVDINI--.....................
gi|283549153|ref|NP_671728.2|     ...............----------------------------.....................
gi|155969701|ref|NP_919288.2|     ...............----------------------------.....................
gi|312147315|ref|NP_001185879.1|  ...............----------------------------.....................
gi|62177127|ref|NP_055826.1|      ...............----------------------------.....................
gi|90186267|ref|NP_078945.2|      ...............--YQAASNGDVNALTAVIREDPSILEC-.....................
gi|134244285|ref|NP_000426.2|     ...............----------------------------.....................
gi|56550047|ref|NP_001008225.1|   ...............----------------------------.....................
gi|67906195|ref|NP_775822.3|      ...............----------------------------.....................
gi|267844887|ref|NP_001136205.2|  ...............-----IEKGKEDALSHLTKYHSAFGE--.....................
gi|47933346|ref|NP_061901.2|      ...............----------------------------.....................
gi|110815813|ref|NP_057460.3|     ...............----------------------------.....................
gi|55770876|ref|NP_004548.3|      ...............----------------------------.....................
gi|59850762|ref|NP_060473.2|      ...............----------------------------.....................
gi|18254476|ref|NP_543150.1|      ...............----------------------------.....................
gi|310114187|ref|XP_003119912.1|  ...............----------------------------.....................
gi|148833508|ref|NP_060087.3|     ...............----------------------------.....................
gi|7657265|ref|NP_056137.1|       ...............---KAASEGKVLTLAALLLNRSESDIRY.....................
gi|34304379|ref|NP_899068.1|      ...............--HAAAVNGDKGALQRLIVGNSALKDK-.....................
gi|34304381|ref|NP_055240.2|      ...............--HAAAVNGDKGALQRLIVGNSALKDK-.....................
gi|38327522|ref|NP_055206.2|      ...............----------------------------.....................
gi|115495445|ref|NP_443723.2|     ...............----------------------------.....................
gi|17981699|ref|NP_523240.1|      ...............----------------------------.....................
gi|4502751|ref|NP_001253.1|       ...............----------------------------.....................
gi|24041035|ref|NP_077719.2|      ...............----------------------------.....................
gi|17864094|ref|NP_064562.1|      ...............-VFNAARDGKLRLLTKLLASKSKEEV--.....................
gi|42734375|ref|NP_597707.1|      ...............----------------------------.....................
gi|13443014|ref|NP_076992.1|      ...............----------------------------.....................
gi|271398201|ref|NP_001162003.1|  ...............----------------------------.....................
gi|60218887|ref|NP_001012428.1|   ...............----------------------------.....................
gi|58331117|ref|NP_001009943.1|   ...............----------------------------.....................
gi|72534772|ref|NP_001026909.1|   ...............----------------------------.....................
gi|18254474|ref|NP_543149.1|      ...............-------------------------S--.....................
gi|338797779|ref|NP_001229743.1|  ...............----------------------------.....................
gi|116325987|ref|NP_872409.2|     ...............----------------LLWHGADITH--.....................
gi|17981702|ref|NP_524145.1|      ...............----------------------------.....................
gi|4502753|ref|NP_001791.1|       ...............----------------------------.....................
gi|126723390|ref|NP_597732.1|     ...............----------------------------.....................
gi|38569426|ref|NP_071379.3|      ...............----CVRNKDKKQIEKLTKLGYPELI--.....................
gi|38569428|ref|NP_942093.1|      ...............----CVRNKDKKQIEKLTKLGYPELI--.....................
gi|24308163|ref|NP_061178.1|      ...............-VYNAARDGKLQLLQKLLSGRSREEL--.....................
gi|53832024|ref|NP_001005474.1|   ...............----------------------------.....................
gi|13899229|ref|NP_113607.1|      ...............----------------------------.....................
gi|14149716|ref|NP_060077.1|      ...............----------------------------.....................
gi|39812133|ref|NP_065082.2|      ...............----------------------------.....................
gi|17981694|ref|NP_004927.2|      ...............----------------------------.....................
gi|116063534|ref|NP_115515.2|     ...............-LLRAVADGDLEMVRYLLEWTEEDLE--.....................
gi|4502749|ref|NP_000068.1|       ...............----------------------------.....................
gi|304376272|ref|NP_001182061.1|  ...............----------------------------.....................
gi|32483404|ref|NP_852092.1|      ...............----------------------------.....................
gi|8051599|ref|NP_057739.1|       ...............----------------------------.....................
gi|8051597|ref|NP_002032.2|       ...............----------------------------.....................
gi|8051595|ref|NP_057738.1|       ...............----------------------------.....................
gi|8051593|ref|NP_005245.2|       ...............----------------------------.....................
gi|41327752|ref|NP_659431.5|      ...............----------------------------.....................
gi|120587025|ref|NP_057232.2|     ...............----------------------------.....................
gi|24586688|ref|NP_543139.4|      ...............--HQALFSGNLQQVQALFQDEEAANMIVetvsnqlawsae.........
gi|110815813|ref|NP_057460.3|     ...............PLHKAIKVEREDVVFLYLIEMDSQLP--.....................
gi|22208964|ref|NP_665879.1|      ...............----ALKSNDFGKLKAILIQRQIDVDTVfevedenmvlasykqg.....
gi|157743292|ref|NP_997721.2|     ...............--------GDLDHLKPLMDQFFQDANVVfeinkdemewqvkspatfgl.
gi|7706379|ref|NP_057200.1|       ...............----ALKSNDFGKLKAILIQRQIDVDTVfevedenmvlasykqg.....
gi|217416350|ref|NP_001136115.1|  ...............----------------------------.....................
gi|226817313|ref|NP_036441.2|     ...............----------------------------.....................
gi|52426735|ref|NP_001139.3|      ...............-FLRAARAGNLDKVVEYLKGGIDINT--.....................
gi|219842214|ref|NP_001137358.1|  ...............----------------------------.....................
gi|13129098|ref|NP_077000.1|      ...............----------------------------.....................
gi|21389427|ref|NP_653219.1|      ...............----------------------------.....................
gi|271398185|ref|NP_001162002.1|  ...............----------------------------.....................
gi|122937241|ref|NP_001073889.1|  ...............----------------------------.....................
gi|341915692|ref|XP_003403589.1|  ...............----------------------------.....................
gi|320202942|ref|NP_001188512.1|  ...............-------------------------S--.....................
gi|116063534|ref|NP_115515.2|     ...............-LFKHIASGNQKEVERLLSQEDHDKDT-.....................
gi|18640738|ref|NP_570124.1|      ...............----------------------------.....................
gi|50897294|ref|NP_001002920.1|   ...............----------------------------.....................
gi|116534990|ref|NP_015628.2|     ...............----------------------------.....................
gi|154354990|ref|NP_055730.2|     ...............----------------------------.....................
gi|341914820|ref|XP_003403870.1|  ...............----------------------------.....................
gi|19718741|ref|NP_542164.2|      ...............-LLHHARNGNAEEVRQLLETMARNEVI-.....................
gi|23510377|ref|NP_694856.1|      ...............----------------------------.....................
gi|64464726|ref|NP_055973.2|      ...............----------------------------.....................
gi|28605137|ref|NP_736606.1|      ...............----------------------------.....................
gi|289629249|ref|NP_001166206.1|  ...............----------------------------.....................
gi|13376842|ref|NP_079511.1|      ...............----------------------------.....................
gi|87239981|ref|NP_003738.2|      ...............----------------------------.....................
gi|41281709|ref|NP_640332.1|      ...............----------------------------.....................
gi|194018403|ref|NP_001123453.1|  ...............----------------------------.....................
gi|41350198|ref|NP_060174.2|      ...............----------------------------.....................
gi|169403957|ref|NP_079209.3|     ...............----------------------------.....................
gi|169403959|ref|NP_001108588.1|  ...............----------------------------.....................
gi|157504499|ref|NP_940873.2|     ...............----------------------------.....................
gi|156142184|ref|NP_057550.3|     ...............----------------------------.....................
gi|38569426|ref|NP_071379.3|      ...............----------------------------.....................
gi|38569428|ref|NP_942093.1|      ...............----------------------------.....................
gi|70995241|ref|NP_060134.2|      ...............PLHRACRDGDLATLCSLLQQTPHAHL--.....................
gi|209969812|ref|NP_001129663.1|  ...............----------------------------.....................
gi|258613875|ref|NP_056308.3|     ...............----------------------------.....................
gi|12746412|ref|NP_075526.1|      ...............----------------------------.....................
gi|320461689|ref|NP_569059.3|     ...............----------------------------.....................
gi|4758606|ref|NP_004508.1|       ...............----------------------------.....................
gi|62420873|ref|NP_001014794.1|   ...............----------------------------.....................
gi|62420875|ref|NP_001014795.1|   ...............----------------------------.....................
gi|157266328|ref|NP_000456.2|     ...............----------------------------.....................
gi|154091032|ref|NP_653191.2|     ...............PICQAAYQNDFGQVWRWVKEDSSYAN--.....................
gi|134948558|ref|NP_056023.3|     ...............----------------------------.....................
gi|134948605|ref|NP_001077094.1|  ...............----------------------------.....................
gi|323362985|ref|NP_001190985.1|  ...............----------------------------.....................
gi|4506499|ref|NP_003712.1|       ...............-IHQLAAQGELDQLKEHLRKGDNLVNK-.....................
gi|21956645|ref|NP_665807.1|      ...............----------------------------.....................
gi|94721248|ref|NP_001035535.1|   ...............----------------------------.....................
gi|156104862|ref|NP_859063.3|     ...............----------------------------.....................
gi|56676397|ref|NP_037407.4|      ...............----------------------------.....................
gi|41055989|ref|NP_059990.2|      ...............----------------------------.....................
gi|304434690|ref|NP_001182073.1|  ...............----------------------------.....................
gi|19924156|ref|NP_604389.1|      ...............----------------------------.....................
gi|256574792|ref|NP_001157915.1|  ...............----------------------------.....................
gi|20270347|ref|NP_620152.1|      ...............----------------------------.....................
gi|31317252|ref|NP_065791.1|      ...............----------------------------.....................
gi|320461543|ref|NP_001073933.2|  ...............----------------------------.....................
gi|21314682|ref|NP_061116.2|      ...............----------------------------.....................
gi|47933348|ref|NP_001001483.1|   ...............----------------------------.....................
gi|267844887|ref|NP_001136205.2|  ...............----------------------------.....................
gi|187608777|ref|NP_038460.4|     ...............----------------------------.....................
gi|34304383|ref|NP_775748.2|      ...............----------------------------.....................
gi|256574784|ref|NP_001157912.1|  ...............TLLRAACANNVGLLRTLVRRGVSVEE--.....................
gi|8923516|ref|NP_060343.1|       ...............----------------LLERKAHSPF--.....................
gi|17505200|ref|NP_062815.2|      ...............----------------------------.....................
gi|38257146|ref|NP_940683.1|      ...............----------------------------.....................
gi|321267560|ref|NP_001155907.2|  ...............----------------------------.....................
gi|183396785|ref|NP_001116856.1|  ...............----------------------------.....................
gi|183396783|ref|NP_001116855.1|  ...............----------------------------.....................
gi|21071037|ref|NP_060215.4|      ...............----------------------------.....................
gi|183396787|ref|NP_001116857.1|  ...............----------------------------.....................
gi|299473797|ref|NP_001177408.1|  ...............----------------------------.....................
gi|284413734|ref|NP_653309.3|     ...............----------------------------.....................
gi|341915472|ref|XP_003403627.1|  ...............----------------------------.....................
gi|341915476|ref|XP_003403594.1|  ...............----------------------------.....................
gi|14150169|ref|NP_115736.1|      ...............----------------------------.....................
gi|256574792|ref|NP_001157915.1|  ...............----------------------------.....................
gi|67906195|ref|NP_775822.3|      ...............----------------------------.....................
gi|28461129|ref|NP_064715.1|      ...............----------------------------.....................
gi|166235148|ref|NP_036515.4|     ...............----------------------------.....................
gi|148664246|ref|NP_665872.2|     ...............----------------------------.....................
gi|76563940|ref|NP_005451.2|      ...............----------------------------.....................
gi|257467559|ref|NP_001004441.2|  ...............----------------------------.....................
gi|226437606|ref|NP_001139813.1|  ...............----------------------------.....................
gi|188219549|ref|NP_115666.2|     ...............----------------------------.....................
gi|13540606|ref|NP_110440.1|      ...............----------------------------.....................
gi|89941470|ref|NP_001034977.1|   ...............----------------------------.....................
gi|62953116|ref|NP_001017523.1|   ...............----------------------------.....................
gi|4885643|ref|NP_005417.1|       ...............----------------------------.....................
gi|112799849|ref|NP_001026855.2|  ...............----------------------------.....................
gi|65786661|ref|NP_001018082.1|   ...............----------------------------.....................
gi|56090539|ref|NP_001007534.1|   ...............----------------------------.....................
gi|118498337|ref|NP_056197.2|     ...............--IDCIRSKDTDALIDAIDTGAFEVN--.....................
gi|187608516|ref|NP_036419.3|     ...............----------------------------.....................
gi|194097375|ref|NP_872414.3|     ...............ALYWACVHNDPTQLQAILDGGVSPEE--.....................
gi|320202962|ref|NP_001189332.1|  ...............----------------LLERKAHSPF--.....................
gi|31581522|ref|NP_004903.2|      ...............----------------------------.....................
gi|37221182|ref|NP_919437.1|      ...............----------------------------.....................
gi|37221184|ref|NP_919438.1|      ...............----------------------------.....................
gi|37221187|ref|NP_919436.1|      ...............----------------------------.....................
gi|121114287|ref|NP_056131.2|     ...............----------------------------.....................
gi|194097377|ref|NP_001123487.1|  ...............----------------------------.....................
gi|300796386|ref|NP_665803.2|     ...............----------------------------.....................
gi|218563749|ref|NP_085152.2|     ...............----------------------------.....................
gi|296179431|ref|NP_068765.3|     ...............----------------------------.....................
gi|215820635|ref|NP_001135974.1|  ...............----------------------------.....................
gi|63003907|ref|NP_006654.2|      ...............----------------------------.....................
gi|168229256|ref|NP_689576.4|     ...............----------------------------.....................
gi|148596953|ref|NP_061877.1|     ...............----ALINGDENLACQIYENNPQLKESL.....................
gi|7661880|ref|NP_055531.1|       ...............----------------------------.....................
gi|21735483|ref|NP_659505.1|      ...............----------------------------.....................
gi|32171201|ref|NP_859077.1|      ...............----------------------------.....................
gi|341915877|ref|XP_001134442.4|  ...............----------------------------.....................
gi|75750529|ref|NP_057636.2|      ...............----------------------------.....................
gi|68131557|ref|NP_056014.2|      ...............----------------------------.....................
gi|38348298|ref|NP_940895.1|      ...............PLLQPALTGDVEGLQKIFEDPENPHHEQ.....................
gi|319803120|ref|NP_001188386.1|  ...............----------------------------.....................
gi|57863263|ref|NP_938207.2|      ...............----------------------------.....................
gi|57863261|ref|NP_112562.3|      ...............----------------------------.....................
gi|341914329|ref|XP_001717391.3|  ...............----------------------------.....................
gi|51972284|ref|NP_001004354.1|   ...............---EAVRKGNTQELQSLLQNMTNCEF--.....................
gi|41393573|ref|NP_054749.2|      rakyqmlafvhklpc----------------------------.....................
gi|146231998|ref|NP_001078923.1|  .rakyqmlafvhklp----------------------------.....................
gi|313102999|ref|NP_001186197.1|  ...............----------------------------.....................
gi|41872507|ref|NP_003637.2|      ...............----------------------------.....................
gi|313102997|ref|NP_001186196.1|  ...............----------------------------.....................
gi|313103001|ref|NP_963291.2|     ...............----------------------------.....................
gi|41872522|ref|NP_963290.1|      ...............----------------------------.....................
gi|13899267|ref|NP_113626.1|      ...............----------------------------.....................
gi|157688564|ref|NP_001099010.1|  ...............----------------------------.....................
gi|18390333|ref|NP_569058.1|      ...............----------------------------.....................
gi|4758156|ref|NP_004708.1|       ...............-ILQAVIAGDLMKLIESYKNGGSLLI--.....................
gi|206725420|ref|NP_001128685.1|  ...............----------------------------.....................
gi|206725415|ref|NP_631940.2|     ...............----------------------------.....................
gi|24308163|ref|NP_061178.1|      ...............----------------------------.....................
gi|17149832|ref|NP_476511.1|      ...............----------------------------.....................
gi|74315348|ref|NP_542435.2|      ...............----------------------------.....................
gi|74315350|ref|NP_061197.4|      ...............----------------------------.....................
gi|74315352|ref|NP_542436.2|      ...............----------------------------.....................
gi|74315354|ref|NP_542437.2|      ...............----------------------------.....................
gi|21237786|ref|NP_055591.2|      ...............----------------------------.....................
gi|124517699|ref|NP_689558.4|     ...............----------------------------.....................
gi|206725422|ref|NP_001128686.1|  ...............----------------------------.....................
gi|17149830|ref|NP_476510.1|      ...............----------------------------.....................
gi|17864094|ref|NP_064562.1|      ...............----------------------------.....................
gi|54607077|ref|NP_075392.2|      ...............----------------------------.....................
gi|31982881|ref|NP_078968.3|      ...............----------------------------.....................
gi|20336214|ref|NP_037399.2|      ...............----------------------------.....................
gi|57863304|ref|NP_056340.2|      ...............----------------------------.....................
gi|304361757|ref|NP_001182027.1|  ...............----------------------------.....................
gi|304361760|ref|NP_001182028.1|  ...............----------------------------.....................
gi|313102995|ref|NP_001186195.1|  ...............----------------------------.....................
gi|20127551|ref|NP_057197.2|      ...............----------------------------.....................
gi|38683799|ref|NP_149112.1|      ...............----------------------------.....................
gi|166795254|ref|NP_110443.3|     ...............----------------------------.....................
gi|18496983|ref|NP_056341.1|      ...............----------------------------.....................
gi|313851097|ref|NP_001186499.1|  ...............----------------------------.....................
gi|155969701|ref|NP_919288.2|     ...............----------------------------.....................
gi|30089932|ref|NP_821066.1|      ...............----------------------------.....................
gi|156104878|ref|NP_055720.3|     ...............----------------------------.....................
gi|294459971|ref|NP_001170902.1|  ...............----------------------------.....................
gi|22547184|ref|NP_067638.3|      ...............----------------------------.....................
gi|7661962|ref|NP_055585.1|       ...............----------------------------.....................
gi|117956371|ref|NP_001071154.1|  ...............----------------------------.....................
gi|95147559|ref|NP_787069.3|      ...............----------------------------.....................
gi|16418357|ref|NP_443087.1|      ...............----------------------------.....................
gi|170650694|ref|NP_001116244.1|  ...............----------------------------.....................
gi|150378537|ref|NP_001092877.1|  ...............----------------------------.....................
gi|80978934|ref|NP_055729.2|      ...............----------------------------.....................
gi|5730102|ref|NP_004612.2|       ...............----------------------------.....................
gi|80978930|ref|NP_001032208.1|   ...............----------------------------.....................
gi|269315852|ref|NP_997237.2|     ...............----------------------------.....................
gi|255982572|ref|NP_001157637.1|  ...............----------------------------.....................
gi|7705831|ref|NP_057199.1|       ...............----------------------------.....................
gi|148806877|ref|NP_597704.1|     ...............----------------------------.....................
gi|156104893|ref|NP_597703.2|     ...............----------------------------.....................
gi|117956373|ref|NP_001071153.1|  ...............----------------------------.....................
gi|221136914|ref|NP_001137472.1|  ...............----------------------------.....................
gi|166851846|ref|NP_001071133.2|  ...............----------------------------.....................
gi|339275867|ref|NP_001229858.1|  ...............----------------------------.....................
gi|90991702|ref|NP_078928.3|      ...............-----YRRGDRGGARDLLEEACDQCA--.....................
gi|71274172|ref|NP_001025041.1|   ...............----------------------------.....................
gi|22547180|ref|NP_671737.1|      ...............----------------------------.....................
gi|4507687|ref|NP_003296.1|       ...............----------------------------.....................
gi|6912736|ref|NP_036603.1|       ...............--LNAVEKGDYATVKQALQEAEIYYN--.....................
gi|110227613|ref|NP_114152.3|     ...............---RAVVEDDLRLLVMLLAHGSKEEV--.....................
gi|194733735|ref|NP_001124170.1|  ...............----------------------------.....................
gi|209863030|ref|NP_001129429.1|  ...............----AVEKGDYASVKKSLEEAEIYFK--.....................
gi|209863028|ref|NP_001129428.1|  ...............----AVEKGDYASVKKSLEEAEIYFK--.....................
gi|209863026|ref|NP_001129427.1|  ...............----AVEKGDYASVKKSLEEAEIYFK--.....................
gi|7706747|ref|NP_057263.1|       ...............----AVEKGDYASVKKSLEEAEIYFK--.....................
gi|209863024|ref|NP_003297.1|     ...............----AVEKGDYASVKKSLEEAEIYFK--.....................
gi|262399375|ref|NP_001161048.1|  ...............----------------------------.....................
gi|262399379|ref|NP_001161049.1|  ...............----------------------------.....................
gi|9966865|ref|NP_065122.1|       ...............----------------------------.....................
gi|25777624|ref|NP_742024.1|      ...............----------------------------.....................
gi|54112401|ref|NP_056030.1|      ...............----------------------------.....................
gi|157743267|ref|NP_001099046.1|  ...............----------------------------.....................
gi|110815813|ref|NP_057460.3|     ...............----------------------------.....................
gi|269847874|ref|NP_073739.3|     ...............----------------------------.....................
gi|75750531|ref|NP_060314.2|      ...............----------------------------.....................
gi|7657265|ref|NP_056137.1|       ...............----------------------------.....................
gi|75750529|ref|NP_057636.2|      ...............----------------------------.....................
gi|257467636|ref|NP_055646.2|     ...............----------------------------.....................
gi|222352179|ref|NP_001138435.1|  ...............----------------------------.....................
gi|222352177|ref|NP_001138434.1|  ...............----------------------------.....................
gi|222352175|ref|NP_001138433.1|  ...............----------------------------.....................
gi|222352173|ref|NP_004998.3|     ...............----------------------------.....................
gi|61742817|ref|NP_001013424.1|   ...............----------------------------.....................
gi|239744064|ref|XP_001714838.2|  ...............----------------------------.....................
gi|222352168|ref|NP_001138432.1|  ...............----------KLKVQRYLSKEGPVLK--.....................
gi|29826341|ref|NP_055914.2|      ...............----------------------------.....................
gi|284005535|ref|NP_001164637.1|  ...............----------------------------.....................
gi|284005543|ref|NP_001164639.1|  ...............----------------------------.....................
gi|284005537|ref|NP_001164638.1|  ...............----------------------------.....................
gi|4507685|ref|NP_003295.1|       ...............----------------------------.....................
gi|15042961|ref|NP_149417.1|      ...............----------------------------.....................
gi|312839866|ref|NP_001186166.1|  ...............----------------------------.....................
gi|312839869|ref|NP_001186167.1|  ...............----------------------------.....................
gi|312839871|ref|NP_001186168.1|  ...............----------------------------.....................
gi|312839873|ref|NP_001186169.1|  ...............----------------------------.....................
gi|109150425|ref|NP_060559.2|     ...............----------------------------.....................
gi|109150435|ref|NP_001035869.1|  ...............----------------------------.....................
gi|257467636|ref|NP_055646.2|     ...............----------------------------.....................
gi|294459965|ref|NP_001170899.1|  ...............----------------------------.....................
gi|209863032|ref|NP_001129430.1|  ...............----AVEKGDYASVKKSLEEAEIYFK--.....................
gi|148664230|ref|NP_055929.1|     ...............-LRKAVEKGEEDTFSDLIWSNPRYLIGS.....................
gi|114842396|ref|NP_694960.2|     ...............----------------------------.....................
gi|294459977|ref|NP_001170904.1|  ...............----------------------------.....................
gi|22748713|ref|NP_689539.1|      ...............----------------------------.....................
gi|224465235|ref|NP_001138999.1|  ...............----------------------------.....................
gi|98985804|ref|NP_478104.2|      ...............----------------------------.....................
gi|17981696|ref|NP_511042.1|      ...............----------------------------.....................
gi|260763963|ref|NP_001120979.2|  ...............----------------------------.....................
gi|27477049|ref|NP_543144.1|      ...............----------------------------.....................
gi|260763966|ref|NP_001077376.2|  ...............----------------------------.....................
gi|260763960|ref|NP_060405.4|     ...............----------------------------.....................
gi|75750531|ref|NP_060314.2|      ...............----------------------------.....................


                                                                        30        40        50      
                                                                         |         |         |      
d1s70b_                             ....................................VKRKKTKVKFDDGAVFLAACSS...G..
gi|21361135|ref|NP_002494.2|      ....................................----------------------...-..
gi|70780355|ref|NP_065210.2|      ....................................-------KAKDDQTPLHCAARI...G..
gi|215598574|ref|NP_001135918.1|  ....................................-------KAKDDQTPLHCAARI...G..
gi|70780353|ref|NP_065208.2|      ....................................-------KAKDDQTPLHCAARI...G..
gi|70780359|ref|NP_065209.2|      ....................................-------KAKDDQTPLHCAARI...G..
gi|70780357|ref|NP_000028.3|      ....................................-------KAKDDQTPLHCAARI...G..
gi|325053666|ref|NP_001191332.1|  ....................................-------ATTSGYTPLHLSARE...G..
gi|325053668|ref|NP_001191333.1|  ....................................-------ATTSGYTPLHLSARE...G..
gi|32967601|ref|NP_066267.2|      ....................................-------ATTSGYTPLHLSARE...G..
gi|188595682|ref|NP_001120965.1|  ....................................-------ATTNGYTPLHISARE...G..
gi|52426737|ref|NP_066187.2|      ....................................-------ATTNGYTPLHISARE...G..
gi|52426735|ref|NP_001139.3|      ....................................-------ATTNGYTPLHISARE...G..
gi|268607595|ref|NP_001161354.1|  .................................llfWGAAVDSIDSEGRTVLSIASAQ...G..
gi|62988328|ref|NP_065070.1|      .................................llfWGAAVDSIDSEGRTVLSIASAQ...G..
gi|48928017|ref|NP_001001716.1|   ....................................----------------------...-..
gi|70780353|ref|NP_065208.2|      ....................................-------QSQKGFTPLYMAAQE...N..
gi|70780355|ref|NP_065210.2|      ....................................-------QSQKGFTPLYMAAQE...N..
gi|70780359|ref|NP_065209.2|      ....................................-------QSQKGFTPLYMAAQE...N..
gi|70780357|ref|NP_000028.3|      ....................................-------QSQKGFTPLYMAAQE...N..
gi|215598574|ref|NP_001135918.1|  ....................................-------QSQKGFTPLYMAAQE...N..
gi|325053668|ref|NP_001191333.1|  ....................................-------QSQNGFTPLYMAAQE...N..
gi|32967601|ref|NP_066267.2|      ....................................-------QSQNGFTPLYMAAQE...N..
gi|304434687|ref|NP_710181.2|     ....................................-------RDKNWQTPLHVAAAN...K..
gi|30425444|ref|NP_848605.1|      ....................................-------QTASGYTPLLIAAQD...Q..
gi|304361757|ref|NP_001182027.1|  ....................................-------KDKKSYTPLHAAASS...G..
gi|304361760|ref|NP_001182028.1|  ....................................-------KDKKSYTPLHAAASS...G..
gi|46519151|ref|NP_060448.1|      ....................................-------QSATGNTALTYACAG...G..
gi|46519154|ref|NP_078944.2|      ....................................-------QSATGNTALTYACAG...G..
gi|157743284|ref|NP_775866.2|     llahsadvnardklwqtplhvaaanratkcaealapLLSSLNVADRSGRSALHHAVHS...G..
gi|55741641|ref|NP_065789.1|      ....................................-------EDLDNWTALISASKE...G..
gi|10863929|ref|NP_066956.1|      ....................................-------EEEGGWTPLHNAVQM...S..
gi|308044526|ref|NP_001183959.1|  ................................llamHANVEDRGNKGDITPLMAASSG...G..
gi|41327754|ref|NP_065690.2|      ....................................-------SNRRGSTPLHMAVER...R..
gi|38683816|ref|NP_942592.1|      ....................................-------RDKKGFTPLILAATA...G..
gi|38683807|ref|NP_115593.3|      ....................................-------RDKKGFTPLILAATA...G..
gi|304434690|ref|NP_001182073.1|  ....................................-------LDSEKRTPLHVAAFL...G..
gi|46519147|ref|NP_060217.1|      ....................................-------KTDEMHTALMEACMD...G..
gi|37620163|ref|NP_065741.3|      ....................................-------KTDEMHTALMEACMD...G..
gi|304361757|ref|NP_001182027.1|  ....................................-------RNSSGRTPLDLAAFK...G..
gi|304361760|ref|NP_001182028.1|  ....................................-------RNSSGRTPLDLAAFK...G..
gi|37620163|ref|NP_065741.3|      ....................................-------SERTKDTPLSLACSG...G..
gi|46519147|ref|NP_060217.1|      ....................................-------SERTKDTPLSLACSG...G..
gi|68131557|ref|NP_056014.2|      ....................................-------QDNEKRTPLHAAAYL...G..
gi|96975023|ref|NP_874362.3|      ....................................-------ESKDGLTLLHCAAQK...G..
gi|10092619|ref|NP_065390.1|      ....................................-----------GDSFLHLAIIH...E..
gi|38683816|ref|NP_942592.1|      ................................llamHANVEDRGIKGDITPLMAAANG...G..
gi|38683807|ref|NP_115593.3|      ................................llamHANVEDRGIKGDITPLMAAANG...G..
gi|157739945|ref|NP_079461.2|     ....................................-------SSESGLTPLGYAAAA...G..
gi|18252778|ref|NP_057234.2|      ....................................-------PNKEGWLPLHEAAYY...G..
gi|89363047|ref|NP_004929.2|      ....................................-------QDKGGSNAVYWAARH...G..
gi|321117514|ref|NP_001189358.1|  ....................................-------PNKEGWLPLHEAAYY...G..
gi|223634006|ref|NP_001138682.1|  ....................................-------RDHAGRTPLHLAVLR...G..
gi|341914599|ref|XP_001714535.3|  ....................................-------ADKHGLTVIHLAAWS...G..
gi|341915319|ref|XP_001128459.4|  ....................................-------ADKHGLTVIHLAAWS...G..
gi|34304379|ref|NP_899068.1|      ....................................-------YDNLFRTPLHWAALL...G..
gi|225543463|ref|NP_001139381.1|  ....................................-------TSENGMTALCYAAAA...G..
gi|34304381|ref|NP_055240.2|      ....................................-------YDNLFRTPLHWAALL...G..
gi|225543461|ref|NP_203752.2|     ....................................-------TSENGMTALCYAAAA...G..
gi|325053666|ref|NP_001191332.1|  ....................................-------ESKSGFTPLHIAAHY...G..
gi|68131557|ref|NP_056014.2|      ....................................----VDIQDGNGQTPLMLSVLN...G..
gi|52426735|ref|NP_001139.3|      ....................................SKMMVNRTTESGFTPLHIAAHY...G..
gi|4506217|ref|NP_002805.1|       ....................................----------------------...-..
gi|188595682|ref|NP_001120965.1|  ....................................SKMMVNRTTESGFTPLHIAAHY...G..
gi|52426737|ref|NP_066187.2|      ....................................SKMMVNRTTESGFTPLHIAAHY...G..
gi|224465233|ref|NP_079033.4|     ....................................-----KMEHQNKRSPLHAAAEA...G..
gi|164664508|ref|NP_005169.2|     ....................................----------DGDTPLHIAVVQ...G..
gi|7705748|ref|NP_057062.1|       ....................................-------VGYGGLTALHIATIA...G..
gi|313569861|ref|NP_001186256.1|  ....................................-------VGYGGLTALHIATIA...G..
gi|163914396|ref|NP_001106279.1|  ....................................-------VGYGGLTALHIATIA...G..
gi|87239981|ref|NP_003738.2|      ....................................-------QPQSHETALHCAVASlhpK..
gi|13376842|ref|NP_079511.1|      ....................................-------HPQTHETALHCAAAS...Pyp
gi|7705831|ref|NP_057199.1|       ....................................-------ADNRGWMPIHEAAYH...N..
gi|255982572|ref|NP_001157637.1|  ....................................-------ADNRGWMPIHEAAYH...N..
gi|338797777|ref|NP_001229742.1|  ....................................--------TKHGRTPLHLAANK...G..
gi|338797775|ref|NP_055757.3|     ....................................--------TKHGRTPLHLAANK...G..
gi|338797766|ref|NP_001229738.1|  ....................................--------TKHGRTPLHLAANK...G..
gi|338797770|ref|NP_001229740.1|  ....................................--------TKHGRTPLHLAANK...G..
gi|206597522|ref|NP_001128663.1|  ....................................----------------------...-..
gi|4502249|ref|NP_003878.1|       ....................................----------------------...-..
gi|304434690|ref|NP_001182073.1|  ....................................----VDVKDAKGQTPLMLAVAY...G..
gi|157743284|ref|NP_775866.2|     ....................................----TDVMDAYGQTPLMLAIMN...G..
gi|46094081|ref|NP_060952.2|      ....................................----------------------...-..
gi|13376842|ref|NP_079511.1|      ....................................-------TAGRKSTPLHFAAGF...G..
gi|87239981|ref|NP_003738.2|      ....................................-------MAGRKSSPLHFAAGF...G..
gi|156142197|ref|NP_006700.3|     ....................................------SDQQSKRTPLHAAAQK...G..
gi|156142199|ref|NP_079532.5|     ....................................------SDQQSKRTPLHAAAQK...G..
gi|92087060|ref|NP_563616.3|      ....................................-------KNDKGETPLLIAVKK...G..
gi|70995267|ref|NP_775776.2|      ....................................-------RDSHGTTLLMVAAYA...G..
gi|219842212|ref|NP_001137357.1|  ....................................VKRQKTKVKFDDGAVFLAACSS...G..
gi|4505317|ref|NP_002471.1|       ....................................VKRQKTKVKFDDGAVFLAACSS...G..
gi|116534990|ref|NP_015628.2|     ....................................-----HEMDDYGNTPLHCAVEK...N..
gi|282394038|ref|NP_001164160.1|  ....................................-------TKNQGRTALQVAAYL...G..
gi|282394032|ref|NP_001164157.1|  ....................................-------TKNQGRTALQVAAYL...G..
gi|282394030|ref|NP_543151.2|     ....................................-------TKNQGRTALQVAAYL...G..
gi|282394036|ref|NP_001164159.1|  ....................................-------TKNQGRTALQVAAYL...G..
gi|282394034|ref|NP_001164158.1|  ....................................-------TKNQGRTALQVAAYL...G..
gi|58331111|ref|NP_061919.1|      ....................................-----------GDTLLHCAARH...G..
gi|58331113|ref|NP_001009941.1|   ....................................-----------GDTLLHCAARH...G..
gi|268607595|ref|NP_001161354.1|  ....................................---------EDDRTSCIVRQAL...E..
gi|62988328|ref|NP_065070.1|      ....................................---------EDDRTSCIVRQAL...E..
gi|221307473|ref|NP_001137250.1|  ....................................----------------------...-..
gi|19923540|ref|NP_060177.2|      ....................................----------------------...-..
gi|140161500|ref|NP_056060.2|     ....................................RGPNVNCVDSTGYTPLHHAALN...G..
gi|224809478|ref|NP_001138997.1|  ....................................-------------DRLLQAVEN...G..
gi|224809468|ref|NP_056392.2|     ....................................---------------LLQAVEN...G..
gi|224809470|ref|NP_001138992.1|  ....................................---------------LLQAVEN...G..
gi|224809472|ref|NP_001138993.1|  ....................................---------------LLQAVEN...G..
gi|224809474|ref|NP_001138994.1|  ....................................---------------LLQAVEN...G..
gi|18079216|ref|NP_065815.1|      ....................................KKINVNFQDPDGFSALHHAALN...G..
gi|224809476|ref|NP_001138995.1|  ....................................---------------LLQAVEN...G..
gi|217416347|ref|NP_065804.2|     ....................................KRLNVNYQDADGFSALHHAALG...G..
gi|341915690|ref|XP_003403588.1|  ....................................----RYHVRREDLDKLHRAAWW...G..
gi|239745058|ref|XP_002343353.1|  ....................................----RYHVRREDLDKLHRAAWW...G..
gi|341915688|ref|XP_003403587.1|  ....................................----RYHVRREDLDKLHRAAWW...G..
gi|310118968|ref|XP_003118905.1|  ....................................-------IKPYHLKGIHRAVFY...R..
gi|30348954|ref|NP_065825.1|      ....................................-------GQCAGHTAMQAASQN...G..
gi|310118966|ref|XP_001717815.3|  ....................................-------IKPYHLKGIHRAVFY...R..
gi|71274109|ref|NP_004547.2|      ....................................----------DGDTLVHLAVIH...E..
gi|110431370|ref|NP_113663.2|     ....................................-------RARNGATPAHDASAT...G..
gi|256222430|ref|NP_079466.3|     ....................................--------KPYHLKRIHRAVLR...G..
gi|28626517|ref|NP_056383.1|      ....................................--------------ALLEASLR...N..
gi|53828703|ref|NP_001005365.2|   ....................................--------RREDLGKLHRAAWW...G..
gi|239747114|ref|XP_002343914.1|  ....................................-----YHVRREDLDKLHRAAWW...G..
gi|153792284|ref|NP_778146.2|     ....................................------HIRREDLDKLHRAAWW...G..
gi|52856434|ref|NP_001005356.1|   ....................................-----YHVRREDLDKLHRAAWW...G..
gi|50511945|ref|NP_690001.3|      ....................................RGPNVNCTDSSGYTALHHAALN...G..
gi|148596917|ref|NP_660278.3|     ....................................--------------HLHRAVSV...N..
gi|209977003|ref|NP_001129685.1|  ....................................-----YHVRREDLDKLHRAAWW...G..
gi|212549546|ref|NP_001131143.1|  ....................................-----YHVRREDLDKLHRAAWW...G..
gi|256222280|ref|NP_001157787.1|  ....................................-----YPIKPYHLKRIHRAVLH...G..
gi|224282147|ref|NP_001138914.1|  ....................................-----YHVRREDLDKLHRAAWW...G..
gi|259155302|ref|NP_001158884.1|  ....................................----------NGDSVLHLAIIH...L..
gi|121582655|ref|NP_653299.3|     ....................................--------------KLLEAVHR...G..
gi|68131557|ref|NP_056014.2|      ....................................-------KSKDGKTPLHMTALH...G..
gi|34577122|ref|NP_003989.2|      ....................................----------NGDSVLHLAIIH...L..
gi|153791352|ref|NP_001093241.1|  ....................................-------VRGEDLDKLHRAAWW...G..
gi|103471993|ref|NP_056151.2|     ....................................---------------IVKATQY...G..
gi|134133226|ref|NP_001077007.1|  ....................................-------VRGEDLDKLHRAAWW...G..
gi|268607514|ref|NP_001161330.1|  ....................................----------------LAACSS...G..
gi|268607512|ref|NP_001161329.1|  ....................................----------------LAACSS...G..
gi|30089994|ref|NP_078984.2|      ....................................-------RDANGWTLLHFSAAR...G..
gi|22208957|ref|NP_078977.2|      ....................................------------RTPVHEAAQR...G..
gi|22208951|ref|NP_665862.1|      ....................................---------FEGFCALHLAASQ...G..
gi|320202950|ref|NP_001188894.1|  ....................................---------FEGFCALHLAASQ...G..
gi|37620163|ref|NP_065741.3|      ....................................-------HTEEGESLLCLACSA...G..
gi|46519147|ref|NP_060217.1|      ....................................-------HTEEGESLLCLACSA...G..
gi|38176283|ref|NP_937886.1|      ....................................-------RDANGWTLLHFSAAR...G..
gi|88953571|ref|XP_933678.1|      ....................................-----YHVRREDLDKLHRAAWW...G..
gi|113413200|ref|XP_934799.2|     ....................................-----YHVRREDLDKLHRAAWW...G..
gi|268607506|ref|NP_002472.2|     ....................................----------------LAACSS...G..
gi|118150656|ref|NP_062618.2|     ....................................---------------LHRAASV...G..
gi|38683816|ref|NP_942592.1|      ....................................-----------GYTPLMEAARE...G..
gi|38683807|ref|NP_115593.3|      ....................................-----------GYTPLMEAARE...G..
gi|304434690|ref|NP_001182073.1|  ....................................----------------------...-..
gi|215598806|ref|NP_543147.2|     ....................................RGLWSLTYEEELTTPLHVAASR...G..
gi|52486194|ref|NP_003551.2|      ....................................-------ENEEGCTPLHLACRK...G..
gi|294337038|ref|NP_001135932.2|  ....................................LRLWSLTYEEELTTPLHVAASR...G..
gi|294337037|ref|NP_001135931.2|  ....................................LRLWSLTYEEELTTPLHVAASR...G..
gi|116875852|ref|NP_065822.2|     ....................................-----YAFGRVKRSLLHIAANC...G..
gi|117320527|ref|NP_002493.3|     ....................................----------NGDTPLHLAIIH...G..
gi|117320540|ref|NP_001070961.1|  ....................................----------NGDTPLHLAIIH...G..
gi|117320531|ref|NP_001070962.1|  ....................................----------NGDTPLHLAIIH...G..
gi|313760592|ref|NP_001186491.1|  ....................................-------ENEEGCTPLHLACRK...G..
gi|52486251|ref|NP_001004426.1|   ....................................-------ENEEGCTPLHLACRK...G..
gi|16975496|ref|NP_219499.1|      ....................................-------------TLLQQAAAQ...G..
gi|52426737|ref|NP_066187.2|      ....................................-------CNQNGLNALHLAAKE...G..
gi|341914805|ref|XP_003403867.1|  ....................................---------------IHRAAIK...G..
gi|60115723|ref|NP_001012421.1|   ....................................---------------IHRAAVK...G..
gi|60460920|ref|NP_001012419.1|   ....................................---------------IHRAAVK...G..
gi|156104901|ref|NP_115626.2|     ....................................---------------IHRAAVK...G..
gi|341914105|ref|XP_001715780.3|  ....................................----------KDLGMIHKAAIA...G..
gi|149363679|ref|NP_001092275.1|  ....................................---------------IHRAAVK...G..
gi|188595682|ref|NP_001120965.1|  ....................................-------CNQNGLNALHLAAKE...G..
gi|14249672|ref|NP_116291.1|      ....................................---------------LLEAAAR...N..
gi|341915999|ref|XP_292717.9|     ....................................----------KDLGMIHKAAIA...G..
gi|157743284|ref|NP_775866.2|     ....................................----------------------...-..
gi|222537750|ref|NP_001138501.1|  ....................................---------------IHTAASR...G..
gi|325053666|ref|NP_001191332.1|  ....................................-------CNQNGLNALHLASKE...G..
gi|283549153|ref|NP_671728.2|     ....................................---------------IHRAAIK...G..
gi|155969701|ref|NP_919288.2|     ....................................---------ASGVSPLHLAARF...G..
gi|312147315|ref|NP_001185879.1|  ....................................------------TDMLQDAIIH...H..
gi|62177127|ref|NP_055826.1|      ....................................-------------DMLQDAIIH...H..
gi|90186267|ref|NP_078945.2|      ....................................-------CDSEGCTPLMHAVSG...R..
gi|134244285|ref|NP_000426.2|     ....................................----------------------...-..
gi|56550047|ref|NP_001008225.1|   ....................................--------------RLMKAAER...G..
gi|67906195|ref|NP_775822.3|      ....................................---------------LLRACDQ...G..
gi|267844887|ref|NP_001136205.2|  ....................................-------ADEIGWIPLHKAAVQ...L..
gi|47933346|ref|NP_061901.2|      ....................................-----------------KATQY...G..
gi|110815813|ref|NP_057460.3|     ....................................-------------TLLHRAIDE...N..
gi|55770876|ref|NP_004548.3|      ....................................----------------------...-..
gi|59850762|ref|NP_060473.2|      ....................................--------------RLMKAAER...G..
gi|18254476|ref|NP_543150.1|      ....................................----------ADRSPLHEAASQ...G..
gi|310114187|ref|XP_003119912.1|  ....................................----------------------...-..
gi|148833508|ref|NP_060087.3|     ....................................----------------------...-..
gi|7657265|ref|NP_056137.1|       ....................................LLGYVSQQGGQRSTPLIIAARN...G..
gi|34304379|ref|NP_899068.1|      ....................................-------EDQFGRTPLMYCVLA...D..
gi|34304381|ref|NP_055240.2|      ....................................-------EDQFGRTPLMYCVLA...D..
gi|38327522|ref|NP_055206.2|      ....................................----------------------...-..
gi|115495445|ref|NP_443723.2|     ....................................----------------------...-..
gi|17981699|ref|NP_523240.1|      ....................................----------------------...-..
gi|4502751|ref|NP_001253.1|       ....................................----------------------...-..
gi|24041035|ref|NP_077719.2|      ....................................----------------------...-..
gi|17864094|ref|NP_064562.1|      ....................................--SSLISEKTNGATPLLMAARY...G..
gi|42734375|ref|NP_597707.1|      ....................................----------------------...-..
gi|13443014|ref|NP_076992.1|      ....................................----------SDWSPMHEAAIH...G..
gi|271398201|ref|NP_001162003.1|  ....................................----------SDWSPMHEAAIH...G..
gi|60218887|ref|NP_001012428.1|   ....................................-----------DRSPLHEAAAQ...G..
gi|58331117|ref|NP_001009943.1|   ....................................----------AGDTLLHCAARH...G..
gi|72534772|ref|NP_001026909.1|   ....................................----------SDWSPMHEAAIH...G..
gi|18254474|ref|NP_543149.1|      ....................................-------DCWADRSPLHEAAAQ...G..
gi|338797779|ref|NP_001229743.1|  ....................................---------------LLVAAYK...G..
gi|116325987|ref|NP_872409.2|     ....................................-------VTTRGWTASHIAAIR...G..
gi|17981702|ref|NP_524145.1|      ....................................------------------AAAR...G..
gi|4502753|ref|NP_001791.1|       ....................................------------------AAAR...G..
gi|126723390|ref|NP_597732.1|     ....................................---------------LLQAVEN...N..
gi|38569426|ref|NP_071379.3|      ....................................----NYTEPINGLSALHLASVS...N..
gi|38569428|ref|NP_942093.1|      ....................................----NYTEPINGLSALHLASVS...N..
gi|24308163|ref|NP_061178.1|      ....................................--DELTGEVAGGGTPLLIAARY...G..
gi|53832024|ref|NP_001005474.1|   ....................................----------DGDTFLHIAVAQ...G..
gi|13899229|ref|NP_113607.1|      ....................................----------DGDTFLHIAVAQ...G..
gi|14149716|ref|NP_060077.1|      ....................................----------------------...-..
gi|39812133|ref|NP_065082.2|      ....................................------------------AAVE...G..
gi|17981694|ref|NP_004927.2|      ....................................----------------------...-..
gi|116063534|ref|NP_115515.2|     ....................................----------------------...-..
gi|4502749|ref|NP_000068.1|       ....................................----------------------...-..
gi|304376272|ref|NP_001182061.1|  ....................................----------------------...-..
gi|32483404|ref|NP_852092.1|      ....................................----------------------...-..
gi|8051599|ref|NP_057739.1|       ....................................----------------------...-..
gi|8051597|ref|NP_002032.2|       ....................................----------------------...-..
gi|8051595|ref|NP_057738.1|       ....................................----------------------...-..
gi|8051593|ref|NP_005245.2|       ....................................----------------------...-..
gi|41327752|ref|NP_659431.5|      ....................................----------------------...-..
gi|120587025|ref|NP_057232.2|     ....................................---------------FLEYVQL...G..
gi|24586688|ref|NP_543139.4|      ....................................QGFWVLTPKTKQTAPLAIATAR...G..
gi|110815813|ref|NP_057460.3|     ....................................--GKLNEADHNGDLALDLALSR...R..
gi|22208964|ref|NP_665879.1|      ....................................YWLPSYKLKSSWATGLHLSVLF...G..
gi|157743292|ref|NP_997721.2|     ....................................SGLWTLEYKRELTTPLCIAAAH...G..
gi|7706379|ref|NP_057200.1|       ....................................YWLPSYKLKSSWATGLHLSVLF...G..
gi|217416350|ref|NP_001136115.1|  ....................................----------------------...-..
gi|226817313|ref|NP_036441.2|     ....................................--------------------QH...R..
gi|52426735|ref|NP_001139.3|      ....................................-------CNQNGLNALHLAAKE...G..
gi|219842214|ref|NP_001137358.1|  ....................................----------------------...-..
gi|13129098|ref|NP_077000.1|      ....................................----------------------...-..
gi|21389427|ref|NP_653219.1|      ....................................----------------------...-..
gi|271398185|ref|NP_001162002.1|  ....................................----------SDWSPMHEAAIH...G..
gi|122937241|ref|NP_001073889.1|  ....................................----------------MDYVQL...H..
gi|341915692|ref|XP_003403589.1|  ....................................----RYHVRREDLDKLHRAAWW...G..
gi|320202942|ref|NP_001188512.1|  ....................................-------DCWADRSPLHEAAAQ...G..
gi|116063534|ref|NP_115515.2|     ....................................--------VQKMCHPLCFC---...-..
gi|18640738|ref|NP_570124.1|      ....................................----------------------...-..
gi|50897294|ref|NP_001002920.1|   ....................................--------RREDLGKLHRAAWW...G..
gi|116534990|ref|NP_015628.2|     ....................................--------DNDGCTPLHYACRQ...G..
gi|154354990|ref|NP_055730.2|     ....................................---------------IHKAASA...G..
gi|341914820|ref|XP_003403870.1|  ....................................---------------IHRAAVK...G..
gi|19718741|ref|NP_542164.2|      ....................................----------------------...-..
gi|23510377|ref|NP_694856.1|      ....................................----------------------...-..
gi|64464726|ref|NP_055973.2|      ....................................----------------------...-..
gi|28605137|ref|NP_736606.1|      ....................................--------------------YS...G..
gi|289629249|ref|NP_001166206.1|  ....................................--------------ALLEASLR...N..
gi|13376842|ref|NP_079511.1|      ....................................----------------------...-..
gi|87239981|ref|NP_003738.2|      ....................................----------------------...-..
gi|41281709|ref|NP_640332.1|      ....................................-----------GDTLLHLFAAR...G..
gi|194018403|ref|NP_001123453.1|  ....................................----------------------...-..
gi|41350198|ref|NP_060174.2|      ....................................----------------------...-..
gi|169403957|ref|NP_079209.3|     ....................................----------------------...-..
gi|169403959|ref|NP_001108588.1|  ....................................----------------------...-..
gi|157504499|ref|NP_940873.2|     ....................................----------------------...-..
gi|156142184|ref|NP_057550.3|     ....................................---------------IWSAALN...G..
gi|38569426|ref|NP_071379.3|      ....................................----------------------...-..
gi|38569428|ref|NP_942093.1|      ....................................----------------------...-..
gi|70995241|ref|NP_060134.2|      ....................................----ASEDSFYGWTPVHWAAHF...G..
gi|209969812|ref|NP_001129663.1|  ....................................----------------------...-..
gi|258613875|ref|NP_056308.3|     ....................................----------------------...-..
gi|12746412|ref|NP_075526.1|      ....................................----------------------...-..
gi|320461689|ref|NP_569059.3|     ....................................-------TDTEEKQALNQAVYD...N..
gi|4758606|ref|NP_004508.1|       ....................................-------------------CRE...G..
gi|62420873|ref|NP_001014794.1|   ....................................-------------------CRE...G..
gi|62420875|ref|NP_001014795.1|   ....................................-------------------CRE...G..
gi|157266328|ref|NP_000456.2|     ....................................----------------------...-..
gi|154091032|ref|NP_653191.2|     ....................................----------------------...-..
gi|134948558|ref|NP_056023.3|     ....................................----------------------...-..
gi|134948605|ref|NP_001077094.1|  ....................................----------------------...-..
gi|323362985|ref|NP_001190985.1|  ....................................----------------------...-..
gi|4506499|ref|NP_003712.1|       ....................................-------PDERGFTPLIWASAF...G..
gi|21956645|ref|NP_665807.1|      ....................................----------------------...-..
gi|94721248|ref|NP_001035535.1|   ....................................---------HCEDTRLHDAAYV...G..
gi|156104862|ref|NP_859063.3|     ....................................----------------------...-..
gi|56676397|ref|NP_037407.4|      ....................................----------------------...-..
gi|41055989|ref|NP_059990.2|      ....................................-------TDAIPSNVLRDAVKN...G..
gi|304434690|ref|NP_001182073.1|  ....................................----------------------...-..
gi|19924156|ref|NP_604389.1|      ....................................----------------------...-..
gi|256574792|ref|NP_001157915.1|  ....................................----------------------...-..
gi|20270347|ref|NP_620152.1|      ....................................----------------------...-..
gi|31317252|ref|NP_065791.1|      ....................................------------EYPLHKAIKV...E..
gi|320461543|ref|NP_001073933.2|  ....................................---------------ACAAAHA...G..
gi|21314682|ref|NP_061116.2|      ....................................-------QKRIWESPLLLAAKD...N..
gi|47933348|ref|NP_001001483.1|   ....................................----------------------...-..
gi|267844887|ref|NP_001136205.2|  ....................................----------------------...-..
gi|187608777|ref|NP_038460.4|     ....................................----WNRRNDMGETLLHRACIE...G..
gi|34304383|ref|NP_775748.2|      ....................................----------------------...-..
gi|256574784|ref|NP_001157912.1|  ....................................----AQETDRNGRTGLIVACYH...G..
gi|8923516|ref|NP_060343.1|       ....................................-------YQEGVSNALLKMAEL...G..
gi|17505200|ref|NP_062815.2|      ....................................---HMLQQKRILESPLLRASKE...N..
gi|38257146|ref|NP_940683.1|      ....................................--------------PLLQACID...G..
gi|321267560|ref|NP_001155907.2|  ....................................------------MTKLHQAVAA...G..
gi|183396785|ref|NP_001116856.1|  ....................................----------------------...-..
gi|183396783|ref|NP_001116855.1|  ....................................----------------------...-..
gi|21071037|ref|NP_060215.4|      ....................................----------------------...-..
gi|183396787|ref|NP_001116857.1|  ....................................----------------------...-..
gi|299473797|ref|NP_001177408.1|  ....................................----------------LEAMQA...G..
gi|284413734|ref|NP_653309.3|     ....................................----------------------...-..
gi|341915472|ref|XP_003403627.1|  ....................................----------------------...-..
gi|341915476|ref|XP_003403594.1|  ....................................----------------------...-..
gi|14150169|ref|NP_115736.1|      ....................................----------------------...-..
gi|256574792|ref|NP_001157915.1|  ....................................----------------------...-..
gi|67906195|ref|NP_775822.3|      ....................................----------------------...-..
gi|28461129|ref|NP_064715.1|      ....................................----------------------...-..
gi|166235148|ref|NP_036515.4|     ....................................----------------------...-..
gi|148664246|ref|NP_665872.2|     ....................................----------------------...-..
gi|76563940|ref|NP_005451.2|      ....................................-----KIHDENGNNLLHIAASQ...G..
gi|257467559|ref|NP_001004441.2|  ....................................---------------LIKAVHQ...S..
gi|226437606|ref|NP_001139813.1|  ....................................---------------LLKAVWL...G..
gi|188219549|ref|NP_115666.2|     ....................................----------------------...-..
gi|13540606|ref|NP_110440.1|      ....................................----------------------...-..
gi|89941470|ref|NP_001034977.1|   ....................................---------------LLRAVGQ...G..
gi|62953116|ref|NP_001017523.1|   ....................................----------------------...G..
gi|4885643|ref|NP_005417.1|       ....................................----------------------...-..
gi|112799849|ref|NP_001026855.2|  ....................................----------------------...-..
gi|65786661|ref|NP_001018082.1|   ....................................---------------------C...G..
gi|56090539|ref|NP_001007534.1|   ....................................----------------------...-..
gi|118498337|ref|NP_056197.2|     ....................................----------------------...-..
gi|187608516|ref|NP_036419.3|     ....................................----------------------...-..
gi|194097375|ref|NP_872414.3|     ....................................----ATQVDSNGRTGLMVACYH...G..
gi|320202962|ref|NP_001189332.1|  ....................................-------YQEGVSNALLKMAEL...G..
gi|31581522|ref|NP_004903.2|      ....................................---------WVDDFPLHRSACE...G..
gi|37221182|ref|NP_919437.1|      ....................................---------WVDDFPLHRSACE...G..
gi|37221184|ref|NP_919438.1|      ....................................---------WVDDFPLHRSACE...G..
gi|37221187|ref|NP_919436.1|      ....................................---------WVDDFPLHRSACE...G..
gi|121114287|ref|NP_056131.2|     ....................................---------------LLDASLE...G..
gi|194097377|ref|NP_001123487.1|  ....................................----------------MVACYH...G..
gi|300796386|ref|NP_665803.2|     ....................................---------------------C...G..
gi|218563749|ref|NP_085152.2|     ....................................----------------------...-..
gi|296179431|ref|NP_068765.3|     ....................................----------------------...-..
gi|215820635|ref|NP_001135974.1|  ....................................---------------LLDAALT...G..
gi|63003907|ref|NP_006654.2|      ....................................---------------LLDAALT...G..
gi|168229256|ref|NP_689576.4|     ....................................----------------------...-..
gi|148596953|ref|NP_061877.1|     ....................................DPNTSYGEPYQHNTPLHYAARH...G..
gi|7661880|ref|NP_055531.1|       ....................................----------------------...-..
gi|21735483|ref|NP_659505.1|      ....................................----------------------...-..
gi|32171201|ref|NP_859077.1|      ....................................----------------------...-..
gi|341915877|ref|XP_001134442.4|  ....................................----------------------...-..
gi|75750529|ref|NP_057636.2|      ....................................----------------------...-..
gi|68131557|ref|NP_056014.2|      ....................................----------------------...-..
gi|38348298|ref|NP_940895.1|      ....................................AMQLLLEEDIVGRNLLYAACMA...G..
gi|319803120|ref|NP_001188386.1|  ....................................---------------LHEYVKQ...G..
gi|57863263|ref|NP_938207.2|      ....................................---------------LHEYVKQ...G..
gi|57863261|ref|NP_112562.3|      ....................................---------------LHEYVKQ...G..
gi|341914329|ref|XP_001717391.3|  ....................................----------------------...-..
gi|51972284|ref|NP_001004354.1|   ....................................----------------------...-..
gi|41393573|ref|NP_054749.2|      ....................................----------------------...-..
gi|146231998|ref|NP_001078923.1|  ....................................----------------------...-..
gi|313102999|ref|NP_001186197.1|  ....................................----------------------...-..
gi|41872507|ref|NP_003637.2|      ....................................----------------------...-..
gi|313102997|ref|NP_001186196.1|  ....................................----------------------...-..
gi|313103001|ref|NP_963291.2|     ....................................----------------------...-..
gi|41872522|ref|NP_963290.1|      ....................................----------------------...-..
gi|13899267|ref|NP_113626.1|      ....................................----------------------...-..
gi|157688564|ref|NP_001099010.1|  ....................................----------------------...-..
gi|18390333|ref|NP_569058.1|      ....................................----------------------...-..
gi|4758156|ref|NP_004708.1|       ....................................----------------------...-..
gi|206725420|ref|NP_001128685.1|  ....................................----------------------...-..
gi|206725415|ref|NP_631940.2|     ....................................----------------------...-..
gi|24308163|ref|NP_061178.1|      ....................................----------------------...-..
gi|17149832|ref|NP_476511.1|      ....................................----------------------...-..
gi|74315348|ref|NP_542435.2|      ....................................----------------------...-..
gi|74315350|ref|NP_061197.4|      ....................................----------------------...-..
gi|74315352|ref|NP_542436.2|      ....................................----------------------...-..
gi|74315354|ref|NP_542437.2|      ....................................----------------------...-..
gi|21237786|ref|NP_055591.2|      ....................................----------------------...-..
gi|124517699|ref|NP_689558.4|     ....................................----------------------...-..
gi|206725422|ref|NP_001128686.1|  ....................................----------------------...-..
gi|17149830|ref|NP_476510.1|      ....................................----------------------...-..
gi|17864094|ref|NP_064562.1|      ....................................----------------------...-..
gi|54607077|ref|NP_075392.2|      ....................................----------------------...-..
gi|31982881|ref|NP_078968.3|      ....................................----------------------...-..
gi|20336214|ref|NP_037399.2|      ....................................----------------------...-..
gi|57863304|ref|NP_056340.2|      ....................................----------------------...-..
gi|304361757|ref|NP_001182027.1|  ....................................---------------LMMAAEN...G..
gi|304361760|ref|NP_001182028.1|  ....................................---------------LMMAAEN...G..
gi|313102995|ref|NP_001186195.1|  ....................................----------------------...-..
gi|20127551|ref|NP_057197.2|      ....................................----------------------...-..
gi|38683799|ref|NP_149112.1|      ....................................----------------------...-..
gi|166795254|ref|NP_110443.3|     ....................................---------------VHECVFK...G..
gi|18496983|ref|NP_056341.1|      ....................................----------------------...-..
gi|313851097|ref|NP_001186499.1|  ....................................----------------------...-..
gi|155969701|ref|NP_919288.2|     ....................................-----------------VAAKD...G..
gi|30089932|ref|NP_821066.1|      ....................................----------------------...-..
gi|156104878|ref|NP_055720.3|     ....................................----------------------...-..
gi|294459971|ref|NP_001170902.1|  ....................................----------------------...-..
gi|22547184|ref|NP_067638.3|      ....................................----------------------...-..
gi|7661962|ref|NP_055585.1|       ....................................----------------------...-..
gi|117956371|ref|NP_001071154.1|  ....................................----------------------...-..
gi|95147559|ref|NP_787069.3|      ....................................----------------------...-..
gi|16418357|ref|NP_443087.1|      ....................................----------------------...-..
gi|170650694|ref|NP_001116244.1|  ....................................----------------------...-..
gi|150378537|ref|NP_001092877.1|  ....................................----------------------...-..
gi|80978934|ref|NP_055729.2|      ....................................----------------------...-..
gi|5730102|ref|NP_004612.2|       ....................................------------------AAEY...G..
gi|80978930|ref|NP_001032208.1|   ....................................----------------------...-..
gi|269315852|ref|NP_997237.2|     ....................................----------------------...-..
gi|255982572|ref|NP_001157637.1|  ....................................----------------------...-..
gi|7705831|ref|NP_057199.1|       ....................................----------------------...-..
gi|148806877|ref|NP_597704.1|     ....................................----------------------...-..
gi|156104893|ref|NP_597703.2|     ....................................----------------------...-..
gi|117956373|ref|NP_001071153.1|  ....................................----------------------...-..
gi|221136914|ref|NP_001137472.1|  ....................................----------------------...-..
gi|166851846|ref|NP_001071133.2|  ....................................----------------------...-..
gi|339275867|ref|NP_001229858.1|  ....................................----------------------...-..
gi|90991702|ref|NP_078928.3|      ....................................-------SQLEKGQLLSIPAAY...G..
gi|71274172|ref|NP_001025041.1|   ....................................----------------------...-..
gi|22547180|ref|NP_671737.1|      ....................................----------------------...-..
gi|4507687|ref|NP_003296.1|       ....................................------------------AAEY...G..
gi|6912736|ref|NP_036603.1|       ....................................----------------------...-..
gi|110227613|ref|NP_114152.3|     ....................................----------------------...-..
gi|194733735|ref|NP_001124170.1|  ....................................------------------AAEY...G..
gi|209863030|ref|NP_001129429.1|  ....................................----------------------...-..
gi|209863028|ref|NP_001129428.1|  ....................................----------------------...-..
gi|209863026|ref|NP_001129427.1|  ....................................----------------------...-..
gi|7706747|ref|NP_057263.1|       ....................................----------------------...-..
gi|209863024|ref|NP_003297.1|     ....................................----------------------...-..
gi|262399375|ref|NP_001161048.1|  ....................................-------------------AEY...G..
gi|262399379|ref|NP_001161049.1|  ....................................-------------------AEY...G..
gi|9966865|ref|NP_065122.1|       ....................................-------------------AEY...G..
gi|25777624|ref|NP_742024.1|      ....................................---------------LFASCRK...G..
gi|54112401|ref|NP_056030.1|      ....................................----------------------...-..
gi|157743267|ref|NP_001099046.1|  ....................................----------------------...-..
gi|110815813|ref|NP_057460.3|     ....................................----------------------...-..
gi|269847874|ref|NP_073739.3|     ....................................----------------------...-..
gi|75750531|ref|NP_060314.2|      ....................................----------------------...-..
gi|7657265|ref|NP_056137.1|       ....................................----------------------...-..
gi|75750529|ref|NP_057636.2|      ....................................----------------------...-..
gi|257467636|ref|NP_055646.2|     ....................................----------------------...-..
gi|222352179|ref|NP_001138435.1|  ....................................----------------------...-..
gi|222352177|ref|NP_001138434.1|  ....................................----------------------...-..
gi|222352175|ref|NP_001138433.1|  ....................................----------------------...-..
gi|222352173|ref|NP_004998.3|     ....................................----------------------...-..
gi|61742817|ref|NP_001013424.1|   ....................................----------------------...-..
gi|239744064|ref|XP_001714838.2|  ....................................----------------------...-..
gi|222352168|ref|NP_001138432.1|  ....................................---------YQKRVALYIAAFC...G..
gi|29826341|ref|NP_055914.2|      ....................................----------------------...-..
gi|284005535|ref|NP_001164637.1|  ....................................----------------------...-..
gi|284005543|ref|NP_001164639.1|  ....................................----------------------...-..
gi|284005537|ref|NP_001164638.1|  ....................................----------------------...-..
gi|4507685|ref|NP_003295.1|       ....................................-------------KLFLLACDK...G..
gi|15042961|ref|NP_149417.1|      ....................................----------------------...-..
gi|312839866|ref|NP_001186166.1|  ....................................----------------------...-..
gi|312839869|ref|NP_001186167.1|  ....................................----------------------...-..
gi|312839871|ref|NP_001186168.1|  ....................................----------------------...-..
gi|312839873|ref|NP_001186169.1|  ....................................----------------------...-..
gi|109150425|ref|NP_060559.2|     ....................................------------WNALLAACRA...G..
gi|109150435|ref|NP_001035869.1|  ....................................------------WNALLAACRA...G..
gi|257467636|ref|NP_055646.2|     ....................................----------------------...-..
gi|294459965|ref|NP_001170899.1|  ....................................----------------------...-..
gi|209863032|ref|NP_001129430.1|  ....................................----------------------...-..
gi|148664230|ref|NP_055929.1|     ....................................GDNPTIVQEGCRYNVMHVAAKE...N..
gi|114842396|ref|NP_694960.2|     ....................................----------------------...-..
gi|294459977|ref|NP_001170904.1|  ....................................----------------------...-..
gi|22748713|ref|NP_689539.1|      ....................................----------------------...-..
gi|224465235|ref|NP_001138999.1|  ....................................----------------------...-..
gi|98985804|ref|NP_478104.2|      ....................................----------------------...-..
gi|17981696|ref|NP_511042.1|      ....................................----------------------...-..
gi|260763963|ref|NP_001120979.2|  ....................................----------------------...-..
gi|27477049|ref|NP_543144.1|      ....................................----------------------...-..
gi|260763966|ref|NP_001077376.2|  ....................................----------------------...-..
gi|260763960|ref|NP_060405.4|     ....................................----------------------...-..
gi|75750531|ref|NP_060314.2|      ....................................----------------------...-..


                                                                                60                  
                                                                                 |                  
d1s70b_                             .DTEEVLRL....................................LER.....GAD......IN
gi|21361135|ref|NP_002494.2|      .--------....................................---.....---......--
gi|70780355|ref|NP_065210.2|      .HTNMVKLL....................................LEN.....NAN......PN
gi|215598574|ref|NP_001135918.1|  .HTNMVKLL....................................LEN.....NAN......PN
gi|70780353|ref|NP_065208.2|      .HTNMVKLL....................................LEN.....NAN......PN
gi|70780359|ref|NP_065209.2|      .HTNMVKLL....................................LEN.....NAN......PN
gi|70780357|ref|NP_000028.3|      .HTNMVKLL....................................LEN.....NAN......PN
gi|325053666|ref|NP_001191332.1|  .HEDVAAFL....................................LDH.....GAS......LS
gi|325053668|ref|NP_001191333.1|  .HEDVAAFL....................................LDH.....GAS......LS
gi|32967601|ref|NP_066267.2|      .HEDVAAFL....................................LDH.....GAS......LS
gi|188595682|ref|NP_001120965.1|  .QVDVASVL....................................LEA.....GAA......HS
gi|52426737|ref|NP_066187.2|      .QVDVASVL....................................LEA.....GAA......HS
gi|52426735|ref|NP_001139.3|      .QVDVASVL....................................LEA.....GAA......HS
gi|268607595|ref|NP_001161354.1|  .NVEVVRTL....................................LDR.....GLD......EN
gi|62988328|ref|NP_065070.1|      .NVEVVRTL....................................LDR.....GLD......EN
gi|48928017|ref|NP_001001716.1|   .--------....................................---.....---......--
gi|70780353|ref|NP_065208.2|      .HLEVVKFL....................................LEN.....GAN......QN
gi|70780355|ref|NP_065210.2|      .HLEVVKFL....................................LEN.....GAN......QN
gi|70780359|ref|NP_065209.2|      .HLEVVKFL....................................LEN.....GAN......QN
gi|70780357|ref|NP_000028.3|      .HLEVVKFL....................................LEN.....GAN......QN
gi|215598574|ref|NP_001135918.1|  .HLEVVKFL....................................LEN.....GAN......QN
gi|325053668|ref|NP_001191333.1|  .HLEVVKFL....................................LDN.....GAS......QS
gi|32967601|ref|NP_066267.2|      .HLEVVKFL....................................LDN.....GAS......QS
gi|304434687|ref|NP_710181.2|     .AVKCAEVI....................................IPL.....LSS......VN
gi|30425444|ref|NP_848605.1|      .QPDLCALL....................................LAH.....GAD......AN
gi|304361757|ref|NP_001182027.1|  .MISVVKYL....................................LDL.....GVD......MN
gi|304361760|ref|NP_001182028.1|  .MISVVKYL....................................LDL.....GVD......MN
gi|46519151|ref|NP_060448.1|      .FVDIVKVL....................................LNE.....GAN......IE
gi|46519154|ref|NP_078944.2|      .FVDIVKVL....................................LNE.....GAN......IE
gi|157743284|ref|NP_775866.2|     .HLETVNLL....................................LNK.....GAS......LN
gi|55741641|ref|NP_065789.1|      .HVHIVEEL....................................LKC.....GVN......LE
gi|10863929|ref|NP_066956.1|      .REDIVELL....................................LRH.....GAD......PV
gi|308044526|ref|NP_001183959.1|  .YLDIVKLL....................................LLH.....DAD......VN
gi|41327754|ref|NP_065690.2|      .VRGVVELL....................................LAR.....KIS......VN
gi|38683816|ref|NP_942592.1|      .HVGVVEIL....................................LDN.....GAD......IE
gi|38683807|ref|NP_115593.3|      .HVGVVEIL....................................LDN.....GAD......IE
gi|304434690|ref|NP_001182073.1|  .DAEIIELL....................................ILS.....GAR......VN
gi|46519147|ref|NP_060217.1|      .HVEVARLL....................................LDS.....GAQ......VN
gi|37620163|ref|NP_065741.3|      .HVEVARLL....................................LDS.....GAQ......VN
gi|304361757|ref|NP_001182027.1|  .HVECVDVL....................................INQ.....GAS......IL
gi|304361760|ref|NP_001182028.1|  .HVECVDVL....................................INQ.....GAS......IL
gi|37620163|ref|NP_065741.3|      .RQEVVDLL....................................LAR.....GAN......KE
gi|46519147|ref|NP_060217.1|      .RQEVVDLL....................................LAR.....GAN......KE
gi|68131557|ref|NP_056014.2|      .DAEIIELL....................................ILS.....GAR......VN
gi|96975023|ref|NP_874362.3|      .HVPVLAFI....................................MEDle...DVA......LD
gi|10092619|ref|NP_065390.1|      .EKALTMEV....................................IRQv....KGDlaf...LN
gi|38683816|ref|NP_942592.1|      .HVKIVKLL....................................LAH.....KAD......VN
gi|38683807|ref|NP_115593.3|      .HVKIVKLL....................................LAH.....KAD......VN
gi|157739945|ref|NP_079461.2|     .YLSIVVLL....................................CKK.....RAK......VD
gi|18252778|ref|NP_057234.2|      .QVGCLKVL....................................QRAy....PGT......ID
gi|89363047|ref|NP_004929.2|      .HVDTLKFL....................................SEN.....KCP......LD
gi|321117514|ref|NP_001189358.1|  .QVGCLKVL....................................QRAy....PGT......ID
gi|223634006|ref|NP_001138682.1|  .HAPLVRLL....................................LQR.....GAP......VG
gi|341914599|ref|XP_001714535.3|  .SLEVMLML....................................VKA.....GAD......QR
gi|341915319|ref|XP_001128459.4|  .SLEVMLML....................................VKA.....GAD......QR
gi|34304379|ref|NP_899068.1|      .HAQIVHLL....................................LERn....KSG......TI
gi|225543463|ref|NP_001139381.1|  .HMKLVCLL....................................TKK.....GVR......VD
gi|34304381|ref|NP_055240.2|      .HAQIVHLL....................................LERn....KSG......TI
gi|225543461|ref|NP_203752.2|     .HMKLVCLL....................................TKK.....GVR......VD
gi|325053666|ref|NP_001191332.1|  .NINVATLL....................................LNR.....AAA......VD
gi|68131557|ref|NP_056014.2|      .HTDCVYSL....................................LNK.....GAN......VD
gi|52426735|ref|NP_001139.3|      .NVNVATLL....................................LNR.....GAA......VD
gi|4506217|ref|NP_002805.1|       .--------....................................---.....---......--
gi|188595682|ref|NP_001120965.1|  .NVNVATLL....................................LNR.....GAA......VD
gi|52426737|ref|NP_066187.2|      .NVNVATLL....................................LNR.....GAA......VD
gi|224465233|ref|NP_079033.4|     .HVDICHML....................................VQA.....GAN......ID
gi|164664508|ref|NP_005169.2|     .NLPAVHRL....................................VNLfqqg.GRE......LD
gi|7705748|ref|NP_057062.1|       .HLEAADVL....................................LQH.....GAN......VN
gi|313569861|ref|NP_001186256.1|  .HLEAADVL....................................LQH.....GAN......VN
gi|163914396|ref|NP_001106279.1|  .HLEAADVL....................................LQH.....GAN......VN
gi|87239981|ref|NP_003738.2|      .RKQVTELL....................................LRK.....GAN......VN
gi|13376842|ref|NP_079511.1|      kRKQICELL....................................LRK.....GAN......IN
gi|7705831|ref|NP_057199.1|       .SVECLQML....................................INA.....DSSeny...IK
gi|255982572|ref|NP_001157637.1|  .SVECLQML....................................INA.....DSSeny...IK
gi|338797777|ref|NP_001229742.1|  .HLPVVQIL....................................LKA.....GCD......LD
gi|338797775|ref|NP_055757.3|     .HLPVVQIL....................................LKA.....GCD......LD
gi|338797766|ref|NP_001229738.1|  .HLPVVQIL....................................LKA.....GCD......LD
gi|338797770|ref|NP_001229740.1|  .HLPVVQIL....................................LKA.....GCD......LD
gi|206597522|ref|NP_001128663.1|  .--------....................................---.....---......--
gi|4502249|ref|NP_003878.1|       .--------....................................---.....---......--
gi|304434690|ref|NP_001182073.1|  .HIDAVSLL....................................LEK.....EAN......VD
gi|157743284|ref|NP_775866.2|     .HVDCVHLL....................................LEK.....GST......AD
gi|46094081|ref|NP_060952.2|      .--------....................................---.....---......--
gi|13376842|ref|NP_079511.1|      .RKDVVEYL....................................LQN.....GAN......VQ
gi|87239981|ref|NP_003738.2|      .RKDVVEHL....................................LQM.....GAN......VH
gi|156142197|ref|NP_006700.3|     .SVEICHVL....................................LQA.....GAN......IN
gi|156142199|ref|NP_079532.5|     .SVEICHVL....................................LQA.....GAN......IN
gi|92087060|ref|NP_563616.3|      .SYDMVSTL....................................IKH.....NTS......LD
gi|70995267|ref|NP_775776.2|      .HIDCVREL....................................VLQ.....GAD......IN
gi|219842212|ref|NP_001137357.1|  .DTDEVLKL....................................LHR.....GAD......IN
gi|4505317|ref|NP_002471.1|       .DTDEVLKL....................................LHR.....GAD......IN
gi|116534990|ref|NP_015628.2|     .QIESVKFL....................................LSR.....GAN......PN
gi|282394038|ref|NP_001164160.1|  .QVELIRLL....................................LQA.....RAG......VD
gi|282394032|ref|NP_001164157.1|  .QVELIRLL....................................LQA.....RAG......VD
gi|282394030|ref|NP_543151.2|     .QVELIRLL....................................LQA.....RAG......VD
gi|282394036|ref|NP_001164159.1|  .QVELIRLL....................................LQA.....RAG......VD
gi|282394034|ref|NP_001164158.1|  .QVELIRLL....................................LQA.....RAG......VD
gi|58331111|ref|NP_061919.1|      .HRDVLAYL....................................AEAw....GMD......IE
gi|58331113|ref|NP_001009941.1|   .HRDVLAYL....................................AEAw....GMD......IE
gi|268607595|ref|NP_001161354.1|  .REDSIRTL....................................LDN.....GAS......VN
gi|62988328|ref|NP_065070.1|      .REDSIRTL....................................LDN.....GAS......VN
gi|221307473|ref|NP_001137250.1|  .--------....................................---.....---......--
gi|19923540|ref|NP_060177.2|      .--------....................................---.....---......--
gi|140161500|ref|NP_056060.2|     .HKDVVEVL....................................LRN.....DAL......TN
gi|224809478|ref|NP_001138997.1|  .DAEKVASL....................................LGKk....GAS......AT
gi|224809468|ref|NP_056392.2|     .DAEKVASL....................................LGKk....GAS......AT
gi|224809470|ref|NP_001138992.1|  .DAEKVASL....................................LGKk....GAS......AT
gi|224809472|ref|NP_001138993.1|  .DAEKVASL....................................LGKk....GAS......AT
gi|224809474|ref|NP_001138994.1|  .DAEKVASL....................................LGKk....GAS......AT
gi|18079216|ref|NP_065815.1|      .NTELISLL....................................LEA.....QAA......VD
gi|224809476|ref|NP_001138995.1|  .DAEKVASL....................................LGKk....GAS......AT
gi|217416347|ref|NP_065804.2|     .SLELIALL....................................LEA.....QAT......VD
gi|341915690|ref|XP_003403588.1|  .KVPRKDLI....................................VMLr....DTD......MN
gi|239745058|ref|XP_002343353.1|  .KVPRKDLI....................................VMLr....DTD......MN
gi|341915688|ref|XP_003403587.1|  .KVPRKDLI....................................VMLr....DTD......MN
gi|310118968|ref|XP_003118905.1|  .DLEELKFV....................................LLT.....RYD......IN
gi|30348954|ref|NP_065825.1|      .HVDILKLL....................................LKQ.....NVD......VE
gi|310118966|ref|XP_001717815.3|  .DLEELKFV....................................LLT.....RYD......IN
gi|71274109|ref|NP_004547.2|      .APAVLLCC....................................LALlp...QEV......LD
gi|110431370|ref|NP_113663.2|     .HLACLQWL....................................LSQg....GCR......VQ
gi|256222430|ref|NP_079466.3|     .NLEKLKYL....................................LLT.....YYD......AN
gi|28626517|ref|NP_056383.1|      .DAEEVRYF....................................LKN.....KVS......PD
gi|53828703|ref|NP_001005365.2|   .EVPRADLI....................................VMLr....GPG......IN
gi|239747114|ref|XP_002343914.1|  .KVPRKDLI....................................VMLr....DTD......MN
gi|153792284|ref|NP_778146.2|     .KVPRKDLI....................................VMLr....DTD......MN
gi|52856434|ref|NP_001005356.1|   .KVPRKDLI....................................VMLk....DTD......MN
gi|50511945|ref|NP_690001.3|      .HKDIVLKL....................................LQY.....EAS......TN
gi|148596917|ref|NP_660278.3|     .DEDLLVRI....................................LQGg....RVK......VD
gi|209977003|ref|NP_001129685.1|  .KVPRKDLI....................................VMLk....DTD......MN
gi|212549546|ref|NP_001131143.1|  .KVPRKDLI....................................VMLr....DTD......MN
gi|256222280|ref|NP_001157787.1|  .NLEKLKYL....................................LLT.....YYD......AN
gi|224282147|ref|NP_001138914.1|  .KVPRKDLI....................................VMLk....DTD......MN
gi|259155302|ref|NP_001158884.1|  .HSQLVRDL....................................LEV.....TSGlisddiIN
gi|121582655|ref|NP_653299.3|     .DVGRVAAL....................................ASRk....SAR......PT
gi|68131557|ref|NP_056014.2|      .RFSRSQTI....................................IQS.....GAV......ID
gi|34577122|ref|NP_003989.2|      .HSQLVRDL....................................LEV.....TSGlisddiIN
gi|153791352|ref|NP_001093241.1|  .KVPRKDLI....................................VMLr....DTD......VN
gi|103471993|ref|NP_056151.2|     .IYERCREL....................................VEA.....GYD......VR
gi|134133226|ref|NP_001077007.1|  .KVPRKDLI....................................VMLr....DTD......VN
gi|268607514|ref|NP_001161330.1|  .DTDEVRKL....................................LAR.....GAD......IN
gi|268607512|ref|NP_001161329.1|  .DTDEVRKL....................................LAR.....GAD......IN
gi|30089994|ref|NP_078984.2|      .KERCVRVF....................................LEH.....GAD......PT
gi|22208957|ref|NP_078977.2|      .ESLQLQQL....................................IES.....GAC......VN
gi|22208951|ref|NP_665862.1|      .HWKIVQIL....................................LEA.....GAD......PN
gi|320202950|ref|NP_001188894.1|  .HWKIVQIL....................................LEA.....GAD......PN
gi|37620163|ref|NP_065741.3|      .YYELAQVL....................................LAM.....HAN......VE
gi|46519147|ref|NP_060217.1|      .YYELAQVL....................................LAM.....HAN......VE
gi|38176283|ref|NP_937886.1|      .KERCVRVF....................................LEH.....GAD......PT
gi|88953571|ref|XP_933678.1|      .KVARKDLI....................................VMLr....DTD......VN
gi|113413200|ref|XP_934799.2|     .KVARKDLI....................................VMLr....DTD......VN
gi|268607506|ref|NP_002472.2|     .DTDEVRKL....................................LAR.....GAD......IN
gi|118150656|ref|NP_062618.2|     .DLKKLKEY....................................LQIk....KYD......VN
gi|38683816|ref|NP_942592.1|      .HEEMVALL....................................LGQ.....GAN......IN
gi|38683807|ref|NP_115593.3|      .HEEMVALL....................................LGQ.....GAN......IN
gi|304434690|ref|NP_001182073.1|  .---CLELL....................................VNN.....GAD......VN
gi|215598806|ref|NP_543147.2|     .HTEVLRLL....................................LRR.....RAR......PD
gi|52486194|ref|NP_003551.2|      .DGEILVEL....................................VQYc....HTQ......MD
gi|294337038|ref|NP_001135932.2|  .HTEVLRLL....................................LRR.....RAR......PD
gi|294337037|ref|NP_001135931.2|  .HTEVLRLL....................................LRR.....RAR......PD
gi|116875852|ref|NP_065822.2|     .SVECLVLL....................................LKK.....GAN......PN
gi|117320527|ref|NP_002493.3|     .QTSVIEQI....................................VYVih...HAQdlgv..VN
gi|117320540|ref|NP_001070961.1|  .QTSVIEQI....................................VYVih...HAQdlgv..VN
gi|117320531|ref|NP_001070962.1|  .QTSVIEQI....................................VYVih...HAQdlgv..VN
gi|313760592|ref|NP_001186491.1|  .DGEILVEL....................................VQYc....HTQ......MD
gi|52486251|ref|NP_001004426.1|   .DGEILVEL....................................VQYc....HTQ......MD
gi|16975496|ref|NP_219499.1|      .NVTLLSML....................................LNEe....GLD......IN
gi|52426737|ref|NP_066187.2|      .HVGLVQEL....................................LGR.....GSS......VD
gi|341914805|ref|XP_003403867.1|  .DAAEVEHC....................................LTRr....FRD......LD
gi|60115723|ref|NP_001012421.1|   .DAAEVERC....................................LARr....SGD......LD
gi|60460920|ref|NP_001012419.1|   .DAAEVERC....................................LARr....SGD......LD
gi|156104901|ref|NP_115626.2|     .DAAEVERC....................................LARr....SGD......LD
gi|341914105|ref|XP_001715780.3|  .DVNKVMES....................................ILLr....LND......LN
gi|149363679|ref|NP_001092275.1|  .DAAEVERC....................................LARr....SGE......LD
gi|188595682|ref|NP_001120965.1|  .HVGLVQEL....................................LGR.....GSS......VD
gi|14249672|ref|NP_116291.1|      .DLEEVRQF....................................LGS.....GVS......PD
gi|341915999|ref|XP_292717.9|     .DVNKVMES....................................ILLr....LND......LN
gi|157743284|ref|NP_775866.2|     .--------....................................LSA.....GFD......IN
gi|222537750|ref|NP_001138501.1|  .QVQKLEKM....................................TVGkk...PVN......LN
gi|325053666|ref|NP_001191332.1|  .HVEVVSEL....................................LQR.....EAN......VD
gi|283549153|ref|NP_671728.2|     .DAAEVERC....................................LTRr....FRD......LD
gi|155969701|ref|NP_919288.2|     .HPVLVEWL....................................LHE.....GHS......AT
gi|312147315|ref|NP_001185879.1|  .NDKEVLRL....................................LKE.....GAD......PH
gi|62177127|ref|NP_055826.1|      .NDKEVLRL....................................LKE.....GAD......PH
gi|90186267|ref|NP_078945.2|      .QADTVKLL....................................LKM.....GAN......IN
gi|134244285|ref|NP_000426.2|     .--------....................................---.....GMD......VN
gi|56550047|ref|NP_001008225.1|   .DVEKVTSI....................................LAKk....GVN......PG
gi|67906195|ref|NP_775822.3|      .DTETARRLlepgaaepaergaepeagaepagaevagpgaaaagaVGA.....PVP......VD
gi|267844887|ref|NP_001136205.2|  .NRKILEIT....................................LSAsd...PSL......WE
gi|47933346|ref|NP_061901.2|      .IFERCKEL....................................VEA.....GYD......VR
gi|110815813|ref|NP_057460.3|     .NEPTACFL....................................IRS.....GCD......VN
gi|55770876|ref|NP_004548.3|      .--------....................................---.....---......LD
gi|59850762|ref|NP_060473.2|      .DVEKVTSI....................................LAKk....GVN......PG
gi|18254476|ref|NP_543150.1|      .RLLALRTL....................................LSQ.....GYN......VN
gi|310114187|ref|XP_003119912.1|  .--------....................................---.....---......--
gi|148833508|ref|NP_060087.3|     .--------....................................---.....--D......VN
gi|7657265|ref|NP_056137.1|       .HAKVVRLL....................................LEHy....RVQ......TQ
gi|34304379|ref|NP_899068.1|      .RLDCADAL....................................LKA.....GAD......VN
gi|34304381|ref|NP_055240.2|      .RLDCADAL....................................LKA.....GAD......VN
gi|38327522|ref|NP_055206.2|      .--------....................................---.....---......--
gi|115495445|ref|NP_443723.2|     .--------....................................---.....-IN......LN
gi|17981699|ref|NP_523240.1|      .--------....................................---.....---......--
gi|4502751|ref|NP_001253.1|       .--------....................................---.....---......--
gi|24041035|ref|NP_077719.2|      .--------....................................---.....--D......VN
gi|17864094|ref|NP_064562.1|      .HLDMVEFL....................................LEQc....SAS......IE
gi|42734375|ref|NP_597707.1|      .--------....................................---.....---......--
gi|13443014|ref|NP_076992.1|      .HQLSLRNL....................................ISQ.....GWA......VN
gi|271398201|ref|NP_001162003.1|  .HQLSLRNL....................................ISQ.....GWA......VN
gi|60218887|ref|NP_001012428.1|   .RLLALKTL....................................IAQ.....GVN......VN
gi|58331117|ref|NP_001009943.1|   .HRDVLAYL....................................AEAw....GMD......IE
gi|72534772|ref|NP_001026909.1|   .HQLSLRNL....................................ISQ.....GWA......VN
gi|18254474|ref|NP_543149.1|      .RLLALKTL....................................IAQ.....GVN......VN
gi|338797779|ref|NP_001229743.1|  .QTENVVQL....................................INK.....GAR......VA
gi|116325987|ref|NP_872409.2|     .QDACVQAL....................................IMN.....GAN......LT
gi|17981702|ref|NP_524145.1|      .DVQEVRRL....................................LHRe....L--......--
gi|4502753|ref|NP_001791.1|       .DVQEVRRL....................................LHRe....L--......--
gi|126723390|ref|NP_597732.1|     .DAPRVAAL....................................IARk....GLV......PT
gi|38569426|ref|NP_071379.3|      .DIDMVSFL....................................LDL.....GAH......PD
gi|38569428|ref|NP_942093.1|      .DIDMVSFL....................................LDL.....GAH......PD
gi|24308163|ref|NP_061178.1|      .HLDVVEYL....................................VDRc....GAS......VE
gi|53832024|ref|NP_001005474.1|   .RRALSYVL....................................ARKm....NALhm....LD
gi|13899229|ref|NP_113607.1|      .RRALSYVL....................................ARKm....NALhm....LD
gi|14149716|ref|NP_060077.1|      .--------....................................---.....---......-D
gi|39812133|ref|NP_065082.2|      .KMKVIEKF....................................LAD.....GGS......AD
gi|17981694|ref|NP_004927.2|      .--------....................................---.....---......--
gi|116063534|ref|NP_115515.2|     .--------....................................---.....---......--
gi|4502749|ref|NP_000068.1|       .--------....................................---.....---......--
gi|304376272|ref|NP_001182061.1|  .--------....................................---.....---......--
gi|32483404|ref|NP_852092.1|      .--------....................................---.....---......--
gi|8051599|ref|NP_057739.1|       .--------....................................---.....---......--
gi|8051597|ref|NP_002032.2|       .--------....................................---.....---......--
gi|8051595|ref|NP_057738.1|       .--------....................................---.....---......--
gi|8051593|ref|NP_005245.2|       .--------....................................---.....---......--
gi|41327752|ref|NP_659431.5|      .--------....................................---.....---......--
gi|120587025|ref|NP_057232.2|     .TSDKVARL....................................LDK.....GLD......PN
gi|24586688|ref|NP_543139.4|      .YTDCARHL....................................IRQ.....GAE......LD
gi|110815813|ref|NP_057460.3|     .LESIATTL....................................VSH.....KAD......VD
gi|22208964|ref|NP_665879.1|      .HVECLLVL....................................LDH.....NAT......IN
gi|157743292|ref|NP_997721.2|     .HTACVRHL....................................LGR.....GAD......PD
gi|7706379|ref|NP_057200.1|       .HVECLLVL....................................LDH.....NAT......IN
gi|217416350|ref|NP_001136115.1|  .--------....................................---.....---......--
gi|226817313|ref|NP_036441.2|     .LVEKITKM....................................LDR.....GLD......PN
gi|52426735|ref|NP_001139.3|      .HVGLVQEL....................................LGR.....GSS......VD
gi|219842214|ref|NP_001137358.1|  .--------....................................---.....---......--
gi|13129098|ref|NP_077000.1|      .--------....................................---.....---......--
gi|21389427|ref|NP_653219.1|      .--------....................................---.....---......--
gi|271398185|ref|NP_001162002.1|  .HQLSLRNL....................................ISQ.....GWA......VN
gi|122937241|ref|NP_001073889.1|  .STDKVARL....................................LDK.....GLD......PN
gi|341915692|ref|XP_003403589.1|  .KVPRKDLI....................................VMLr....DTD......MN
gi|320202942|ref|NP_001188512.1|  .RLLALKTL....................................IAQ.....---......--
gi|116063534|ref|NP_115515.2|     .--DDCEKL....................................VSG.....RLNdpsvvtPF
gi|18640738|ref|NP_570124.1|      .--------....................................---.....---......--
gi|50897294|ref|NP_001002920.1|   .EVPRADLI....................................VMLr....GPG......IN
gi|116534990|ref|NP_015628.2|     .GPGSVNNL....................................LGF.....NVS......IH
gi|154354990|ref|NP_055730.2|     .NVAKVQQI....................................LLLr....KNG......LN
gi|341914820|ref|XP_003403870.1|  .DAAEVERC....................................LARr....SGD......LH
gi|19718741|ref|NP_542164.2|      .--------....................................ADI.....NCK......GR
gi|23510377|ref|NP_694856.1|      .--------....................................---.....---......--
gi|64464726|ref|NP_055973.2|      .--------....................................---.....---......--
gi|28605137|ref|NP_736606.1|      .KLEELKES....................................ILAd....KSL......AT
gi|289629249|ref|NP_001166206.1|  .DAEEVRYF....................................LKN.....KVS......PD
gi|13376842|ref|NP_079511.1|      .--------....................................---.....---......--
gi|87239981|ref|NP_003738.2|      .--------....................................---.....---......--
gi|41281709|ref|NP_640332.1|      .LRWAAYAA....................................AEVlqv..YRR......LD
gi|194018403|ref|NP_001123453.1|  .--------....................................---.....---......--
gi|41350198|ref|NP_060174.2|      .--------....................................---.....---......--
gi|169403957|ref|NP_079209.3|     .--------....................................---.....---......--
gi|169403959|ref|NP_001108588.1|  .--------....................................---.....---......--
gi|157504499|ref|NP_940873.2|     .--------....................................---.....---......--
gi|156142184|ref|NP_057550.3|     .DLGRVKHL....................................IQK.....AED......PS
gi|38569426|ref|NP_071379.3|      .--------....................................---.....---......--
gi|38569428|ref|NP_942093.1|      .--------....................................---.....---......--
gi|70995241|ref|NP_060134.2|      .KLECLVQL....................................VRA.....GAT......LN
gi|209969812|ref|NP_001129663.1|  .--------....................................---.....---......--
gi|258613875|ref|NP_056308.3|     .--------....................................---.....---......--
gi|12746412|ref|NP_075526.1|      .--------....................................---.....---......--
gi|320461689|ref|NP_569059.3|     .DSYTLDQL....................................LRQe....RYKrf....IN
gi|4758606|ref|NP_004508.1|       .NAVAVRLW....................................LDNt....END......LN
gi|62420873|ref|NP_001014794.1|   .NAVAVRLW....................................LDNt....END......LN
gi|62420875|ref|NP_001014795.1|   .NAVAVRLW....................................LDNt....END......LN
gi|157266328|ref|NP_000456.2|     .--------....................................---.....---......--
gi|154091032|ref|NP_653191.2|     .--------....................................---.....---......--
gi|134948558|ref|NP_056023.3|     .--------....................................---.....---......--
gi|134948605|ref|NP_001077094.1|  .--------....................................---.....---......--
gi|323362985|ref|NP_001190985.1|  .--------....................................---.....---......--
gi|4506499|ref|NP_003712.1|       .EIETVRFL....................................LEW.....GAD......PH
gi|21956645|ref|NP_665807.1|      .--------....................................---.....---......--
gi|94721248|ref|NP_001035535.1|   .DLQTLRSL....................................LQEesy..RSR......IN
gi|156104862|ref|NP_859063.3|     .--------....................................---.....---......VN
gi|56676397|ref|NP_037407.4|      .--------....................................---.....---......--
gi|41055989|ref|NP_059990.2|      .DYITVKVA....................................LNSne...EYN......LD
gi|304434690|ref|NP_001182073.1|  .--------....................................---.....---......--
gi|19924156|ref|NP_604389.1|      .--------....................................---.....---......--
gi|256574792|ref|NP_001157915.1|  .--------....................................---.....---......--
gi|20270347|ref|NP_620152.1|      .--------....................................---.....---......--
gi|31317252|ref|NP_065791.1|      .REDVVFLY....................................LIEmdsqlPGK......LN
gi|320461543|ref|NP_001073933.2|  .DVEALQAL....................................VEL.....GSD......LG
gi|21314682|ref|NP_061116.2|      .DVQALNKL....................................LKYe....DCK......VH
gi|47933348|ref|NP_001001483.1|   .--------....................................---.....---......--
gi|267844887|ref|NP_001136205.2|  .--------....................................---.....---......--
gi|187608777|ref|NP_038460.4|     .QLRRVQDL....................................VRQ.....GHP......LN
gi|34304383|ref|NP_775748.2|      .--------....................................---.....---......--
gi|256574784|ref|NP_001157912.1|  .FVDTVVAL....................................AECp....HVD......VN
gi|8923516|ref|NP_060343.1|       .LTRAADVL....................................LRH.....GAN......LN
gi|17505200|ref|NP_062815.2|      .DLSVLRQL....................................LLDc....TCD......VR
gi|38257146|ref|NP_940683.1|      .DFNYSKRL....................................LES.....GFD......PN
gi|321267560|ref|NP_001155907.2|  .DYSLVKKI....................................LKKg....LCD......PN
gi|183396785|ref|NP_001116856.1|  .--------....................................---.....---......--
gi|183396783|ref|NP_001116855.1|  .--------....................................---.....---......--
gi|21071037|ref|NP_060215.4|      .--------....................................---.....---......--
gi|183396787|ref|NP_001116857.1|  .--------....................................---.....---......--
gi|299473797|ref|NP_001177408.1|  .KVHLARFV....................................LDAld...RSI......ID
gi|284413734|ref|NP_653309.3|     .--AVFHTF....................................SRKts...SST......IN
gi|341915472|ref|XP_003403627.1|  .--------....................................---.....-MD......LN
gi|341915476|ref|XP_003403594.1|  .--------....................................---.....-MD......LN
gi|14150169|ref|NP_115736.1|      .--------....................................---.....---......--
gi|256574792|ref|NP_001157915.1|  .--------....................................---.....---......--
gi|67906195|ref|NP_775822.3|      .--------....................................---.....---......--
gi|28461129|ref|NP_064715.1|      .--------....................................---.....---......--
gi|166235148|ref|NP_036515.4|     .--------....................................---.....---......--
gi|148664246|ref|NP_665872.2|     .--------....................................---.....---......--
gi|76563940|ref|NP_005451.2|      .HAECLQHL....................................TSLm....GEDc.....LN
gi|257467559|ref|NP_001004441.2|  .RLRLTRLL....................................LEG.....GAY......IN
gi|226437606|ref|NP_001139813.1|  .RLRLTRLL....................................LEG.....GAY......IN
gi|188219549|ref|NP_115666.2|     .--------....................................---.....---......--
gi|13540606|ref|NP_110440.1|      .--------....................................---.....---......--
gi|89941470|ref|NP_001034977.1|   .KLRLARLL....................................LEG.....GAY......VN
gi|62953116|ref|NP_001017523.1|   .RTDLVKQA....................................VSLl....GPDg.....IN
gi|4885643|ref|NP_005417.1|       .-FDLVQRI....................................IYE.....---......--
gi|112799849|ref|NP_001026855.2|  .-FDLVQRI....................................IYE.....---......--
gi|65786661|ref|NP_001018082.1|   .RTDLVKQA....................................VSLl....GPDg.....IN
gi|56090539|ref|NP_001007534.1|   .-------F....................................IRT.....---......--
gi|118498337|ref|NP_056197.2|     .--------....................................---.....---......--
gi|187608516|ref|NP_036419.3|     .--------....................................---.....---......--
gi|194097375|ref|NP_872414.3|     .FQSVVALL....................................SHCp....FLD......VN
gi|320202962|ref|NP_001189332.1|  .LTRAADVL....................................LRH.....GAN......LN
gi|31581522|ref|NP_004903.2|      .DSELLSRL....................................LSE.....RFS......VN
gi|37221182|ref|NP_919437.1|      .DSELLSRL....................................LSE.....RFS......VN
gi|37221184|ref|NP_919438.1|      .DSELLSRL....................................LSE.....RFS......VN
gi|37221187|ref|NP_919436.1|      .DSELLSRL....................................LSE.....RFS......VN
gi|121114287|ref|NP_056131.2|     .EFDLVQRI....................................IYE.....VED......PS
gi|194097377|ref|NP_001123487.1|  .FQSVVALL....................................SHCp....FLD......VN
gi|300796386|ref|NP_665803.2|     .RTDLINQA....................................IEAl....GPDg.....VN
gi|218563749|ref|NP_085152.2|     .--------....................................---.....---......--
gi|296179431|ref|NP_068765.3|     .-KDVVLYC....................................LQKd....SED......VN
gi|215820635|ref|NP_001135974.1|  .ELEVVQQA....................................VKE.....MND......PS
gi|63003907|ref|NP_006654.2|      .ELEVVQQA....................................VKE.....MND......PS
gi|168229256|ref|NP_689576.4|     .--------....................................---.....---......--
gi|148596953|ref|NP_061877.1|     .MNKILGTF....................................LGR.....DGN......PN
gi|7661880|ref|NP_055531.1|       .--------....................................---.....---......--
gi|21735483|ref|NP_659505.1|      .--------....................................---.....---......--
gi|32171201|ref|NP_859077.1|      .--------....................................---.....---......--
gi|341915877|ref|XP_001134442.4|  .--------....................................---.....---......--
gi|75750529|ref|NP_057636.2|      .--------....................................---.....---......--
gi|68131557|ref|NP_056014.2|      .--------....................................---.....---......--
gi|38348298|ref|NP_940895.1|      .QSDVIRAL....................................AKY.....GVN......LN
gi|319803120|ref|NP_001188386.1|  .NYVKVKKI....................................LKK.....GIY......VD
gi|57863263|ref|NP_938207.2|      .NYVKVKKI....................................LKK.....GIY......VD
gi|57863261|ref|NP_112562.3|      .NYVKVKKI....................................LKK.....GIY......VD
gi|341914329|ref|XP_001717391.3|  .--------....................................---.....---......--
gi|51972284|ref|NP_001004354.1|   .--------....................................---.....--N......VN
gi|41393573|ref|NP_054749.2|      .--------....................................---.....---......--
gi|146231998|ref|NP_001078923.1|  .--------....................................---.....---......--
gi|313102999|ref|NP_001186197.1|  .--------....................................---.....---......--
gi|41872507|ref|NP_003637.2|      .--------....................................---.....---......--
gi|313102997|ref|NP_001186196.1|  .--------....................................---.....---......--
gi|313103001|ref|NP_963291.2|     .--------....................................---.....---......--
gi|41872522|ref|NP_963290.1|      .--------....................................---.....---......--
gi|13899267|ref|NP_113626.1|      .--------....................................---.....---......--
gi|157688564|ref|NP_001099010.1|  .--------....................................---.....---......--
gi|18390333|ref|NP_569058.1|      .--------....................................---.....---......--
gi|4758156|ref|NP_004708.1|       .--------....................................---.....---......--
gi|206725420|ref|NP_001128685.1|  .--------....................................---.....---......--
gi|206725415|ref|NP_631940.2|     .--------....................................---.....---......--
gi|24308163|ref|NP_061178.1|      .--------....................................---.....---......--
gi|17149832|ref|NP_476511.1|      .--------....................................---.....---......--
gi|74315348|ref|NP_542435.2|      .--------....................................---.....--S......YT
gi|74315350|ref|NP_061197.4|      .--------....................................---.....--S......YT
gi|74315352|ref|NP_542436.2|      .--------....................................---.....--S......YT
gi|74315354|ref|NP_542437.2|      .--------....................................---.....--S......YT
gi|21237786|ref|NP_055591.2|      .--------....................................---.....---......--
gi|124517699|ref|NP_689558.4|     .--------....................................---.....---......--
gi|206725422|ref|NP_001128686.1|  .--------....................................---.....---......--
gi|17149830|ref|NP_476510.1|      .--------....................................---.....---......--
gi|17864094|ref|NP_064562.1|      .--------....................................---.....---......--
gi|54607077|ref|NP_075392.2|      .--------....................................---.....---......--
gi|31982881|ref|NP_078968.3|      .--------....................................---.....---......--
gi|20336214|ref|NP_037399.2|      .--------....................................---.....---......--
gi|57863304|ref|NP_056340.2|      .--------....................................---.....---......--
gi|304361757|ref|NP_001182027.1|  .QTNTVEML....................................VSSa....SAE......LT
gi|304361760|ref|NP_001182028.1|  .QTNTVEML....................................VSSa....SAE......LT
gi|313102995|ref|NP_001186195.1|  .--------....................................---.....---......--
gi|20127551|ref|NP_057197.2|      .--------....................................---.....---......--
gi|38683799|ref|NP_149112.1|      .--------....................................---.....---......--
gi|166795254|ref|NP_110443.3|     .DVRRLSSL....................................IRT.....---......--
gi|18496983|ref|NP_056341.1|      .--------....................................---.....---......--
gi|313851097|ref|NP_001186499.1|  .--------....................................---.....---......--
gi|155969701|ref|NP_919288.2|     .DVATLERL....................................LEA.....GALg.....PG
gi|30089932|ref|NP_821066.1|      .--------....................................---.....---......--
gi|156104878|ref|NP_055720.3|     .--------....................................---.....---......--
gi|294459971|ref|NP_001170902.1|  .--------....................................---.....---......--
gi|22547184|ref|NP_067638.3|      .--------....................................---.....---......--
gi|7661962|ref|NP_055585.1|       .--------....................................---.....---......--
gi|117956371|ref|NP_001071154.1|  .--------....................................---.....---......--
gi|95147559|ref|NP_787069.3|      .--------....................................---.....---......--
gi|16418357|ref|NP_443087.1|      .--------....................................---.....---......--
gi|170650694|ref|NP_001116244.1|  .--------....................................---.....---......--
gi|150378537|ref|NP_001092877.1|  .--------....................................---.....---......--
gi|80978934|ref|NP_055729.2|      .--------....................................---.....---......--
gi|5730102|ref|NP_004612.2|       .NIPVVRKM....................................LEEch...SLN......VN
gi|80978930|ref|NP_001032208.1|   .--------....................................---.....---......--
gi|269315852|ref|NP_997237.2|     .--------....................................---.....---......--
gi|255982572|ref|NP_001157637.1|  .--------....................................---.....---......--
gi|7705831|ref|NP_057199.1|       .--------....................................---.....---......--
gi|148806877|ref|NP_597704.1|     .--------....................................---.....---......--
gi|156104893|ref|NP_597703.2|     .--------....................................---.....---......--
gi|117956373|ref|NP_001071153.1|  .--------....................................---.....---......--
gi|221136914|ref|NP_001137472.1|  .--------....................................---.....---......--
gi|166851846|ref|NP_001071133.2|  .--------....................................---.....---......--
gi|339275867|ref|NP_001229858.1|  .--------....................................---.....---......--
gi|90991702|ref|NP_078928.3|      .DLEMVRYL....................................LSK.....RLV......EL
gi|71274172|ref|NP_001025041.1|   .--------....................................---.....---......--
gi|22547180|ref|NP_671737.1|      .--------....................................---.....---......--
gi|4507687|ref|NP_003296.1|       .NIPVVRKM....................................LEEsk...TLN......VN
gi|6912736|ref|NP_036603.1|       .--------....................................---.....-VN......IN
gi|110227613|ref|NP_114152.3|     .--------....................................---.....--N......ET
gi|194733735|ref|NP_001124170.1|  .NIPVVRKM....................................LEEsk...TLN......VN
gi|209863030|ref|NP_001129429.1|  .--------....................................---.....-IN......IN
gi|209863028|ref|NP_001129428.1|  .--------....................................---.....-IN......IN
gi|209863026|ref|NP_001129427.1|  .--------....................................---.....-IN......IN
gi|7706747|ref|NP_057263.1|       .--------....................................---.....-IN......IN
gi|209863024|ref|NP_003297.1|     .--------....................................---.....-IN......IN
gi|262399375|ref|NP_001161048.1|  .NIPVVRKM....................................LEEsk...TLN......FN
gi|262399379|ref|NP_001161049.1|  .NIPVVRKM....................................LEEsk...TLN......FN
gi|9966865|ref|NP_065122.1|       .NIPVVRKM....................................LEEsk...TLN......FN
gi|25777624|ref|NP_742024.1|      .DVGRVRYL....................................LEQr....DVE......VN
gi|54112401|ref|NP_056030.1|      .--------....................................---.....---......--
gi|157743267|ref|NP_001099046.1|  .--------....................................---.....---......--
gi|110815813|ref|NP_057460.3|     .-------L....................................IQR.....GSH......TD
gi|269847874|ref|NP_073739.3|     .--------....................................---.....---......--
gi|75750531|ref|NP_060314.2|      .--------....................................---.....---......--
gi|7657265|ref|NP_056137.1|       .--------....................................---.....---......--
gi|75750529|ref|NP_057636.2|      .--------....................................---.....---......--
gi|257467636|ref|NP_055646.2|     .--------....................................---.....---......--
gi|222352179|ref|NP_001138435.1|  .--------....................................---.....---......--
gi|222352177|ref|NP_001138434.1|  .--------....................................---.....---......--
gi|222352175|ref|NP_001138433.1|  .--------....................................---.....---......--
gi|222352173|ref|NP_004998.3|     .--------....................................---.....---......--
gi|61742817|ref|NP_001013424.1|   .--------....................................---.....---......--
gi|239744064|ref|XP_001714838.2|  .--------....................................---.....---......--
gi|222352168|ref|NP_001138432.1|  .YIELTEWA....................................LKQ.....GAR......PH
gi|29826341|ref|NP_055914.2|      .--------....................................---.....---......--
gi|284005535|ref|NP_001164637.1|  .--------....................................---.....---......--
gi|284005543|ref|NP_001164639.1|  .--------....................................---.....---......--
gi|284005537|ref|NP_001164638.1|  .--------....................................---.....---......--
gi|4507685|ref|NP_003295.1|       .DYYMVKKI....................................LEEnssg.DLN......IN
gi|15042961|ref|NP_149417.1|      .--------....................................---.....---......--
gi|312839866|ref|NP_001186166.1|  .--------....................................---.....---......--
gi|312839869|ref|NP_001186167.1|  .--------....................................---.....---......--
gi|312839871|ref|NP_001186168.1|  .--------....................................---.....---......--
gi|312839873|ref|NP_001186169.1|  .--------....................................---.....---......--
gi|109150425|ref|NP_060559.2|     .DVGVLKLQ....................................LAPs....PAD......PR
gi|109150435|ref|NP_001035869.1|  .DVGVLKLQ....................................LAPs....PAD......PR
gi|257467636|ref|NP_055646.2|     .--------....................................---.....---......--
gi|294459965|ref|NP_001170899.1|  .--------....................................---.....---......--
gi|209863032|ref|NP_001129430.1|  .--------....................................---.....-IN......IN
gi|148664230|ref|NP_055929.1|     .QASICQLT....................................LDV.....LEN......PD
gi|114842396|ref|NP_694960.2|     .--------....................................---.....---......--
gi|294459977|ref|NP_001170904.1|  .--------....................................---.....---......--
gi|22748713|ref|NP_689539.1|      .--------....................................---.....---......--
gi|224465235|ref|NP_001138999.1|  .--------....................................---.....---......--
gi|98985804|ref|NP_478104.2|      .--------....................................---.....---......--
gi|17981696|ref|NP_511042.1|      .--------....................................---.....---......--
gi|260763963|ref|NP_001120979.2|  .--------....................................---.....---......--
gi|27477049|ref|NP_543144.1|      .--------....................................---.....---......--
gi|260763966|ref|NP_001077376.2|  .--------....................................---.....---......--
gi|260763960|ref|NP_060405.4|     .--------....................................---.....---......--
gi|75750531|ref|NP_060314.2|      .--------....................................---.....---......--


                                                                70                                  
                                                                 |                                  
d1s70b_                             Y...........................ANVD.....GL..TA.....................
gi|21361135|ref|NP_002494.2|      -...........................VTED.....GD..TA.....................
gi|70780355|ref|NP_065210.2|      L...........................ATTA.....GH..TP.....................
gi|215598574|ref|NP_001135918.1|  L...........................ATTA.....GH..TP.....................
gi|70780353|ref|NP_065208.2|      L...........................ATTA.....GH..TP.....................
gi|70780359|ref|NP_065209.2|      L...........................ATTA.....GH..TP.....................
gi|70780357|ref|NP_000028.3|      L...........................ATTA.....GH..TP.....................
gi|325053666|ref|NP_001191332.1|  I...........................TTKK.....GF..TP.....................
gi|325053668|ref|NP_001191333.1|  I...........................TTKK.....GF..TP.....................
gi|32967601|ref|NP_066267.2|      I...........................TTKK.....GF..TP.....................
gi|188595682|ref|NP_001120965.1|  L...........................ATKK.....GF..TP.....................
gi|52426737|ref|NP_066187.2|      L...........................ATKK.....GF..TP.....................
gi|52426735|ref|NP_001139.3|      L...........................ATKK.....GF..TP.....................
gi|268607595|ref|NP_001161354.1|  H...........................RDDA.....GW..TP.....................
gi|62988328|ref|NP_065070.1|      H...........................RDDA.....GW..TP.....................
gi|48928017|ref|NP_001001716.1|   -...........................----.....--..--.....................
gi|70780353|ref|NP_065208.2|      V...........................ATED.....GF..TP.....................
gi|70780355|ref|NP_065210.2|      V...........................ATED.....GF..TP.....................
gi|70780359|ref|NP_065209.2|      V...........................ATED.....GF..TP.....................
gi|70780357|ref|NP_000028.3|      V...........................ATED.....GF..TP.....................
gi|215598574|ref|NP_001135918.1|  V...........................ATED.....GF..TP.....................
gi|325053668|ref|NP_001191333.1|  L...........................ATED.....GF..TPlavalqqghdqvvslllendt
gi|32967601|ref|NP_066267.2|      L...........................ATED.....GF..TPlavalqqghdqvvslllendt
gi|304434687|ref|NP_710181.2|     V...........................SDRG.....GR..TA.....................
gi|30425444|ref|NP_848605.1|      R...........................VDED.....GW..AP.....................
gi|304361757|ref|NP_001182027.1|  E...........................PNAY.....GN..TP.....................
gi|304361760|ref|NP_001182028.1|  E...........................PNAY.....GN..TP.....................
gi|46519151|ref|NP_060448.1|      D...........................HNEN.....GH..TP.....................
gi|46519154|ref|NP_078944.2|      D...........................HNEN.....GH..TP.....................
gi|157743284|ref|NP_775866.2|     V...........................CDKK.....ER..QP.....................
gi|55741641|ref|NP_065789.1|      H...........................RDMG.....GW..TA.....................
gi|10863929|ref|NP_066956.1|      L...........................RKKN.....GA..TP.....................
gi|308044526|ref|NP_001183959.1|  S...........................QSAT.....GN..TA.....................
gi|41327754|ref|NP_065690.2|      A...........................KDED.....QW..TA.....................
gi|38683816|ref|NP_942592.1|      A...........................QSERt....KD..TP.....................
gi|38683807|ref|NP_115593.3|      A...........................QSERt....KD..TP.....................
gi|304434690|ref|NP_001182073.1|  A...........................KDNM.....WL..TP.....................
gi|46519147|ref|NP_060217.1|      M...........................PADS.....FE..SP.....................
gi|37620163|ref|NP_065741.3|      M...........................PADS.....FE..SP.....................
gi|304361757|ref|NP_001182027.1|  V...........................KDYIl....KR..TP.....................
gi|304361760|ref|NP_001182028.1|  V...........................KDYIl....KR..TP.....................
gi|37620163|ref|NP_065741.3|      H...........................RNVS.....DY..TP.....................
gi|46519147|ref|NP_060217.1|      H...........................RNVS.....DY..TP.....................
gi|68131557|ref|NP_056014.2|      A...........................KDSK.....WL..TP.....................
gi|96975023|ref|NP_874362.3|      H...........................VDKL.....GR..TA.....................
gi|10092619|ref|NP_065390.1|      F...........................QNNL.....QQ..TP.....................
gi|38683816|ref|NP_942592.1|      A...........................QSST.....GN..TA.....................
gi|38683807|ref|NP_115593.3|      A...........................QSST.....GN..TA.....................
gi|157739945|ref|NP_079461.2|     H...........................LDKN.....GQ..CA.....................
gi|18252778|ref|NP_057234.2|      Q...........................RTLQ.....EE..TA.....................
gi|89363047|ref|NP_004929.2|      V...........................KDKS.....GE..MA.....................
gi|321117514|ref|NP_001189358.1|  Q...........................RTLQ.....EE..TA.....................
gi|223634006|ref|NP_001138682.1|  A...........................VDRA.....GR..TA.....................
gi|341914599|ref|XP_001714535.3|  A...........................KNQD.....GM..SA.....................
gi|341915319|ref|XP_001128459.4|  A...........................KNQD.....GM..SA.....................
gi|34304379|ref|NP_899068.1|      P...........................SDSQ.....GA..TP.....................
gi|225543463|ref|NP_001139381.1|  H...........................LDKK.....GQ..CA.....................
gi|34304381|ref|NP_055240.2|      P...........................SDSQ.....GA..TP.....................
gi|225543461|ref|NP_203752.2|     H...........................LDKK.....GQ..CA.....................
gi|325053666|ref|NP_001191332.1|  F...........................TARN.....DI..TP.....................
gi|68131557|ref|NP_056014.2|      A...........................KDKW.....GR..TA.....................
gi|52426735|ref|NP_001139.3|      F...........................TARN.....GI..TP.....................
gi|4506217|ref|NP_002805.1|       -...........................-DQD.....SR..TA.....................
gi|188595682|ref|NP_001120965.1|  F...........................TARN.....GI..TP.....................
gi|52426737|ref|NP_066187.2|      F...........................TARN.....GI..TP.....................
gi|224465233|ref|NP_079033.4|     T...........................CSED.....QR..TP.....................
gi|164664508|ref|NP_005169.2|     I...........................YNNL.....RQ..TP.....................
gi|7705748|ref|NP_057062.1|       I...........................QDAV.....FF..TP.....................
gi|313569861|ref|NP_001186256.1|  I...........................QDAV.....FF..TP.....................
gi|163914396|ref|NP_001106279.1|  I...........................QDAV.....FF..TP.....................
gi|87239981|ref|NP_003738.2|      E...........................KNKD.....FM..TP.....................
gi|13376842|ref|NP_079511.1|      E...........................KTKE.....FL..TP.....................
gi|7705831|ref|NP_057199.1|       M...........................KTFE.....GF..CA.....................
gi|255982572|ref|NP_001157637.1|  M...........................KTFE.....GF..CA.....................
gi|338797777|ref|NP_001229742.1|  V...........................QDDG.....DQ..TA.....................
gi|338797775|ref|NP_055757.3|     V...........................QDDG.....DQ..TA.....................
gi|338797766|ref|NP_001229738.1|  V...........................QDDG.....DQ..TA.....................
gi|338797770|ref|NP_001229740.1|  V...........................QDDG.....DQ..TA.....................
gi|206597522|ref|NP_001128663.1|  -...........................----.....--..--.....................
gi|4502249|ref|NP_003878.1|       -...........................----.....--..--.....................
gi|304434690|ref|NP_001182073.1|  T...........................VDIL.....GC..TA.....................
gi|157743284|ref|NP_775866.2|     A...........................ADLR.....GR..TA.....................
gi|46094081|ref|NP_060952.2|      -...........................----.....--..--.....................
gi|13376842|ref|NP_079511.1|      A...........................RDDG.....GL..IP.....................
gi|87239981|ref|NP_003738.2|      A...........................RDDG.....GL..IP.....................
gi|156142197|ref|NP_006700.3|     A...........................VDKQ.....QR..TP.....................
gi|156142199|ref|NP_079532.5|     A...........................VDKQ.....QR..TP.....................
gi|92087060|ref|NP_563616.3|      Q...........................PCVK.....RW..SA.....................
gi|70995267|ref|NP_775776.2|      L...........................QRES.....GT..TA.....................
gi|219842212|ref|NP_001137357.1|  Y...........................ANVD.....GL..TA.....................
gi|4505317|ref|NP_002471.1|       Y...........................ANVD.....GL..TA.....................
gi|116534990|ref|NP_015628.2|     L...........................RNFN.....MM..AP.....................
gi|282394038|ref|NP_001164160.1|  L...........................PDDE.....GN..TA.....................
gi|282394032|ref|NP_001164157.1|  L...........................PDDE.....GN..TA.....................
gi|282394030|ref|NP_543151.2|     L...........................PDDE.....GN..TA.....................
gi|282394036|ref|NP_001164159.1|  L...........................PDDE.....GN..TA.....................
gi|282394034|ref|NP_001164158.1|  L...........................PDDE.....GN..TA.....................
gi|58331111|ref|NP_061919.1|      A...........................TNRD.....YK..RP.....................
gi|58331113|ref|NP_001009941.1|   A...........................TNRD.....YK..RP.....................
gi|268607595|ref|NP_001161354.1|  Q...........................CDSN.....GR..TL.....................
gi|62988328|ref|NP_065070.1|      Q...........................CDSN.....GR..TL.....................
gi|221307473|ref|NP_001137250.1|  -...........................----.....--..--.....................
gi|19923540|ref|NP_060177.2|      -...........................----.....--..--.....................
gi|140161500|ref|NP_056060.2|     V...........................ADSK.....GC..YP.....................
gi|224809478|ref|NP_001138997.1|  K...........................HDSE.....GK..TA.....................
gi|224809468|ref|NP_056392.2|     K...........................HDSE.....GK..TA.....................
gi|224809470|ref|NP_001138992.1|  K...........................HDSE.....GK..TA.....................
gi|224809472|ref|NP_001138993.1|  K...........................HDSE.....GK..TA.....................
gi|224809474|ref|NP_001138994.1|  K...........................HDSE.....GK..TA.....................
gi|18079216|ref|NP_065815.1|      I...........................KDNK.....GM..RP.....................
gi|224809476|ref|NP_001138995.1|  K...........................HDSE.....GK..TA.....................
gi|217416347|ref|NP_065804.2|     I...........................KDSN.....GM..RP.....................
gi|341915690|ref|XP_003403588.1|  K...........................RDKQ.....KR..TA.....................
gi|239745058|ref|XP_002343353.1|  K...........................RDKQ.....KR..TA.....................
gi|341915688|ref|XP_003403587.1|  K...........................RDKQ.....KR..TA.....................
gi|310118968|ref|XP_003118905.1|  K...........................RDRK.....ER..TA.....................
gi|30348954|ref|NP_065825.1|      A...........................EDKD.....GD..RA.....................
gi|310118966|ref|XP_001717815.3|  K...........................RDRK.....ER..TA.....................
gi|71274109|ref|NP_004547.2|      I...........................QNNL.....YQ..TA.....................
gi|110431370|ref|NP_113663.2|     D...........................KDNS.....GA..TV.....................
gi|256222430|ref|NP_079466.3|     K...........................RDRK.....ER..TA.....................
gi|28626517|ref|NP_056383.1|      L...........................CNED.....GL..TA.....................
gi|53828703|ref|NP_001005365.2|   K...........................RDKK.....KR..TA.....................
gi|239747114|ref|XP_002343914.1|  K...........................RDKE.....KR..TA.....................
gi|153792284|ref|NP_778146.2|     K...........................RDKE.....KR..TA.....................
gi|52856434|ref|NP_001005356.1|   K...........................KDKQ.....KR..TA.....................
gi|50511945|ref|NP_690001.3|      V...........................ADNK.....GY..FP.....................
gi|148596917|ref|NP_660278.3|     V...........................PNKF.....GF..TA.....................
gi|209977003|ref|NP_001129685.1|  K...........................KDKQ.....KR..TA.....................
gi|212549546|ref|NP_001131143.1|  K...........................RDKQ.....KR..TA.....................
gi|256222280|ref|NP_001157787.1|  K...........................RDRK.....ER..TA.....................
gi|224282147|ref|NP_001138914.1|  K...........................KDKQ.....KR..TA.....................
gi|259155302|ref|NP_001158884.1|  M...........................RNDL.....YQ..TP.....................
gi|121582655|ref|NP_653299.3|     K...........................LDSN.....GQ..SP.....................
gi|68131557|ref|NP_056014.2|      C...........................EDKN.....GN..TP.....................
gi|34577122|ref|NP_003989.2|      M...........................RNDL.....YQ..TP.....................
gi|153791352|ref|NP_001093241.1|  K...........................QDKQ.....KR..TA.....................
gi|103471993|ref|NP_056151.2|     Q...........................PDKE.....NV..TL.....................
gi|134133226|ref|NP_001077007.1|  K...........................KDKQ.....KR..TA.....................
gi|268607514|ref|NP_001161330.1|  T...........................VNVD.....GL..TA.....................
gi|268607512|ref|NP_001161329.1|  T...........................VNVD.....GL..TA.....................
gi|30089994|ref|NP_078984.2|      V...........................KDLIg....GF..TA.....................
gi|22208957|ref|NP_078977.2|      Q...........................VTVD.....SI..TP.....................
gi|22208951|ref|NP_665862.1|      A...........................TTLE.....ET..TP.....................
gi|320202950|ref|NP_001188894.1|  A...........................TTLE.....ET..TP.....................
gi|37620163|ref|NP_065741.3|      D...........................RGNK.....GDi.TP.....................
gi|46519147|ref|NP_060217.1|      D...........................RGNK.....GDi.TP.....................
gi|38176283|ref|NP_937886.1|      V...........................KDLIg....GF..TA.....................
gi|88953571|ref|XP_933678.1|      K...........................QDKQ.....KR..TA.....................
gi|113413200|ref|XP_934799.2|     K...........................QDKQ.....KR..TA.....................
gi|268607506|ref|NP_002472.2|     T...........................VNVD.....GL..TA.....................
gi|118150656|ref|NP_062618.2|     M...........................QDKK.....YR..TP.....................
gi|38683816|ref|NP_942592.1|      A...........................QTEEt....QE..TA.....................
gi|38683807|ref|NP_115593.3|      A...........................QTEEt....QE..TA.....................
gi|304434690|ref|NP_001182073.1|  I...........................QSKD.....GK..SP.....................
gi|215598806|ref|NP_543147.2|     S...........................A-PG.....GR..TA.....................
gi|52486194|ref|NP_003551.2|      V...........................TDYK.....GE..TV.....................
gi|294337038|ref|NP_001135932.2|  S...........................A-PG.....GR..TA.....................
gi|294337037|ref|NP_001135931.2|  S...........................A-PG.....GR..TA.....................
gi|116875852|ref|NP_065822.2|     Y...........................QDIS.....GC..TP.....................
gi|117320527|ref|NP_002493.3|     L...........................TNHL.....HQ..TP.....................
gi|117320540|ref|NP_001070961.1|  L...........................TNHL.....HQ..TP.....................
gi|117320531|ref|NP_001070962.1|  L...........................TNHL.....HQ..TP.....................
gi|313760592|ref|NP_001186491.1|  V...........................TDYK.....GE..TV.....................
gi|52486251|ref|NP_001004426.1|   V...........................TDYK.....GE..TV.....................
gi|16975496|ref|NP_219499.1|      Y...........................SCED.....GH..SA.....................
gi|52426737|ref|NP_066187.2|      S...........................ATKK.....GN..TA.....................
gi|341914805|ref|XP_003403867.1|  V...........................RDKK.....DR..TV.....................
gi|60115723|ref|NP_001012421.1|   A...........................LDKQ.....HR..TA.....................
gi|60460920|ref|NP_001012419.1|   A...........................LDKQ.....HR..TA.....................
gi|156104901|ref|NP_115626.2|     A...........................LDKQ.....HR..TA.....................
gi|341914105|ref|XP_001715780.3|  D...........................RDKK.....NR..TA.....................
gi|149363679|ref|NP_001092275.1|  A...........................LDKQ.....HR..TA.....................
gi|188595682|ref|NP_001120965.1|  S...........................ATKK.....GN..TA.....................
gi|14249672|ref|NP_116291.1|      L...........................ANED.....GL..TA.....................
gi|341915999|ref|XP_292717.9|     D...........................RDKK.....NR..TA.....................
gi|157743284|ref|NP_775866.2|     T...........................PDNL.....GR..TC.....................
gi|222537750|ref|NP_001138501.1|  K...........................RDMK.....KR..TA.....................
gi|325053666|ref|NP_001191332.1|  A...........................ATKK.....GN..TA.....................
gi|283549153|ref|NP_671728.2|     A...........................RDRK.....DR..TV.....................
gi|155969701|ref|NP_919288.2|     L...........................ETRE.....GA..RP.....................
gi|312147315|ref|NP_001185879.1|  T...........................LVSS.....GG..SL.....................
gi|62177127|ref|NP_055826.1|      T...........................LVSS.....GG..SL.....................
gi|90186267|ref|NP_078945.2|      M...........................QDAY.....GR..TS.....................
gi|134244285|ref|NP_000426.2|     V...........................RGPD.....GF..TP.....................
gi|56550047|ref|NP_001008225.1|   K...........................LDVE.....GR..SV.....................
gi|67906195|ref|NP_775822.3|      C...........................SDEA.....GN..TA.....................
gi|267844887|ref|NP_001136205.2|  Q...........................TTHN.....GE..TP.....................
gi|47933346|ref|NP_061901.2|      Q...........................PDKE.....NV..SL.....................
gi|110815813|ref|NP_057460.3|     Sprqpgangegee...............EARD.....GQ..TP.....................
gi|55770876|ref|NP_004548.3|      T...........................RGPD.....GV..TP.....................
gi|59850762|ref|NP_060473.2|      K...........................LDVE.....GR..SV.....................
gi|18254476|ref|NP_543150.1|      A...........................VTLD.....HV..TP.....................
gi|310114187|ref|XP_003119912.1|  -...........................---V.....GL..TA.....................
gi|148833508|ref|NP_060087.3|     V...........................RGPD.....GF..TP.....................
gi|7657265|ref|NP_056137.1|       Qtgtvrfdg...................YVID.....GA..TA.....................
gi|34304379|ref|NP_899068.1|      K...........................TDHS.....QR..TA.....................
gi|34304381|ref|NP_055240.2|      K...........................TDHS.....QR..TA.....................
gi|38327522|ref|NP_055206.2|      -...........................----.....--..--.....................
gi|115495445|ref|NP_443723.2|     I...........................QDAQ.....KR..TA.....................
gi|17981699|ref|NP_523240.1|      -...........................----.....--..--.....................
gi|4502751|ref|NP_001253.1|       -...........................----.....--..--.....................
gi|24041035|ref|NP_077719.2|      V...........................RGPD.....GC..TP.....................
gi|17864094|ref|NP_064562.1|      Vggsvnfdg...................ETIE.....GA..PP.....................
gi|42734375|ref|NP_597707.1|      -...........................----.....--..--.....................
gi|13443014|ref|NP_076992.1|      I...........................ITAD.....HV..SP.....................
gi|271398201|ref|NP_001162003.1|  I...........................ITAD.....HV..SP.....................
gi|60218887|ref|NP_001012428.1|   L...........................VTIN.....RV..SS.....................
gi|58331117|ref|NP_001009943.1|   A...........................TNRD.....YK..RP.....................
gi|72534772|ref|NP_001026909.1|   I...........................ITAD.....HV..SP.....................
gi|18254474|ref|NP_543149.1|      L...........................VTIN.....RV..SS.....................
gi|338797779|ref|NP_001229743.1|  V...........................T-KH.....GR..TP.....................
gi|116325987|ref|NP_872409.2|     A...........................QDDR.....GC..TP.....................
gi|17981702|ref|NP_524145.1|      -...........................----.....--..--.....................
gi|4502753|ref|NP_001791.1|       -...........................----.....--..--.....................
gi|126723390|ref|NP_597732.1|     K...........................LDPE.....GK..SA.....................
gi|38569426|ref|NP_071379.3|      V...........................QDRM.....GC..TP.....................
gi|38569428|ref|NP_942093.1|      V...........................QDRM.....GC..TP.....................
gi|24308163|ref|NP_061178.1|      Aggsvhfdg...................ETIE.....GA..PP.....................
gi|53832024|ref|NP_001005474.1|   I...........................KEHN.....GQ..SA.....................
gi|13899229|ref|NP_113607.1|      I...........................KEHN.....GQ..SA.....................
gi|14149716|ref|NP_060077.1|      S...........................TNAD.....GI..SA.....................
gi|39812133|ref|NP_065082.2|      T...........................CDQF.....RR..TA.....................
gi|17981694|ref|NP_004927.2|      -...........................----.....--..--.....................
gi|116063534|ref|NP_115515.2|     -...........................----.....--..--.....................
gi|4502749|ref|NP_000068.1|       -...........................----.....--..--.....................
gi|304376272|ref|NP_001182061.1|  -...........................----.....--..--.....................
gi|32483404|ref|NP_852092.1|      -...........................----.....--..--.....................
gi|8051599|ref|NP_057739.1|       -...........................----.....--..--.....................
gi|8051597|ref|NP_002032.2|       -...........................----.....--..--.....................
gi|8051595|ref|NP_057738.1|       -...........................----.....--..--.....................
gi|8051593|ref|NP_005245.2|       -...........................----.....--..--.....................
gi|41327752|ref|NP_659431.5|      -...........................----.....--..--.....................
gi|120587025|ref|NP_057232.2|     Y...........................HDSDs....GE..TP.....................
gi|24586688|ref|NP_543139.4|      A...........................R-VG.....GR..AA.....................
gi|110815813|ref|NP_057460.3|     M...........................VDKS.....GW..SL.....................
gi|22208964|ref|NP_665879.1|      C...........................R-PN.....GK..TP.....................
gi|157743292|ref|NP_997721.2|     A...........................S-PG.....GR..GA.....................
gi|7706379|ref|NP_057200.1|       C...........................R-PN.....GK..TP.....................
gi|217416350|ref|NP_001136115.1|  -...........................----.....--..-P.....................
gi|226817313|ref|NP_036441.2|     F...........................HDPEt....GE..TP.....................
gi|52426735|ref|NP_001139.3|      S...........................ATKK.....GN..TA.....................
gi|219842214|ref|NP_001137358.1|  -...........................----.....--..--.....................
gi|13129098|ref|NP_077000.1|      -...........................----.....--..--.....................
gi|21389427|ref|NP_653219.1|      -...........................----.....--..--.....................
gi|271398185|ref|NP_001162002.1|  I...........................ITAD.....HV..SP.....................
gi|122937241|ref|NP_001073889.1|  F...........................HDPDs....GE..CP.....................
gi|341915692|ref|XP_003403589.1|  K...........................RDKQ.....KR..TA.....................
gi|320202942|ref|NP_001188512.1|  -...........................----.....--..--.....................
gi|116063534|ref|NP_115515.2|     S...........................RDDR.....GH..TP.....................
gi|18640738|ref|NP_570124.1|      -...........................----.....--..--.....................
gi|50897294|ref|NP_001002920.1|   K...........................RDKK.....KR..TA.....................
gi|116534990|ref|NP_015628.2|     S...........................KSKD.....KK..SP.....................
gi|154354990|ref|NP_055730.2|     D...........................RDKM.....NR..TA.....................
gi|341914820|ref|XP_003403870.1|  A...........................LDKQ.....HR..TA.....................
gi|19718741|ref|NP_542164.2|      S...........................KSNL.....GW..TP.....................
gi|23510377|ref|NP_694856.1|      -...........................----.....--..--.....................
gi|64464726|ref|NP_055973.2|      -...........................----.....--..--.....................
gi|28605137|ref|NP_736606.1|      R...........................TDQD.....SR..TA.....................
gi|289629249|ref|NP_001166206.1|  L...........................CNED.....GL..TA.....................
gi|13376842|ref|NP_079511.1|      -...........................----.....--..--.....................
gi|87239981|ref|NP_003738.2|      -...........................----.....--..--.....................
gi|41281709|ref|NP_640332.1|      I...........................REHK.....GK..TP.....................
gi|194018403|ref|NP_001123453.1|  -...........................----.....--..--.....................
gi|41350198|ref|NP_060174.2|      -...........................----.....--..--.....................
gi|169403957|ref|NP_079209.3|     -...........................----.....--..--.....................
gi|169403959|ref|NP_001108588.1|  -...........................----.....--..--.....................
gi|157504499|ref|NP_940873.2|     -...........................----.....--..--.....................
gi|156142184|ref|NP_057550.3|     Q...........................PDSA.....GY..TA.....................
gi|38569426|ref|NP_071379.3|      -...........................----.....--..--.....................
gi|38569428|ref|NP_942093.1|      -...........................----.....--..--.....................
gi|70995241|ref|NP_060134.2|      V...........................STTRy....AQ..TP.....................
gi|209969812|ref|NP_001129663.1|  -...........................----.....--..--.....................
gi|258613875|ref|NP_056308.3|     -...........................----.....--..--.....................
gi|12746412|ref|NP_075526.1|      -...........................----.....--..--.....................
gi|320461689|ref|NP_569059.3|     S...........................RSGW.....GVpgTP.....................
gi|4758606|ref|NP_004508.1|       Q...........................GDDH.....GF..SP.....................
gi|62420873|ref|NP_001014794.1|   Q...........................GDDH.....GF..SP.....................
gi|62420875|ref|NP_001014795.1|   Q...........................GDDH.....GF..SP.....................
gi|157266328|ref|NP_000456.2|     -...........................----.....--..--.....................
gi|154091032|ref|NP_653191.2|     V...........................QDGFn....GD..TP.....................
gi|134948558|ref|NP_056023.3|     -...........................----.....--..--.....................
gi|134948605|ref|NP_001077094.1|  -...........................----.....--..--.....................
gi|323362985|ref|NP_001190985.1|  -...........................----.....--..--.....................
gi|4506499|ref|NP_003712.1|       I...........................LAKE.....RE..SA.....................
gi|21956645|ref|NP_665807.1|      -...........................----.....--..--.....................
gi|94721248|ref|NP_001035535.1|   E...........................KSVWccgwlPC..TP.....................
gi|156104862|ref|NP_859063.3|     L...........................ADHN.....GN..TA.....................
gi|56676397|ref|NP_037407.4|      -...........................----.....--..--.....................
gi|41055989|ref|NP_059990.2|      Q...........................E---.....--..--.....................
gi|304434690|ref|NP_001182073.1|  -...........................----.....--..--.....................
gi|19924156|ref|NP_604389.1|      -...........................----.....--..--.....................
gi|256574792|ref|NP_001157915.1|  -...........................----.....--..--.....................
gi|20270347|ref|NP_620152.1|      -...........................----.....--..--.....................
gi|31317252|ref|NP_065791.1|      E...........................ADHN.....GD..LA.....................
gi|320461543|ref|NP_001073933.2|  L...........................VDFN.....GQ..TP.....................
gi|21314682|ref|NP_061116.2|      Q...........................RGAM.....GE..TA.....................
gi|47933348|ref|NP_001001483.1|   -...........................----.....--..--.....................
gi|267844887|ref|NP_001136205.2|  -...........................----.....--..SI.....................
gi|187608777|ref|NP_038460.4|     P...........................RDYC.....GW..TP.....................
gi|34304383|ref|NP_775748.2|      -...........................----.....--..--.....................
gi|256574784|ref|NP_001157912.1|  W...........................QDSE.....GN..TA.....................
gi|8923516|ref|NP_060343.1|       F...........................EDPVt....YY..TA.....................
gi|17505200|ref|NP_062815.2|      Q...........................RGAL.....GE..TA.....................
gi|38257146|ref|NP_940683.1|      I...........................RDSR.....GR..TG.....................
gi|321267560|ref|NP_001155907.2|  Y...........................KDVD.....--..--.....................
gi|183396785|ref|NP_001116856.1|  -...........................----.....--..--.....................
gi|183396783|ref|NP_001116855.1|  -...........................----.....--..--.....................
gi|21071037|ref|NP_060215.4|      -...........................----.....--..--.....................
gi|183396787|ref|NP_001116857.1|  -...........................----.....--..--.....................
gi|299473797|ref|NP_001177408.1|  C...........................RAEQ.....GR..TP.....................
gi|284413734|ref|NP_653309.3|     V...........................SDEA.....GY..TI.....................
gi|341915472|ref|XP_003403627.1|  I...........................RDAK.....KR..TA.....................
gi|341915476|ref|XP_003403594.1|  I...........................RDAK.....KR..TA.....................
gi|14150169|ref|NP_115736.1|      -...........................----.....--..--.....................
gi|256574792|ref|NP_001157915.1|  -...........................----.....--..--.....................
gi|67906195|ref|NP_775822.3|      -...........................----.....--..--.....................
gi|28461129|ref|NP_064715.1|      -...........................----.....--..--.....................
gi|166235148|ref|NP_036515.4|     -...........................----.....--..--.....................
gi|148664246|ref|NP_665872.2|     -...........................----.....--..--.....................
gi|76563940|ref|NP_005451.2|      E...........................R---.....--..--.....................
gi|257467559|ref|NP_001004441.2|  E...........................SNDR.....GE..TP.....................
gi|226437606|ref|NP_001139813.1|  E...........................SNDK.....GE..TA.....................
gi|188219549|ref|NP_115666.2|     -...........................----.....--..--.....................
gi|13540606|ref|NP_110440.1|      -...........................----.....--..AA.....................
gi|89941470|ref|NP_001034977.1|   E...........................GDAQ.....GE..TA.....................
gi|62953116|ref|NP_001017523.1|   T...........................MSEQ.....GM..TP.....................
gi|4885643|ref|NP_005417.1|       -...........................----.....--..--.....................
gi|112799849|ref|NP_001026855.2|  -...........................----.....--..--.....................
gi|65786661|ref|NP_001018082.1|   T...........................MSEQ.....GM..TP.....................
gi|56090539|ref|NP_001007534.1|   -...........................----.....--..--.....................
gi|118498337|ref|NP_056197.2|     F...........................MDDV.....GQ..TL.....................
gi|187608516|ref|NP_036419.3|     -...........................----.....--..--.....................
gi|194097375|ref|NP_872414.3|     Q...........................QDKG.....GD..TA.....................
gi|320202962|ref|NP_001189332.1|  F...........................EDPVt....YY..TA.....................
gi|31581522|ref|NP_004903.2|      Q...........................LDSD.....HW..AP.....................
gi|37221182|ref|NP_919437.1|      Q...........................LDSD.....HW..AP.....................
gi|37221184|ref|NP_919438.1|      Q...........................LDSD.....HW..AP.....................
gi|37221187|ref|NP_919436.1|      Q...........................LDSD.....HW..AP.....................
gi|121114287|ref|NP_056131.2|     K...........................PNDE.....GI..TP.....................
gi|194097377|ref|NP_001123487.1|  Q...........................QDKG.....GD..TA.....................
gi|300796386|ref|NP_665803.2|     T...........................MDDQ.....GM..TP.....................
gi|218563749|ref|NP_085152.2|     -...........................----.....--..--.....................
gi|296179431|ref|NP_068765.3|     H...........................RDNA.....GY..TA.....................
gi|215820635|ref|NP_001135974.1|  Q...........................PNEE.....GI..TA.....................
gi|63003907|ref|NP_006654.2|      Q...........................PNEE.....GI..TA.....................
gi|168229256|ref|NP_689576.4|     -...........................----.....--..--.....................
gi|148596953|ref|NP_061877.1|     K...........................RNVH.....NE..TS.....................
gi|7661880|ref|NP_055531.1|       -...........................----.....--..--.....................
gi|21735483|ref|NP_659505.1|      -...........................-SDT.....GK..TC.....................
gi|32171201|ref|NP_859077.1|      -...........................----.....--..--.....................
gi|341915877|ref|XP_001134442.4|  -...........................----.....--..--.....................
gi|75750529|ref|NP_057636.2|      -...........................----.....--..--.....................
gi|68131557|ref|NP_056014.2|      -...........................----.....--..--.....................
gi|38348298|ref|NP_940895.1|      E...........................KTTR.....GY..TL.....................
gi|319803120|ref|NP_001188386.1|  A...........................VNSL.....GQ..TA.....................
gi|57863263|ref|NP_938207.2|      A...........................VNSL.....GQ..TA.....................
gi|57863261|ref|NP_112562.3|      A...........................VNSL.....GQ..TA.....................
gi|341914329|ref|XP_001717391.3|  -...........................----.....--..--.....................
gi|51972284|ref|NP_001004354.1|   S...........................FGPE.....GQ..TA.....................
gi|41393573|ref|NP_054749.2|      -...........................----.....--..--.....................
gi|146231998|ref|NP_001078923.1|  -...........................----.....--..--.....................
gi|313102999|ref|NP_001186197.1|  -...........................----.....--..--.....................
gi|41872507|ref|NP_003637.2|      -...........................----.....--..--.....................
gi|313102997|ref|NP_001186196.1|  -...........................----.....--..--.....................
gi|313103001|ref|NP_963291.2|     -...........................----.....--..--.....................
gi|41872522|ref|NP_963290.1|      -...........................----.....--..--.....................
gi|13899267|ref|NP_113626.1|      -...........................----.....--..--.....................
gi|157688564|ref|NP_001099010.1|  -...........................----.....--..--.....................
gi|18390333|ref|NP_569058.1|      -...........................---S.....GI..SP.....................
gi|4758156|ref|NP_004708.1|       -...........................QGPD.....HC..SL.....................
gi|206725420|ref|NP_001128685.1|  -...........................----.....--..--.....................
gi|206725415|ref|NP_631940.2|     -...........................----.....--..--.....................
gi|24308163|ref|NP_061178.1|      -...........................----.....--..--.....................
gi|17149832|ref|NP_476511.1|      -...........................----.....--..--.....................
gi|74315348|ref|NP_542435.2|      D...........................SY--.....--..--.....................
gi|74315350|ref|NP_061197.4|      D...........................SY--.....--..--.....................
gi|74315352|ref|NP_542436.2|      D...........................SY--.....--..--.....................
gi|74315354|ref|NP_542437.2|      D...........................SY--.....--..--.....................
gi|21237786|ref|NP_055591.2|      -...........................----.....--..--.....................
gi|124517699|ref|NP_689558.4|     -...........................----.....GK..YP.....................
gi|206725422|ref|NP_001128686.1|  -...........................----.....--..--.....................
gi|17149830|ref|NP_476510.1|      -...........................----.....--..--.....................
gi|17864094|ref|NP_064562.1|      -...........................----.....--..--.....................
gi|54607077|ref|NP_075392.2|      -...........................----.....--..--.....................
gi|31982881|ref|NP_078968.3|      -...........................----.....--..--.....................
gi|20336214|ref|NP_037399.2|      -...........................----.....--..--.....................
gi|57863304|ref|NP_056340.2|      -...........................----.....--..--.....................
gi|304361757|ref|NP_001182027.1|  L...........................QDNS.....KN..TA.....................
gi|304361760|ref|NP_001182028.1|  L...........................QDNS.....KN..TA.....................
gi|313102995|ref|NP_001186195.1|  -...........................----.....--..--.....................
gi|20127551|ref|NP_057197.2|      -...........................----.....--..--.....................
gi|38683799|ref|NP_149112.1|      -...........................----.....--..--.....................
gi|166795254|ref|NP_110443.3|     -...........................----.....--..--.....................
gi|18496983|ref|NP_056341.1|      -...........................----.....--..--.....................
gi|313851097|ref|NP_001186499.1|  -...........................----.....--..--.....................
gi|155969701|ref|NP_919288.2|     I...........................TDAL.....GA..GL.....................
gi|30089932|ref|NP_821066.1|      -...........................----.....--..--.....................
gi|156104878|ref|NP_055720.3|     -...........................----.....--..--.....................
gi|294459971|ref|NP_001170902.1|  -...........................---R.....GQ..TA.....................
gi|22547184|ref|NP_067638.3|      -...........................---R.....GQ..TA.....................
gi|7661962|ref|NP_055585.1|       -...........................----.....--..--.....................
gi|117956371|ref|NP_001071154.1|  -...........................----.....--..--.....................
gi|95147559|ref|NP_787069.3|      -...........................----.....--..--.....................
gi|16418357|ref|NP_443087.1|      -...........................----.....--..--.....................
gi|170650694|ref|NP_001116244.1|  -...........................----.....--..--.....................
gi|150378537|ref|NP_001092877.1|  -...........................----.....--..--.....................
gi|80978934|ref|NP_055729.2|      -...........................----.....--..--.....................
gi|5730102|ref|NP_004612.2|       C...........................VDYM.....GQ..NA.....................
gi|80978930|ref|NP_001032208.1|   -...........................----.....--..--.....................
gi|269315852|ref|NP_997237.2|     -...........................----.....--..--.....................
gi|255982572|ref|NP_001157637.1|  -...........................----.....--..TP.....................
gi|7705831|ref|NP_057199.1|       -...........................----.....--..TP.....................
gi|148806877|ref|NP_597704.1|     -...........................----.....--..--.....................
gi|156104893|ref|NP_597703.2|     -...........................----.....--..--.....................
gi|117956373|ref|NP_001071153.1|  -...........................----.....--..--.....................
gi|221136914|ref|NP_001137472.1|  -...........................----.....--..--.....................
gi|166851846|ref|NP_001071133.2|  -...........................----.....--..--.....................
gi|339275867|ref|NP_001229858.1|  -...........................----.....--..--.....................
gi|90991702|ref|NP_078928.3|      P...........................TEPT.....DD..NP.....................
gi|71274172|ref|NP_001025041.1|   -...........................----.....--..--.....................
gi|22547180|ref|NP_671737.1|      -...........................---R.....GQ..TA.....................
gi|4507687|ref|NP_003296.1|       C...........................VDYM.....GQ..NA.....................
gi|6912736|ref|NP_036603.1|       C...........................MDPL.....GR..SA.....................
gi|110227613|ref|NP_114152.3|     Y...........................GDGD.....GR..TA.....................
gi|194733735|ref|NP_001124170.1|  C...........................VDYM.....GQ..NA.....................
gi|209863030|ref|NP_001129429.1|  C...........................IDPL.....GR..TA.....................
gi|209863028|ref|NP_001129428.1|  C...........................IDPL.....GR..TA.....................
gi|209863026|ref|NP_001129427.1|  C...........................IDPL.....GR..TA.....................
gi|7706747|ref|NP_057263.1|       C...........................IDPL.....GR..TA.....................
gi|209863024|ref|NP_003297.1|     C...........................IDPL.....GR..TA.....................
gi|262399375|ref|NP_001161048.1|  C...........................VDYM.....GQ..NA.....................
gi|262399379|ref|NP_001161049.1|  C...........................VDYM.....GQ..NA.....................
gi|9966865|ref|NP_065122.1|       C...........................VDYM.....GQ..NA.....................
gi|25777624|ref|NP_742024.1|      V...........................RDKW.....DS..TP.....................
gi|54112401|ref|NP_056030.1|      -...........................----.....--..--.....................
gi|157743267|ref|NP_001099046.1|  -...........................----.....--..--.....................
gi|110815813|ref|NP_057460.3|     A...........................PDTAt....GN..CL.....................
gi|269847874|ref|NP_073739.3|     -...........................----.....--..--.....................
gi|75750531|ref|NP_060314.2|      -...........................----.....--..--.....................
gi|7657265|ref|NP_056137.1|       -...........................----.....--..--.....................
gi|75750529|ref|NP_057636.2|      -...........................----.....--..--.....................
gi|257467636|ref|NP_055646.2|     -...........................----.....--..--.....................
gi|222352179|ref|NP_001138435.1|  -...........................----.....--..--.....................
gi|222352177|ref|NP_001138434.1|  -...........................----.....--..--.....................
gi|222352175|ref|NP_001138433.1|  -...........................----.....--..--.....................
gi|222352173|ref|NP_004998.3|     -...........................----.....--..--.....................
gi|61742817|ref|NP_001013424.1|   -...........................----.....--..--.....................
gi|239744064|ref|XP_001714838.2|  -...........................----.....--..--.....................
gi|222352168|ref|NP_001138432.1|  Eavgvhpyrawcheal............HADV.....SK..CP.....................
gi|29826341|ref|NP_055914.2|      -...........................----.....--..--.....................
gi|284005535|ref|NP_001164637.1|  -...........................----.....--..--.....................
gi|284005543|ref|NP_001164639.1|  -...........................----.....--..--.....................
gi|284005537|ref|NP_001164638.1|  -...........................----.....--..--.....................
gi|4507685|ref|NP_003295.1|       C...........................VDVL.....GR..NA.....................
gi|15042961|ref|NP_149417.1|      -...........................----.....--..--.....................
gi|312839866|ref|NP_001186166.1|  -...........................----.....--..--.....................
gi|312839869|ref|NP_001186167.1|  -...........................----.....--..--.....................
gi|312839871|ref|NP_001186168.1|  -...........................----.....--..--.....................
gi|312839873|ref|NP_001186169.1|  -...........................----.....--..--.....................
gi|109150425|ref|NP_060559.2|     V...........................L---.....--..--.....................
gi|109150435|ref|NP_001035869.1|  V...........................L---.....--..--.....................
gi|257467636|ref|NP_055646.2|     -...........................----.....--..--.....................
gi|294459965|ref|NP_001170899.1|  -...........................----.....--..--.....................
gi|209863032|ref|NP_001129430.1|  C...........................IDPL.....GR..TA.....................
gi|148664230|ref|NP_055929.1|     FmrlmypdddeamlqkriryvvdlylntPDKM.....GYd.TP.....................
gi|114842396|ref|NP_694960.2|     -...........................----.....--..--.....................
gi|294459977|ref|NP_001170904.1|  -...........................----.....--..--.....................
gi|22748713|ref|NP_689539.1|      -...........................----.....--..--.....................
gi|224465235|ref|NP_001138999.1|  -...........................----.....--..--.....................
gi|98985804|ref|NP_478104.2|      -...........................----.....--..--.....................
gi|17981696|ref|NP_511042.1|      -...........................----.....--..--.....................
gi|260763963|ref|NP_001120979.2|  -...........................----.....--..--.....................
gi|27477049|ref|NP_543144.1|      -...........................----.....--..--.....................
gi|260763966|ref|NP_001077376.2|  -...........................----.....--..--.....................
gi|260763960|ref|NP_060405.4|     -...........................----.....--..--.....................
gi|75750531|ref|NP_060314.2|      -...........................----.....--..--.....................


                                                                               80                   
                                                                                |                   
d1s70b_                             .........................................LHQACID...D....N.V.....
gi|21361135|ref|NP_002494.2|      .........................................LHLAVIH...Q....H.E.....
gi|70780355|ref|NP_065210.2|      .........................................LHIAARE...G....H.V.....
gi|215598574|ref|NP_001135918.1|  .........................................LHIAARE...G....H.V.....
gi|70780353|ref|NP_065208.2|      .........................................LHIAARE...G....H.V.....
gi|70780359|ref|NP_065209.2|      .........................................LHIAARE...G....H.V.....
gi|70780357|ref|NP_000028.3|      .........................................LHIAARE...G....H.V.....
gi|325053666|ref|NP_001191332.1|  .........................................LHVAAKY...G....K.L.....
gi|325053668|ref|NP_001191333.1|  .........................................LHVAAKY...G....K.L.....
gi|32967601|ref|NP_066267.2|      .........................................LHVAAKY...G....K.L.....
gi|188595682|ref|NP_001120965.1|  .........................................LHVAAKY...G....S.L.....
gi|52426737|ref|NP_066187.2|      .........................................LHVAAKY...G....S.L.....
gi|52426735|ref|NP_001139.3|      .........................................LHVAAKY...G....S.L.....
gi|268607595|ref|NP_001161354.1|  .........................................LHMAAFE...G....H.R.....
gi|62988328|ref|NP_065070.1|      .........................................LHMAAFE...G....H.R.....
gi|48928017|ref|NP_001001716.1|   .........................................-------...-....-.-.....
gi|70780353|ref|NP_065208.2|      .........................................LAVALQQ...G....H.E.....
gi|70780355|ref|NP_065210.2|      .........................................LAVALQQ...G....H.E.....
gi|70780359|ref|NP_065209.2|      .........................................LAVALQQ...G....H.E.....
gi|70780357|ref|NP_000028.3|      .........................................LAVALQQ...G....H.E.....
gi|215598574|ref|NP_001135918.1|  .........................................LAVALQQ...G....H.E.....
gi|325053668|ref|NP_001191333.1|  kgkvrlpalhiaarkddtkaaalllqndnnadvesksgftpLHIAAHY...G....N.I.....
gi|32967601|ref|NP_066267.2|      kgkvrlpalhiaarkddtkaaalllqndnnadvesksgftpLHIAAHY...G....N.I.....
gi|304434687|ref|NP_710181.2|     .........................................LHHAALN...G....H.V.....
gi|30425444|ref|NP_848605.1|      .........................................LHFAAQN...G....D.D.....
gi|304361757|ref|NP_001182027.1|  .........................................LHVACYN...G....Q.D.....
gi|304361760|ref|NP_001182028.1|  .........................................LHVACYN...G....Q.D.....
gi|46519151|ref|NP_060448.1|      .........................................LMEAASA...G....H.V.....
gi|46519154|ref|NP_078944.2|      .........................................LMEAASA...G....H.V.....
gi|157743284|ref|NP_775866.2|     .........................................LHWAAFL...G....H.L.....
gi|55741641|ref|NP_065789.1|      .........................................LMWACYK...G....R.T.....
gi|10863929|ref|NP_066956.1|      .........................................FILAAIA...G....S.V.....
gi|308044526|ref|NP_001183959.1|  .........................................LTYACAG...G....F.V.....
gi|41327754|ref|NP_065690.2|      .........................................LHFAAQN...G....D.E.....
gi|38683816|ref|NP_942592.1|      .........................................LSLACSG...G....R.Q.....
gi|38683807|ref|NP_115593.3|      .........................................LSLACSG...G....R.Q.....
gi|304434690|ref|NP_001182073.1|  .........................................LHRAVAS...R....S.E.....
gi|46519147|ref|NP_060217.1|      .........................................LTLAACG...G....H.V.....
gi|37620163|ref|NP_065741.3|      .........................................LTLAACG...G....H.V.....
gi|304361757|ref|NP_001182027.1|  .........................................IHAAATN...G....H.S.....
gi|304361760|ref|NP_001182028.1|  .........................................IHAAATN...G....H.S.....
gi|37620163|ref|NP_065741.3|      .........................................LSLAASG...G....Y.V.....
gi|46519147|ref|NP_060217.1|      .........................................LSLAASG...G....Y.V.....
gi|68131557|ref|NP_056014.2|      .........................................LHRAVAS...C....S.E.....
gi|96975023|ref|NP_874362.3|      .........................................FHRAAEH...G....Q.L.....
gi|10092619|ref|NP_065390.1|      .........................................LHLAVIT...N....Q.P.....
gi|38683816|ref|NP_942592.1|      .........................................LTYACAG...G....Y.V.....
gi|38683807|ref|NP_115593.3|      .........................................LTYACAG...G....Y.V.....
gi|157739945|ref|NP_079461.2|     .........................................LVHAALR...G....H.L.....
gi|18252778|ref|NP_057234.2|      .........................................VYLATCR...G....H.L.....
gi|89363047|ref|NP_004929.2|      .........................................LHVAARY...G....H.A.....
gi|321117514|ref|NP_001189358.1|  .........................................VYLATCR...G....H.L.....
gi|223634006|ref|NP_001138682.1|  .........................................LHEAAWH...G....H.S.....
gi|341914599|ref|XP_001714535.3|  .........................................LHFATQS...N....H.V.....
gi|341915319|ref|XP_001128459.4|  .........................................LHFATQS...N....H.V.....
gi|34304379|ref|NP_899068.1|      .........................................LHYAAQS...N....F.A.....
gi|225543463|ref|NP_001139381.1|  .........................................LVHSALR...G....H.G.....
gi|34304381|ref|NP_055240.2|      .........................................LHYAAQS...N....F.A.....
gi|225543461|ref|NP_203752.2|     .........................................LVHSALR...G....H.G.....
gi|325053666|ref|NP_001191332.1|  .........................................LHVASKR...G....N.A.....
gi|68131557|ref|NP_056014.2|      .........................................LHRGAVT...G....H.E.....
gi|52426735|ref|NP_001139.3|      .........................................LHVASKR...G....N.T.....
gi|4506217|ref|NP_002805.1|       .........................................LHWACSA...G....H.T.....
gi|188595682|ref|NP_001120965.1|  .........................................LHVASKR...G....N.T.....
gi|52426737|ref|NP_066187.2|      .........................................LHVASKR...G....N.T.....
gi|224465233|ref|NP_079033.4|     .........................................LMEAAEN...N....H.L.....
gi|164664508|ref|NP_005169.2|     .........................................LHLAVIT...T....L.P.....
gi|7705748|ref|NP_057062.1|       .........................................LHIAAYY...G....H.E.....
gi|313569861|ref|NP_001186256.1|  .........................................LHIAAYY...G....H.E.....
gi|163914396|ref|NP_001106279.1|  .........................................LHIAAYY...G....H.E.....
gi|87239981|ref|NP_003738.2|      .........................................LHVAAER...A....H.N.....
gi|13376842|ref|NP_079511.1|      .........................................LHVASEK...A....H.N.....
gi|7705831|ref|NP_057199.1|       .........................................LHLAASQ...G....H.W.....
gi|255982572|ref|NP_001157637.1|  .........................................LHLAASQ...G....H.W.....
gi|338797777|ref|NP_001229742.1|  .........................................LHRATVV...G....N.T.....
gi|338797775|ref|NP_055757.3|     .........................................LHRATVV...G....N.T.....
gi|338797766|ref|NP_001229738.1|  .........................................LHRATVV...G....N.T.....
gi|338797770|ref|NP_001229740.1|  .........................................LHRATVV...G....N.T.....
gi|206597522|ref|NP_001128663.1|  .........................................-------...-....-.-.....
gi|4502249|ref|NP_003878.1|       .........................................-------...-....-.-.....
gi|304434690|ref|NP_001182073.1|  .........................................LHRGIMT...G....H.E.....
gi|157743284|ref|NP_775866.2|     .........................................LHRGAVT...G....C.E.....
gi|46094081|ref|NP_060952.2|      .........................................-------...-....-.-.....
gi|13376842|ref|NP_079511.1|      .........................................LHNACSF...G....H.A.....
gi|87239981|ref|NP_003738.2|      .........................................LHNACSF...G....H.A.....
gi|156142197|ref|NP_006700.3|     .........................................LMEAVVN...N....H.L.....
gi|156142199|ref|NP_079532.5|     .........................................LMEAVVN...N....H.L.....
gi|92087060|ref|NP_563616.3|      .........................................MHEAAKQ...G....R.K.....
gi|70995267|ref|NP_775776.2|      .........................................LFFAAQQ...G....H.N.....
gi|219842212|ref|NP_001137357.1|  .........................................LHQACID...D....N.V.....
gi|4505317|ref|NP_002471.1|       .........................................LHQACID...D....N.V.....
gi|116534990|ref|NP_015628.2|     .........................................LHIAVQG...M....N.N.....
gi|282394038|ref|NP_001164160.1|  .........................................LHYAALG...N....Q.P.....
gi|282394032|ref|NP_001164157.1|  .........................................LHYAALG...N....Q.P.....
gi|282394030|ref|NP_543151.2|     .........................................LHYAALG...N....Q.P.....
gi|282394036|ref|NP_001164159.1|  .........................................LHYAALG...N....Q.P.....
gi|282394034|ref|NP_001164158.1|  .........................................LHYAALG...N....Q.P.....
gi|58331111|ref|NP_061919.1|      .........................................LHEAASM...G....H.R.....
gi|58331113|ref|NP_001009941.1|   .........................................LHEAASM...G....H.R.....
gi|268607595|ref|NP_001161354.1|  .........................................LANAAYS...G....S.L.....
gi|62988328|ref|NP_065070.1|      .........................................LANAAYS...G....S.L.....
gi|221307473|ref|NP_001137250.1|  .........................................-------...-....-.-.....
gi|19923540|ref|NP_060177.2|      .........................................-------...-....-.-.....
gi|140161500|ref|NP_056060.2|     .........................................LHLAAWK...G....D.A.....
gi|224809478|ref|NP_001138997.1|  .........................................FHLAAAK...G....H.V.....
gi|224809468|ref|NP_056392.2|     .........................................FHLAAAK...G....H.V.....
gi|224809470|ref|NP_001138992.1|  .........................................FHLAAAK...G....H.V.....
gi|224809472|ref|NP_001138993.1|  .........................................FHLAAAK...G....H.V.....
gi|224809474|ref|NP_001138994.1|  .........................................FHLAAAK...G....H.V.....
gi|18079216|ref|NP_065815.1|      .........................................LHYAAWQ...G....R.K.....
gi|224809476|ref|NP_001138995.1|  .........................................FHLAAAK...G....H.V.....
gi|217416347|ref|NP_065804.2|     .........................................LHYAAWQ...G....R.L.....
gi|341915690|ref|XP_003403588.1|  .........................................LHLASAN...G....N.S.....
gi|239745058|ref|XP_002343353.1|  .........................................LHLASAN...G....N.S.....
gi|341915688|ref|XP_003403587.1|  .........................................LHLASAN...G....N.S.....
gi|310118968|ref|XP_003118905.1|  .........................................LHLACAT...G....Q.P.....
gi|30348954|ref|NP_065825.1|      .........................................VHHAAFG...D....E.G.....
gi|310118966|ref|XP_001717815.3|  .........................................LHLACAT...G....Q.P.....
gi|71274109|ref|NP_004547.2|      .........................................LHLAVHL...D....Q.P.....
gi|110431370|ref|NP_113663.2|     .........................................LHLAARF...G....H.P.....
gi|256222430|ref|NP_079466.3|     .........................................LHLACAT...G....Q.P.....
gi|28626517|ref|NP_056383.1|      .........................................LHQCCID...N....F.E.....
gi|53828703|ref|NP_001005365.2|   .........................................LHLACAN...G....N.S.....
gi|239747114|ref|XP_002343914.1|  .........................................LHLASAN...G....N.S.....
gi|153792284|ref|NP_778146.2|     .........................................LHLASAN...G....N.S.....
gi|52856434|ref|NP_001005356.1|   .........................................LHLASAN...G....N.S.....
gi|50511945|ref|NP_690001.3|      .........................................IHLAAWK...G....D.V.....
gi|148596917|ref|NP_660278.3|     .........................................LMVAAQK...G....Y.T.....
gi|209977003|ref|NP_001129685.1|  .........................................LHLASAN...G....N.S.....
gi|212549546|ref|NP_001131143.1|  .........................................LHLASAN...G....N.S.....
gi|256222280|ref|NP_001157787.1|  .........................................LHLACAT...G....Q.P.....
gi|224282147|ref|NP_001138914.1|  .........................................LHLASAN...G....N.S.....
gi|259155302|ref|NP_001158884.1|  .........................................LHLAVIT...K....Q.E.....
gi|121582655|ref|NP_653299.3|     .........................................FHLAASK...G....L.T.....
gi|68131557|ref|NP_056014.2|      .........................................LHIAARY...G....H.E.....
gi|34577122|ref|NP_003989.2|      .........................................LHLAVIT...K....Q.E.....
gi|153791352|ref|NP_001093241.1|  .........................................LHLASAN...G....N.S.....
gi|103471993|ref|NP_056151.2|     .........................................LHWAAIN...N....R.I.....
gi|134133226|ref|NP_001077007.1|  .........................................LHLASAN...G....N.S.....
gi|268607514|ref|NP_001161330.1|  .........................................LHQACID...E....N.L.....
gi|268607512|ref|NP_001161329.1|  .........................................LHQACID...E....N.L.....
gi|30089994|ref|NP_078984.2|      .........................................LHYAAMH...G....R.A.....
gi|22208957|ref|NP_078977.2|      .........................................LHAASLQ...G....Q.A.....
gi|22208951|ref|NP_665862.1|      .........................................LFLAVEN...G....Q.I.....
gi|320202950|ref|NP_001188894.1|  .........................................LFLAVEN...G....Q.I.....
gi|37620163|ref|NP_065741.3|      .........................................LMAASSG...G....Y.L.....
gi|46519147|ref|NP_060217.1|      .........................................LMAASSG...G....Y.L.....
gi|38176283|ref|NP_937886.1|      .........................................LHYAAMH...G....R.A.....
gi|88953571|ref|XP_933678.1|      .........................................LHLASAN...G....N.S.....
gi|113413200|ref|XP_934799.2|     .........................................LHLASAN...G....N.S.....
gi|268607506|ref|NP_002472.2|     .........................................LHQACID...E....N.L.....
gi|118150656|ref|NP_062618.2|     .........................................LHLACAN...G....H.T.....
gi|38683816|ref|NP_942592.1|      .........................................LTLACCG...G....F.L.....
gi|38683807|ref|NP_115593.3|      .........................................LTLACCG...G....F.L.....
gi|304434690|ref|NP_001182073.1|  .........................................LHMTAVH...G....R.F.....
gi|215598806|ref|NP_543147.2|     .........................................LHEACAA...G....H.T.....
gi|52486194|ref|NP_003551.2|      .........................................FHYAVQG...D....N.S.....
gi|294337038|ref|NP_001135932.2|  .........................................LHEACAA...G....H.T.....
gi|294337037|ref|NP_001135931.2|  .........................................LHEACAA...G....H.T.....
gi|116875852|ref|NP_065822.2|     .........................................LHLAARN...G....Q.K.....
gi|117320527|ref|NP_002493.3|     .........................................LHLAVIT...G....Q.T.....
gi|117320540|ref|NP_001070961.1|  .........................................LHLAVIT...G....Q.T.....
gi|117320531|ref|NP_001070962.1|  .........................................LHLAVIT...G....Q.T.....
gi|313760592|ref|NP_001186491.1|  .........................................FHYAVQG...D....N.S.....
gi|52486251|ref|NP_001004426.1|   .........................................FHYAVQG...D....N.S.....
gi|16975496|ref|NP_219499.1|      .........................................LYSAAKN...G....H.T.....
gi|52426737|ref|NP_066187.2|      .........................................LHIASLA...G....Q.A.....
gi|341914805|ref|XP_003403867.1|  .........................................LHLACAH...G....R.V.....
gi|60115723|ref|NP_001012421.1|   .........................................LHLACAS...G....H.V.....
gi|60460920|ref|NP_001012419.1|   .........................................LHLACAS...G....H.V.....
gi|156104901|ref|NP_115626.2|     .........................................LHLACTS...G....H.V.....
gi|341914105|ref|XP_001715780.3|  .........................................LLLACAH...G....R.P.....
gi|149363679|ref|NP_001092275.1|  .........................................LHLACAS...G....H.V.....
gi|188595682|ref|NP_001120965.1|  .........................................LHIASLA...G....Q.A.....
gi|14249672|ref|NP_116291.1|      .........................................LHQCCID...D....F.R.....
gi|341915999|ref|XP_292717.9|     .........................................LLLACAH...G....R.P.....
gi|157743284|ref|NP_775866.2|     .........................................LHAAASG...G....N.V.....
gi|222537750|ref|NP_001138501.1|  .........................................LHWACVN...G....H.A.....
gi|325053666|ref|NP_001191332.1|  .........................................LHIASLA...G....Q.A.....
gi|283549153|ref|NP_671728.2|     .........................................LHLACAH...G....R.V.....
gi|155969701|ref|NP_919288.2|     .........................................LHHAAVS...G....D.L.....
gi|312147315|ref|NP_001185879.1|  .........................................LHLCARY...D....N.A.....
gi|62177127|ref|NP_055826.1|      .........................................LHLCARY...D....N.A.....
gi|90186267|ref|NP_078945.2|      .........................................LCLATYL...G....W.L.....
gi|134244285|ref|NP_000426.2|     .........................................LMLASFC...G....G.Alepmp
gi|56550047|ref|NP_001008225.1|   .........................................FHVVTSK...G....N.L.....
gi|67906195|ref|NP_775822.3|      .........................................LQFAAAG...G....H.E.....
gi|267844887|ref|NP_001136205.2|  .........................................LFLAVSS...C....L.L.....
gi|47933346|ref|NP_061901.2|      .........................................LHWAAIN...N....R.L.....
gi|110815813|ref|NP_057460.3|     .........................................LHLAASW...G....L.E.....
gi|55770876|ref|NP_004548.3|      .........................................LMSAVCC...G....E.Vqsgtf
gi|59850762|ref|NP_060473.2|      .........................................FHVVTSK...G....N.L.....
gi|18254476|ref|NP_543150.1|      .........................................LHEACLG...D....H.V.....
gi|310114187|ref|XP_003119912.1|  .........................................LHLACAT...G....Q.P.....
gi|148833508|ref|NP_060087.3|     .........................................LMIASCS...G....G.Gletgn
gi|7657265|ref|NP_056137.1|       .........................................LWCAAGA...G....H.F.....
gi|34304379|ref|NP_899068.1|      .........................................LHLAAQK...G....N.Y.....
gi|34304381|ref|NP_055240.2|      .........................................LHLAAQK...G....N.Y.....
gi|38327522|ref|NP_055206.2|      .........................................--KAALE...N....K.L.....
gi|115495445|ref|NP_443723.2|     .........................................LHWACVN...G....H.E.....
gi|17981699|ref|NP_523240.1|      .........................................-------...-....-.-.....
gi|4502751|ref|NP_001253.1|       .........................................-------...-....-.-.....
gi|24041035|ref|NP_077719.2|      .........................................LMLASLR...G....G.Ssdlsd
gi|17864094|ref|NP_064562.1|      .........................................LWAASAA...G....H.L.....
gi|42734375|ref|NP_597707.1|      .........................................LHTAASI...G....Q.Y.....
gi|13443014|ref|NP_076992.1|      .........................................LHEACLG...G....H.L.....
gi|271398201|ref|NP_001162003.1|  .........................................LHEACLG...G....H.L.....
gi|60218887|ref|NP_001012428.1|   .........................................LHEACLG...G....H.V.....
gi|58331117|ref|NP_001009943.1|   .........................................LHEAASM...G....H.R.....
gi|72534772|ref|NP_001026909.1|   .........................................LHEACLG...G....H.L.....
gi|18254474|ref|NP_543149.1|      .........................................LHEACLG...G....H.V.....
gi|338797779|ref|NP_001229743.1|  .........................................LHLAANK...G....H.L.....
gi|116325987|ref|NP_872409.2|     .........................................LHLAATH...G....H.S.....
gi|17981702|ref|NP_524145.1|      .........................................-------...-....-.-.....
gi|4502753|ref|NP_001791.1|       .........................................-------...-....-.-.....
gi|126723390|ref|NP_597732.1|     .........................................FHLAAMR...G....A.A.....
gi|38569426|ref|NP_071379.3|      .........................................TMRAAEL...G....H.E.....
gi|38569428|ref|NP_942093.1|      .........................................TMRAAEL...G....H.E.....
gi|24308163|ref|NP_061178.1|      .........................................LWAASAA...G....H.L.....
gi|53832024|ref|NP_001005474.1|   .........................................FQVAVAA...N....Q.H.....
gi|13899229|ref|NP_113607.1|      .........................................FQVAVAA...N....Q.H.....
gi|14149716|ref|NP_060077.1|      .........................................LHQACID...E....N.L.....
gi|39812133|ref|NP_065082.2|      .........................................LHRASLE...G....H.M.....
gi|17981694|ref|NP_004927.2|      .........................................-------...-....-.-.....
gi|116063534|ref|NP_115515.2|     .........................................-------...-....-.-.....
gi|4502749|ref|NP_000068.1|       .........................................-------...-....-.-.....
gi|304376272|ref|NP_001182061.1|  .........................................-------...-....-.-.....
gi|32483404|ref|NP_852092.1|      .........................................-------...-....-.-.....
gi|8051599|ref|NP_057739.1|       .........................................-------...-....-.-.....
gi|8051597|ref|NP_002032.2|       .........................................-------...-....-.-.....
gi|8051595|ref|NP_057738.1|       .........................................-------...-....-.-.....
gi|8051593|ref|NP_005245.2|       .........................................-------...-....-.-.....
gi|41327752|ref|NP_659431.5|      .........................................---AAAE...N....Q.E.....
gi|120587025|ref|NP_057232.2|     .........................................LTLAAQTe..G....S.V.....
gi|24586688|ref|NP_543139.4|      .........................................LHEACAR...A....Q.F.....
gi|110815813|ref|NP_057460.3|     .........................................LHKGIQR...G....D.L.....
gi|22208964|ref|NP_665879.1|      .........................................LHVACEM...A....N.V.....
gi|157743292|ref|NP_997721.2|     .........................................LHEACLG...G....H.T.....
gi|7706379|ref|NP_057200.1|       .........................................LHVACEM...A....N.V.....
gi|217416350|ref|NP_001136115.1|  .........................................LHYAAWQ...G....R.L.....
gi|226817313|ref|NP_036441.2|     .........................................LTLAAQL...Dd...S.V.....
gi|52426735|ref|NP_001139.3|      .........................................LHIASLA...G....Q.A.....
gi|219842214|ref|NP_001137358.1|  .........................................-------...-....-.-.....
gi|13129098|ref|NP_077000.1|      .........................................-------...-....-.-.....
gi|21389427|ref|NP_653219.1|      .........................................-------...-....-.-.....
gi|271398185|ref|NP_001162002.1|  .........................................LHEACLG...G....H.L.....
gi|122937241|ref|NP_001073889.1|  .........................................LSLAAQL...D....NaT.....
gi|341915692|ref|XP_003403589.1|  .........................................LHLASAN...G....N.S.....
gi|320202942|ref|NP_001188512.1|  .........................................---ACLG...G....H.V.....
gi|116063534|ref|NP_115515.2|     .........................................LHVAAVC...G....Q.A.....
gi|18640738|ref|NP_570124.1|      .........................................----MTI...G....D.V.....
gi|50897294|ref|NP_001002920.1|   .........................................LHLACAN...G....N.S.....
gi|116534990|ref|NP_015628.2|     .........................................LHFAASY...G....R.I.....
gi|154354990|ref|NP_055730.2|     .........................................LHLACAN...G....H.P.....
gi|341914820|ref|XP_003403870.1|  .........................................LHLACAS...G....H.V.....
gi|19718741|ref|NP_542164.2|      .........................................LHLACYF...G....H.R.....
gi|23510377|ref|NP_694856.1|      .........................................-------...-....-.-.....
gi|64464726|ref|NP_055973.2|      .........................................-------...-....-.-.....
gi|28605137|ref|NP_736606.1|      .........................................LHWACSA...G....H.T.....
gi|289629249|ref|NP_001166206.1|  .........................................LHQCCID...N....F.E.....
gi|13376842|ref|NP_079511.1|      .........................................-------...-....-.-.....
gi|87239981|ref|NP_003738.2|      .........................................-------...-....-.-.....
gi|41281709|ref|NP_640332.1|      .........................................LLVAAAA...N....Q.P.....
gi|194018403|ref|NP_001123453.1|  .........................................-------...-....-.-.....
gi|41350198|ref|NP_060174.2|      .........................................-------...-....-.-.....
gi|169403957|ref|NP_079209.3|     .........................................-------...-....-.-.....
gi|169403959|ref|NP_001108588.1|  .........................................-------...-....-.-.....
gi|157504499|ref|NP_940873.2|     .........................................-------...-....-.-.....
gi|156142184|ref|NP_057550.3|     .........................................LHYASRN...G....H.Y.....
gi|38569426|ref|NP_071379.3|      .........................................-------...-....-.-.....
gi|38569428|ref|NP_942093.1|      .........................................-------...-....-.-.....
gi|70995241|ref|NP_060134.2|      .........................................AHIAAFG...G....H.P.....
gi|209969812|ref|NP_001129663.1|  .........................................-------...-....-.-.....
gi|258613875|ref|NP_056308.3|     .........................................-------...-....-.-.....
gi|12746412|ref|NP_075526.1|      .........................................-------...-....-.-.....
gi|320461689|ref|NP_569059.3|     .........................................LRLAASY...G....H.L.....
gi|4758606|ref|NP_004508.1|       .........................................LHWACRE...G....R.S.....
gi|62420873|ref|NP_001014794.1|   .........................................LHWACRE...G....R.S.....
gi|62420875|ref|NP_001014795.1|   .........................................LHWACRE...G....R.S.....
gi|157266328|ref|NP_000456.2|     .........................................-------...-....-.-.....
gi|154091032|ref|NP_653191.2|     .........................................LICACRR...G....H.V.....
gi|134948558|ref|NP_056023.3|     .........................................-------...-....-.-.....
gi|134948605|ref|NP_001077094.1|  .........................................-------...-....-.-.....
gi|323362985|ref|NP_001190985.1|  .........................................-------...-....-.-.....
gi|4506499|ref|NP_003712.1|       .........................................LSLASTG...G....Y.T.....
gi|21956645|ref|NP_665807.1|      .........................................-------...-....-.-.....
gi|94721248|ref|NP_001035535.1|   .........................................LRIAATA...G....H.G.....
gi|156104862|ref|NP_859063.3|     .........................................LHYSVSH...S....N.F.....
gi|56676397|ref|NP_037407.4|      .........................................-------...-....-.-.....
gi|41055989|ref|NP_059990.2|      .........................................-------...-....-.-.....
gi|304434690|ref|NP_001182073.1|  .........................................-------...-....-.-.....
gi|19924156|ref|NP_604389.1|      .........................................-------...-....-.-.....
gi|256574792|ref|NP_001157915.1|  .........................................-------...-....-.-.....
gi|20270347|ref|NP_620152.1|      .........................................-------...-....-.-.....
gi|31317252|ref|NP_065791.1|      .........................................LDLALSR...R....L.E.....
gi|320461543|ref|NP_001073933.2|  .........................................LHAAARG...G....H.T.....
gi|21314682|ref|NP_061116.2|      .........................................LHIAALY...D....N.L.....
gi|47933348|ref|NP_001001483.1|   .........................................-------...-....-.-.....
gi|267844887|ref|NP_001136205.2|  .........................................LLEAASG...G....N.P.....
gi|187608777|ref|NP_038460.4|     .........................................LHEACNY...G....H.L.....
gi|34304383|ref|NP_775748.2|      .........................................-------...-....-.-.....
gi|256574784|ref|NP_001157912.1|  .........................................LITAAQA...G....H.A.....
gi|8923516|ref|NP_060343.1|       .........................................LHIAVLR...N....Q.P.....
gi|17505200|ref|NP_062815.2|      .........................................LHIAALY...D....N.L.....
gi|38257146|ref|NP_940683.1|      .........................................LHLAAAR...G....N.V.....
gi|321267560|ref|NP_001155907.2|  .........................................-------...-....-.-.....
gi|183396785|ref|NP_001116856.1|  .........................................-------...-....-.-.....
gi|183396783|ref|NP_001116855.1|  .........................................-------...-....-.-.....
gi|21071037|ref|NP_060215.4|      .........................................-------...-....-.-.....
gi|183396787|ref|NP_001116857.1|  .........................................-------...-....-.-.....
gi|299473797|ref|NP_001177408.1|  .........................................LMVAVGL...PdpalR.A.....
gi|284413734|ref|NP_653309.3|     .........................................FHHAALH...N....R.V.....
gi|341915472|ref|XP_003403627.1|  .........................................LHWACAN...G....H.A.....
gi|341915476|ref|XP_003403594.1|  .........................................LHWACAN...G....H.A.....
gi|14150169|ref|NP_115736.1|      .........................................-------...-....-.-.....
gi|256574792|ref|NP_001157915.1|  .........................................-------...-....-.-.....
gi|67906195|ref|NP_775822.3|      .........................................-------...-....-.-.....
gi|28461129|ref|NP_064715.1|      .........................................-------...-....-.-.....
gi|166235148|ref|NP_036515.4|     .........................................-------...-....-.-.....
gi|148664246|ref|NP_665872.2|     .........................................-------...-....-.-.....
gi|76563940|ref|NP_005451.2|      .........................................-------...-....-.-.....
gi|257467559|ref|NP_001004441.2|  .........................................LMIACKT...K....H.Vdhqsv
gi|226437606|ref|NP_001139813.1|  .........................................LMVACIT...K....H.Vdqqsi
gi|188219549|ref|NP_115666.2|     .........................................-------...-....-.-.....
gi|13540606|ref|NP_110440.1|      .........................................LLEAARA...N....N.M.....
gi|89941470|ref|NP_001034977.1|   .........................................LMAACR-...-....-.-.....
gi|62953116|ref|NP_001017523.1|   .........................................LMYACVR...G....D.E.....
gi|4885643|ref|NP_005417.1|       .........................................-------...-....-.-.....
gi|112799849|ref|NP_001026855.2|  .........................................-------...-....-.-.....
gi|65786661|ref|NP_001018082.1|   .........................................LMYACVR...G....D.E.....
gi|56090539|ref|NP_001007534.1|   .........................................-------...-....-.-.....
gi|118498337|ref|NP_056197.2|     .........................................LNWASAF...G....T.Q.....
gi|187608516|ref|NP_036419.3|     .........................................-------...-....-.-.....
gi|194097375|ref|NP_872414.3|     .........................................LMLAAQA...G....H.V.....
gi|320202962|ref|NP_001189332.1|  .........................................LHIAVLR...N....Q.P.....
gi|31581522|ref|NP_004903.2|      .........................................IHYACWY...G....K.V.....
gi|37221182|ref|NP_919437.1|      .........................................IHYACWY...G....K.V.....
gi|37221184|ref|NP_919438.1|      .........................................IHYACWY...G....K.V.....
gi|37221187|ref|NP_919436.1|      .........................................IHYACWY...G....K.V.....
gi|121114287|ref|NP_056131.2|     .........................................LHNAVCA...G....H.H.....
gi|194097377|ref|NP_001123487.1|  .........................................LMLAAQA...G....H.V.....
gi|300796386|ref|NP_665803.2|     .........................................LMYACAA...G....D.E.....
gi|218563749|ref|NP_085152.2|     .........................................-------...-....-.-.....
gi|296179431|ref|NP_068765.3|     .........................................LHEACSR...G....W.T.....
gi|215820635|ref|NP_001135974.1|  .........................................LHNAICG...A....N.Y.....
gi|63003907|ref|NP_006654.2|      .........................................LHNAICG...A....N.Y.....
gi|168229256|ref|NP_689576.4|     .........................................-------...-....-.-.....
gi|148596953|ref|NP_061877.1|     .........................................MHLLCMG...P....Q.Imiseg
gi|7661880|ref|NP_055531.1|       .........................................-------...-....-.-.....
gi|21735483|ref|NP_659505.1|      .........................................LMKALLNinpN....T.K.....
gi|32171201|ref|NP_859077.1|      .........................................-------...-....-.-.....
gi|341915877|ref|XP_001134442.4|  .........................................-------...-....-.-.....
gi|75750529|ref|NP_057636.2|      .........................................-------...-....-.W.....
gi|68131557|ref|NP_056014.2|      .........................................-------...-....-.-.....
gi|38348298|ref|NP_940895.1|      .........................................LHCAAAW...G....R.L.....
gi|319803120|ref|NP_001188386.1|  .........................................LFVAALL...G....L.R.....
gi|57863263|ref|NP_938207.2|      .........................................LFVAALL...G....L.R.....
gi|57863261|ref|NP_112562.3|      .........................................LFVAALL...G....L.R.....
gi|341914329|ref|XP_001717391.3|  .........................................-------...-....-.-.....
gi|51972284|ref|NP_001004354.1|   .........................................LHQSVID...G....N.L.....
gi|41393573|ref|NP_054749.2|      .........................................-------...-....-.-.....
gi|146231998|ref|NP_001078923.1|  .........................................-------...-....-.-.....
gi|313102999|ref|NP_001186197.1|  .........................................-------...-....-.-.....
gi|41872507|ref|NP_003637.2|      .........................................-------...-....-.-.....
gi|313102997|ref|NP_001186196.1|  .........................................-------...-....-.-.....
gi|313103001|ref|NP_963291.2|     .........................................-------...-....-.-.....
gi|41872522|ref|NP_963290.1|      .........................................-------...-....-.-.....
gi|13899267|ref|NP_113626.1|      .........................................-------...-....-.-.....
gi|157688564|ref|NP_001099010.1|  .........................................-------...-....-.-.....
gi|18390333|ref|NP_569058.1|      .........................................VHCAAAG...A....H.P.....
gi|4758156|ref|NP_004708.1|       .........................................LHYAAKT...G....N.G.....
gi|206725420|ref|NP_001128685.1|  .........................................-------...-....-.-.....
gi|206725415|ref|NP_631940.2|     .........................................-------...-....-.-.....
gi|24308163|ref|NP_061178.1|      .........................................-------...-....-.-.....
gi|17149832|ref|NP_476511.1|      .........................................-------...-....-.-.....
gi|74315348|ref|NP_542435.2|      .........................................-------...-....-.-.....
gi|74315350|ref|NP_061197.4|      .........................................-------...-....-.-.....
gi|74315352|ref|NP_542436.2|      .........................................-------...-....-.-.....
gi|74315354|ref|NP_542437.2|      .........................................-------...-....-.-.....
gi|21237786|ref|NP_055591.2|      .........................................-------...-....-.-.....
gi|124517699|ref|NP_689558.4|     .........................................LHYLVWH...Nr...H.R.....
gi|206725422|ref|NP_001128686.1|  .........................................-------...-....-.-.....
gi|17149830|ref|NP_476510.1|      .........................................-------...-....-.-.....
gi|17864094|ref|NP_064562.1|      .........................................-------...-....-.-.....
gi|54607077|ref|NP_075392.2|      .........................................-------...-....-.-.....
gi|31982881|ref|NP_078968.3|      .........................................-------...-....-.-.....
gi|20336214|ref|NP_037399.2|      .........................................-------...-....-.-.....
gi|57863304|ref|NP_056340.2|      .........................................-------...-....-.-.....
gi|304361757|ref|NP_001182027.1|  .........................................LHLACSK...G....H.E.....
gi|304361760|ref|NP_001182028.1|  .........................................LHLACSK...G....H.E.....
gi|313102995|ref|NP_001186195.1|  .........................................-------...-....-.-.....
gi|20127551|ref|NP_057197.2|      .........................................-------...-....-.-.....
gi|38683799|ref|NP_149112.1|      .........................................-------...-....-.-.....
gi|166795254|ref|NP_110443.3|     .........................................-------...-....-.-.....
gi|18496983|ref|NP_056341.1|      .........................................-------...-....-.-.....
gi|313851097|ref|NP_001186499.1|  .........................................-------...-....-.-.....
gi|155969701|ref|NP_919288.2|     .........................................VHHATRA...G....H.L.....
gi|30089932|ref|NP_821066.1|      .........................................-------...-....-.-.....
gi|156104878|ref|NP_055720.3|     .........................................-------...-....-.-.....
gi|294459971|ref|NP_001170902.1|  .........................................LHIAIER...R....C.K.....
gi|22547184|ref|NP_067638.3|      .........................................LHIAIER...R....C.K.....
gi|7661962|ref|NP_055585.1|       .........................................-------...-....-.-.....
gi|117956371|ref|NP_001071154.1|  .........................................-------...-....-.-.....
gi|95147559|ref|NP_787069.3|      .........................................-------...-....-.-.....
gi|16418357|ref|NP_443087.1|      .........................................-------...-....-.-.....
gi|170650694|ref|NP_001116244.1|  .........................................-------...-....-.-.....
gi|150378537|ref|NP_001092877.1|  .........................................-------...-....-.-.....
gi|80978934|ref|NP_055729.2|      .........................................-------...-....-.-.....
gi|5730102|ref|NP_004612.2|       .........................................LQLAVAN...E....H.L.....
gi|80978930|ref|NP_001032208.1|   .........................................-------...-....-.-.....
gi|269315852|ref|NP_997237.2|     .........................................--RLVWA...Nr...H.R.....
gi|255982572|ref|NP_001157637.1|  .........................................LFIAAQE...G....H.T.....
gi|7705831|ref|NP_057199.1|       .........................................LFIAAQE...G....H.T.....
gi|148806877|ref|NP_597704.1|     .........................................-------...-....-.-.....
gi|156104893|ref|NP_597703.2|     .........................................-------...-....-.-.....
gi|117956373|ref|NP_001071153.1|  .........................................-------...-....-.-.....
gi|221136914|ref|NP_001137472.1|  .........................................-------...-....-.-.....
gi|166851846|ref|NP_001071133.2|  .........................................-------...-....-.-.....
gi|339275867|ref|NP_001229858.1|  .........................................LHTAASI...G....Q.Y.....
gi|90991702|ref|NP_078928.3|      .........................................AVVAAYF...G....H.T.....
gi|71274172|ref|NP_001025041.1|   .........................................-------...-....-.-.....
gi|22547180|ref|NP_671737.1|      .........................................LHIAIER...R....C.K.....
gi|4507687|ref|NP_003296.1|       .........................................LQLAVGN...E....H.L.....
gi|6912736|ref|NP_036603.1|       .........................................LLIAIEN...E....N.L.....
gi|110227613|ref|NP_114152.3|     .........................................LHLSSAM...A....N.V.....
gi|194733735|ref|NP_001124170.1|  .........................................LQLAVGN...E....H.L.....
gi|209863030|ref|NP_001129429.1|  .........................................LLIAIEN...E....N.L.....
gi|209863028|ref|NP_001129428.1|  .........................................LLIAIEN...E....N.L.....
gi|209863026|ref|NP_001129427.1|  .........................................LLIAIEN...E....N.L.....
gi|7706747|ref|NP_057263.1|       .........................................LLIAIEN...E....N.L.....
gi|209863024|ref|NP_003297.1|     .........................................LLIAIEN...E....N.L.....
gi|262399375|ref|NP_001161048.1|  .........................................LQLAVGN...E....H.L.....
gi|262399379|ref|NP_001161049.1|  .........................................LQLAVGN...E....H.L.....
gi|9966865|ref|NP_065122.1|       .........................................LQLAVGN...E....H.L.....
gi|25777624|ref|NP_742024.1|      .........................................LYYACLC...G....H.E.....
gi|54112401|ref|NP_056030.1|      .........................................-------...-....-.-.....
gi|157743267|ref|NP_001099046.1|  .........................................-------...-....-.-.....
gi|110815813|ref|NP_057460.3|     .........................................LQRAAGA...G....N.E.....
gi|269847874|ref|NP_073739.3|     .........................................-------...-....-.-.....
gi|75750531|ref|NP_060314.2|      .........................................----ERR...K....R.W.....
gi|7657265|ref|NP_056137.1|       .........................................-------...-....-.-.....
gi|75750529|ref|NP_057636.2|      .........................................-----EG...N....H.E.....
gi|257467636|ref|NP_055646.2|     .........................................-------...-....-.-.....
gi|222352179|ref|NP_001138435.1|  .........................................-------...-....-.-.....
gi|222352177|ref|NP_001138434.1|  .........................................-------...-....-.-.....
gi|222352175|ref|NP_001138433.1|  .........................................-------...-....-.-.....
gi|222352173|ref|NP_004998.3|     .........................................-------...-....-.-.....
gi|61742817|ref|NP_001013424.1|   .........................................-------...-....-.-.....
gi|239744064|ref|XP_001714838.2|  .........................................-------...-....-.-.....
gi|222352168|ref|NP_001138432.1|  .........................................IHAAAEA...G....Q.L.....
gi|29826341|ref|NP_055914.2|      .........................................-------...-....-.-.....
gi|284005535|ref|NP_001164637.1|  .........................................-------...-....-.-.....
gi|284005543|ref|NP_001164639.1|  .........................................-------...-....-.-.....
gi|284005537|ref|NP_001164638.1|  .........................................-------...-....-.-.....
gi|4507685|ref|NP_003295.1|       .........................................VTITIEN...E....N.L.....
gi|15042961|ref|NP_149417.1|      .........................................-------...-....-.-.....
gi|312839866|ref|NP_001186166.1|  .........................................-------...-....-.-.....
gi|312839869|ref|NP_001186167.1|  .........................................-------...-....-.-.....
gi|312839871|ref|NP_001186168.1|  .........................................-------...-....-.-.....
gi|312839873|ref|NP_001186169.1|  .........................................-------...-....-.-.....
gi|109150425|ref|NP_060559.2|     .........................................-------...-....-.-.....
gi|109150435|ref|NP_001035869.1|  .........................................-------...-....-.-.....
gi|257467636|ref|NP_055646.2|     .........................................-------...-....-.-.....
gi|294459965|ref|NP_001170899.1|  .........................................-------...-....-.-.....
gi|209863032|ref|NP_001129430.1|  .........................................LLIAIEN...E....N.L.....
gi|148664230|ref|NP_055929.1|     .........................................LHFACKF...G....N.A.....
gi|114842396|ref|NP_694960.2|     .........................................-------...-....-.-.....
gi|294459977|ref|NP_001170904.1|  .........................................-------...-....-.-.....
gi|22748713|ref|NP_689539.1|      .........................................-------...-....-.-.....
gi|224465235|ref|NP_001138999.1|  .........................................-------...-....-.-.....
gi|98985804|ref|NP_478104.2|      .........................................-------...-....-.-.....
gi|17981696|ref|NP_511042.1|      .........................................-------...-....-.-.....
gi|260763963|ref|NP_001120979.2|  .........................................-------...-....-.-.....
gi|27477049|ref|NP_543144.1|      .........................................-------...-....-.-.....
gi|260763966|ref|NP_001077376.2|  .........................................-------...-....-.-.....
gi|260763960|ref|NP_060405.4|     .........................................-------...-....-.-.....
gi|75750531|ref|NP_060314.2|      .........................................-------...-....-.-.....


                                                       90                                           
                                                        |                                           
d1s70b_                             .................DMVKFLVE...........N...G.A.....................
gi|21361135|ref|NP_002494.2|      .................PFLDFLLG...........F...S.A.....................
gi|70780355|ref|NP_065210.2|      .................ETVLALLE...........K...E.A.....................
gi|215598574|ref|NP_001135918.1|  .................ETVLALLE...........K...E.A.....................
gi|70780353|ref|NP_065208.2|      .................ETVLALLE...........K...E.A.....................
gi|70780359|ref|NP_065209.2|      .................ETVLALLE...........K...E.A.....................
gi|70780357|ref|NP_000028.3|      .................ETVLALLE...........K...E.A.....................
gi|325053666|ref|NP_001191332.1|  .................EVANLLLQ...........K...S.A.....................
gi|325053668|ref|NP_001191333.1|  .................EVANLLLQ...........K...S.A.....................
gi|32967601|ref|NP_066267.2|      .................EVANLLLQ...........K...S.A.....................
gi|188595682|ref|NP_001120965.1|  .................DVAKLLLQ...........R...R.A.....................
gi|52426737|ref|NP_066187.2|      .................DVAKLLLQ...........R...R.A.....................
gi|52426735|ref|NP_001139.3|      .................DVAKLLLQ...........R...R.A.....................
gi|268607595|ref|NP_001161354.1|  .................LICEALIE...........Q...G.A.....................
gi|62988328|ref|NP_065070.1|      .................LICEALIE...........Q...G.A.....................
gi|48928017|ref|NP_001001716.1|   .................--------...........-...-.-.....................
gi|70780353|ref|NP_065208.2|      .................NVVAHLIN...........Y...G.Tkgkvrlpalhiaarnddtrta
gi|70780355|ref|NP_065210.2|      .................NVVAHLIN...........Y...G.Tkgkvrlpalhiaarnddtrta
gi|70780359|ref|NP_065209.2|      .................NVVAHLIN...........Y...G.Tkgkvrlpalhiaarnddtrta
gi|70780357|ref|NP_000028.3|      .................NVVAHLIN...........Y...G.Tkgkvrlpalhiaarnddtrta
gi|215598574|ref|NP_001135918.1|  .................NVVAHLIN...........Y...G.Tkgkvrlpalhiaarnddtrta
gi|325053668|ref|NP_001191333.1|  .................NVATLLLN...........R...A.A.....................
gi|32967601|ref|NP_066267.2|      .................NVATLLLN...........R...A.A.....................
gi|304434687|ref|NP_710181.2|     .................EMVNLLLA...........K...G.A.....................
gi|30425444|ref|NP_848605.1|      .................GTARLLLD...........H...G.A.....................
gi|304361757|ref|NP_001182027.1|  .................VVVNELID...........C...G.A.....................
gi|304361760|ref|NP_001182028.1|  .................VVVNELID...........C...G.A.....................
gi|46519151|ref|NP_060448.1|      .................EVARVLLD...........H...G.A.....................
gi|46519154|ref|NP_078944.2|      .................EVARVLLD...........H...G.A.....................
gi|157743284|ref|NP_775866.2|     .................EVLKLLVA...........R...G.A.....................
gi|55741641|ref|NP_065789.1|      .................DVVELLLS...........H...G.A.....................
gi|10863929|ref|NP_066956.1|      .................KLLKLFLS...........K...G.A.....................
gi|308044526|ref|NP_001183959.1|  .................DIVKVLLN...........E...G.A.....................
gi|41327754|ref|NP_065690.2|      .................SSTRLLLE...........K...N.A.....................
gi|38683816|ref|NP_942592.1|      .................EVVELLLA...........R...G.A.....................
gi|38683807|ref|NP_115593.3|      .................EVVELLLA...........R...G.A.....................
gi|304434690|ref|NP_001182073.1|  .................EAVQVLIK...........H...S.A.....................
gi|46519147|ref|NP_060217.1|      .................ELAALLIE...........R...G.A.....................
gi|37620163|ref|NP_065741.3|      .................ELAALLIE...........R...G.A.....................
gi|304361757|ref|NP_001182027.1|  .................ECLRLLIG...........NaepQ.N.....................
gi|304361760|ref|NP_001182028.1|  .................ECLRLLIG...........NaepQ.N.....................
gi|37620163|ref|NP_065741.3|      .................NIIKILLN...........A...G.A.....................
gi|46519147|ref|NP_060217.1|      .................NIIKILLN...........A...G.A.....................
gi|68131557|ref|NP_056014.2|      .................EAVQVLLK...........H...S.A.....................
gi|96975023|ref|NP_874362.3|      .................DALDFLVG...........S...G.C.....................
gi|10092619|ref|NP_065390.1|      .................EIAEALLG...........A...G.C.....................
gi|38683816|ref|NP_942592.1|      .................DVVKVLLE...........S...G.A.....................
gi|38683807|ref|NP_115593.3|      .................DVVKVLLE...........S...G.A.....................
gi|157739945|ref|NP_079461.2|     .................EVVKFLIQ...........C...D.Wtmagqqqgvfkkshaiqqali
gi|18252778|ref|NP_057234.2|      .................DCLLSLLQ...........A...G.A.....................
gi|89363047|ref|NP_004929.2|      .................DVAQLLCS...........F...G.S.....................
gi|321117514|ref|NP_001189358.1|  .................DCLLSLLQ...........A...G.A.....................
gi|223634006|ref|NP_001138682.1|  .................RVAELLLQ...........R...G.A.....................
gi|341914599|ref|XP_001714535.3|  .................RIVEYLIQdl.........H...L.K.....................
gi|341915319|ref|XP_001128459.4|  .................RIVEYLIQdl.........H...L.K.....................
gi|34304379|ref|NP_899068.1|      .................ETVKVFLK...........H...P.Svkddsdlegrtsfmwaagkgs
gi|225543463|ref|NP_001139381.1|  .................DILQYLLT...........C...E.Wspgppqpgtlrkshalqqalt
gi|34304381|ref|NP_055240.2|      .................ETVKVFLK...........H...P.Svkddsdlegrtsfmwaagkgs
gi|225543461|ref|NP_203752.2|     .................DILQYLLT...........C...E.Wspgppqpgtlrkshalqqalt
gi|325053666|ref|NP_001191332.1|  .................NMVKLLLD...........R...G.A.....................
gi|68131557|ref|NP_056014.2|      .................ECVDALLQ...........H...G.A.....................
gi|52426735|ref|NP_001139.3|      .................NMVKLLLD...........R...G.G.....................
gi|4506217|ref|NP_002805.1|       .................EIVEFLLQ...........L...G.V.....................
gi|188595682|ref|NP_001120965.1|  .................NMVKLLLD...........R...G.G.....................
gi|52426737|ref|NP_066187.2|      .................NMVKLLLD...........R...G.G.....................
gi|224465233|ref|NP_079033.4|     .................EAVKYLIK...........A...G.A.....................
gi|164664508|ref|NP_005169.2|     .................SVVRLLVT...........A...G.A.....................
gi|7705748|ref|NP_057062.1|       .................QVTRLLLK...........F...G.A.....................
gi|313569861|ref|NP_001186256.1|  .................QVTRLLLK...........F...G.A.....................
gi|163914396|ref|NP_001106279.1|  .................QVTRLLLK...........F...G.A.....................
gi|87239981|ref|NP_003738.2|      .................DVMEVLHK...........H...G.A.....................
gi|13376842|ref|NP_079511.1|      .................DVVEVVVK...........H...E.A.....................
gi|7705831|ref|NP_057199.1|       .................KIVQILLE...........A...G.A.....................
gi|255982572|ref|NP_001157637.1|  .................KIVQILLE...........A...G.A.....................
gi|338797777|ref|NP_001229742.1|  .................EIIAALIH...........E...G.C.....................
gi|338797775|ref|NP_055757.3|     .................EIIAALIH...........E...G.C.....................
gi|338797766|ref|NP_001229738.1|  .................EIIAALIH...........E...G.C.....................
gi|338797770|ref|NP_001229740.1|  .................EIIAALIH...........E...G.C.....................
gi|206597522|ref|NP_001128663.1|  .................--------...........-...-.-.....................
gi|4502249|ref|NP_003878.1|       .................--------...........-...-.-.....................
gi|304434690|ref|NP_001182073.1|  .................ECVQMLLE...........Q...E.V.....................
gi|157743284|ref|NP_775866.2|     .................DCLAALLD...........H...D.A.....................
gi|46094081|ref|NP_060952.2|      .................--------...........-...-.-.....................
gi|13376842|ref|NP_079511.1|      .................EVVNLLLR...........H...G.A.....................
gi|87239981|ref|NP_003738.2|      .................EVVSLLLC...........Q...G.A.....................
gi|156142197|ref|NP_006700.3|     .................EVARYMVQ...........R...G.G.....................
gi|156142199|ref|NP_079532.5|     .................EVARYMVQ...........R...G.G.....................
gi|92087060|ref|NP_563616.3|      .................DIVALLLK...........H...G.G.....................
gi|70995267|ref|NP_775776.2|      .................DVVRFLFG...........F...G.A.....................
gi|219842212|ref|NP_001137357.1|  .................DMVKFLVE...........N...G.A.....................
gi|4505317|ref|NP_002471.1|       .................DMVKFLVE...........N...G.A.....................
gi|116534990|ref|NP_015628.2|     .................EVMKVLLE...........Hr..T.I.....................
gi|282394038|ref|NP_001164160.1|  .................EATRVLLS...........A...G.C.....................
gi|282394032|ref|NP_001164157.1|  .................EATRVLLS...........A...G.C.....................
gi|282394030|ref|NP_543151.2|     .................EATRVLLS...........A...G.C.....................
gi|282394036|ref|NP_001164159.1|  .................EATRVLLS...........A...G.C.....................
gi|282394034|ref|NP_001164158.1|  .................EATRVLLS...........A...G.C.....................
gi|58331111|ref|NP_061919.1|      .................DCVRYLLG...........R...G.A.....................
gi|58331113|ref|NP_001009941.1|   .................DCVRYLLG...........R...G.A.....................
gi|268607595|ref|NP_001161354.1|  .................DVVNLLVS...........R...G.A.....................
gi|62988328|ref|NP_065070.1|      .................DVVNLLVS...........R...G.A.....................
gi|221307473|ref|NP_001137250.1|  .................--------...........-...-.-.....................
gi|19923540|ref|NP_060177.2|      .................--------...........-...-.-.....................
gi|140161500|ref|NP_056060.2|     .................QIVRLLIH...........Q...G.P.....................
gi|224809478|ref|NP_001138997.1|  .................ECLRVMIT...........H...G.V.....................
gi|224809468|ref|NP_056392.2|     .................ECLRVMIT...........H...G.V.....................
gi|224809470|ref|NP_001138992.1|  .................ECLRVMIT...........H...G.V.....................
gi|224809472|ref|NP_001138993.1|  .................ECLRVMIT...........H...G.V.....................
gi|224809474|ref|NP_001138994.1|  .................ECLRVMIT...........H...G.V.....................
gi|18079216|ref|NP_065815.1|      .................EPMKLVLK...........A...G.S.....................
gi|224809476|ref|NP_001138995.1|  .................ECLRVMIT...........H...G.V.....................
gi|217416347|ref|NP_065804.2|     .................EPVRLLLR...........A...S.A.....................
gi|341915690|ref|XP_003403588.1|  .................EVVQLLLD...........R...R.C.....................
gi|239745058|ref|XP_002343353.1|  .................EVVQLLLD...........R...R.C.....................
gi|341915688|ref|XP_003403587.1|  .................EVVQLLLD...........R...R.C.....................
gi|310118968|ref|XP_003118905.1|  .................EMVHLLVS...........R...R.C.....................
gi|30348954|ref|NP_065825.1|      .................AVIEVLHR...........G...S.A.....................
gi|310118966|ref|XP_001717815.3|  .................EMVHLLVS...........R...R.C.....................
gi|71274109|ref|NP_004547.2|      .................GAVRALVL...........K...G.A.....................
gi|110431370|ref|NP_113663.2|     .................EVVNWLLH...........Hg..G.G.....................
gi|256222430|ref|NP_079466.3|     .................EMVHLLVS...........R...R.C.....................
gi|28626517|ref|NP_056383.1|      .................EIVKLLLS...........H...G.A.....................
gi|53828703|ref|NP_001005365.2|   .................EVVSLLLD...........R...Q.C.....................
gi|239747114|ref|XP_002343914.1|  .................EVVQLLLD...........R...R.C.....................
gi|153792284|ref|NP_778146.2|     .................EVVQLLLD...........R...R.C.....................
gi|52856434|ref|NP_001005356.1|   .................EVVKLLLD...........R...R.C.....................
gi|50511945|ref|NP_690001.3|      .................EIVKILIH...........H...G.P.....................
gi|148596917|ref|NP_660278.3|     .................RLVKILVS...........N...G.T.....................
gi|209977003|ref|NP_001129685.1|  .................EVVKLLLD...........R...R.C.....................
gi|212549546|ref|NP_001131143.1|  .................EVVQLLLD...........R...R.C.....................
gi|256222280|ref|NP_001157787.1|  .................EMVHLLVS...........R...R.C.....................
gi|224282147|ref|NP_001138914.1|  .................EVVKLLLD...........R...R.C.....................
gi|259155302|ref|NP_001158884.1|  .................DVVEDLLR...........A...G.A.....................
gi|121582655|ref|NP_653299.3|     .................ECLTILLA...........N...G.A.....................
gi|68131557|ref|NP_056014.2|      .................LLINTLIT...........S...G.A.....................
gi|34577122|ref|NP_003989.2|      .................DVVEDLLR...........A...G.A.....................
gi|153791352|ref|NP_001093241.1|  .................EVVKLLLD...........R...R.C.....................
gi|103471993|ref|NP_056151.2|     .................DLVKYYIS...........K...G.A.....................
gi|134133226|ref|NP_001077007.1|  .................EVVKLLLD...........R...R.C.....................
gi|268607514|ref|NP_001161330.1|  .................DMVKFLVE...........N...R.A.....................
gi|268607512|ref|NP_001161329.1|  .................DMVKFLVE...........N...R.A.....................
gi|30089994|ref|NP_078984.2|      .................RIARLMLE...........S...E.Y.....................
gi|22208957|ref|NP_078977.2|      .................RCVQLLLA...........A...G.A.....................
gi|22208951|ref|NP_665862.1|      .................DVLRLLLQ...........H...G.A.....................
gi|320202950|ref|NP_001188894.1|  .................DVLRLLLQ...........H...G.A.....................
gi|37620163|ref|NP_065741.3|      .................DIVKLLLL...........H...D.A.....................
gi|46519147|ref|NP_060217.1|      .................DIVKLLLL...........H...D.A.....................
gi|38176283|ref|NP_937886.1|      .................RIARLMLE...........S...E.Y.....................
gi|88953571|ref|XP_933678.1|      .................GVVKLLLD...........R...R.C.....................
gi|113413200|ref|XP_934799.2|     .................GVVKLLLD...........R...R.C.....................
gi|268607506|ref|NP_002472.2|     .................DMVKFLVE...........N...R.A.....................
gi|118150656|ref|NP_062618.2|     .................DVVLFLIE...........Q...Q.C.....................
gi|38683816|ref|NP_942592.1|      .................EVADFLIK...........A...G.A.....................
gi|38683807|ref|NP_115593.3|      .................EVADFLIK...........A...G.A.....................
gi|304434690|ref|NP_001182073.1|  .................TRSQTLIQ...........N...G.G.....................
gi|215598806|ref|NP_543147.2|     .................ACVHVLLV...........A...G.A.....................
gi|52486194|ref|NP_003551.2|      .................QVLQLLGR...........Na..V.A.....................
gi|294337038|ref|NP_001135932.2|  .................ACVHVLLV...........A...G.A.....................
gi|294337037|ref|NP_001135931.2|  .................ACVHVLLV...........A...G.A.....................
gi|116875852|ref|NP_065822.2|     .................KCMSKLLE...........Y...S.A.....................
gi|117320527|ref|NP_002493.3|     .................SVVSFLLR...........V...G.A.....................
gi|117320540|ref|NP_001070961.1|  .................SVVSFLLR...........V...G.A.....................
gi|117320531|ref|NP_001070962.1|  .................SVVSFLLR...........V...G.A.....................
gi|313760592|ref|NP_001186491.1|  .................QVLQLLGR...........Na..V.A.....................
gi|52486251|ref|NP_001004426.1|   .................QVLQLLGR...........Na..V.A.....................
gi|16975496|ref|NP_219499.1|      .................DCVRLLLS...........A...E.A.....................
gi|52426737|ref|NP_066187.2|      .................EVVKVLVK...........E...G.A.....................
gi|341914805|ref|XP_003403867.1|  .................QVVTLLLD...........R...K.C.....................
gi|60115723|ref|NP_001012421.1|   .................QVVTLLVN...........R...K.C.....................
gi|60460920|ref|NP_001012419.1|   .................QVVTLLVN...........R...K.C.....................
gi|156104901|ref|NP_115626.2|     .................QVVTLLVN...........R...K.C.....................
gi|341914105|ref|XP_001715780.3|  .................GVVADLVA...........R...K.C.....................
gi|149363679|ref|NP_001092275.1|  .................QVVTLLVN...........R...K.C.....................
gi|188595682|ref|NP_001120965.1|  .................EVVKVLVK...........E...G.A.....................
gi|14249672|ref|NP_116291.1|      .................EMVQQLLE...........A...G.A.....................
gi|341915999|ref|XP_292717.9|     .................GVVADLVA...........R...K.C.....................
gi|157743284|ref|NP_775866.2|     .................ECLNLLLS...........S...G.A.....................
gi|222537750|ref|NP_001138501.1|  .................EVVTFLVD...........R...K.C.....................
gi|325053666|ref|NP_001191332.1|  .................EVVKVLVT...........N...G.A.....................
gi|283549153|ref|NP_671728.2|     .................QVVTLLLH...........R...R.C.....................
gi|155969701|ref|NP_919288.2|     .................TCLKLLTA...........Ah..G.S.....................
gi|312147315|ref|NP_001185879.1|  .................FIAEILID...........R...G.V.....................
gi|62177127|ref|NP_055826.1|      .................FIAEILID...........R...G.V.....................
gi|90186267|ref|NP_078945.2|      .................EGCVSLLR...........N...G.A.....................
gi|134244285|ref|NP_000426.2|     ......teedeaddtsaSIISDLIC...........Q...G.A.....................
gi|56550047|ref|NP_001008225.1|   .................ECLNAILI...........H...G.V.....................
gi|67906195|ref|NP_775822.3|      .................PLVRFLLR...........R...G.A.....................
gi|267844887|ref|NP_001136205.2|  .................ENATFLLL...........N...G.C.....................
gi|47933346|ref|NP_061901.2|      .................DLVKFYIS...........K...G.A.....................
gi|110815813|ref|NP_057460.3|     .................ETVQCLLE...........F...G.A.....................
gi|55770876|ref|NP_004548.3|      .........qgawlgcpEPWEPLLD...........G...G.A.....................
gi|59850762|ref|NP_060473.2|      .................ECLNAILI...........H...G.V.....................
gi|18254476|ref|NP_543150.1|      .................ACARTLLE...........A...G.A.....................
gi|310114187|ref|XP_003119912.1|  .................EMVHLLVS...........R...R.C.....................
gi|148833508|ref|NP_060087.3|     .........seeeedapAVISDFIY...........Q...G.A.....................
gi|7657265|ref|NP_056137.1|       .................EVVKLLVS...........H...G.A.....................
gi|34304379|ref|NP_899068.1|      .................RFMKLLLT...........R...R.A.....................
gi|34304381|ref|NP_055240.2|      .................RFMKLLLT...........R...R.A.....................
gi|38327522|ref|NP_055206.2|      .................PVVEKFLS...........D...K.N.....................
gi|115495445|ref|NP_443723.2|     .................EVVTFLVD...........R...K.C.....................
gi|17981699|ref|NP_523240.1|      .................--------...........-...-.-.....................
gi|4502751|ref|NP_001253.1|       .................--------...........-...-.-.....................
gi|24041035|ref|NP_077719.2|      .......ededaedssaNIITDLVY...........Q...G.A.....................
gi|17864094|ref|NP_064562.1|      .................KVVQSLLN...........H...G.A.....................
gi|42734375|ref|NP_597707.1|      .................EVVKECVQ...........Rr..E.L.....................
gi|13443014|ref|NP_076992.1|      .................SCVKILLK...........H...G.A.....................
gi|271398201|ref|NP_001162003.1|  .................SCVKILLK...........H...G.A.....................
gi|60218887|ref|NP_001012428.1|   .................ACAKALLE...........N...G.A.....................
gi|58331117|ref|NP_001009943.1|   .................DCVRYLLG...........R...G.A.....................
gi|72534772|ref|NP_001026909.1|   .................SCVKILLK...........H...G.A.....................
gi|18254474|ref|NP_543149.1|      .................ACAKALLE...........N...G.A.....................
gi|338797779|ref|NP_001229743.1|  .................PVVQILLK...........A...G.C.....................
gi|116325987|ref|NP_872409.2|     .................FTLQIMLR...........S...G.V.....................
gi|17981702|ref|NP_524145.1|      .................--------...........-...-.-.....................
gi|4502753|ref|NP_001791.1|       .................--------...........-...-.-.....................
gi|126723390|ref|NP_597732.1|     .................SCLEVMIA...........H...G.S.....................
gi|38569426|ref|NP_071379.3|      .................LSMEILAK...........A...K.A.....................
gi|38569428|ref|NP_942093.1|      .................LSMEILAK...........A...K.A.....................
gi|24308163|ref|NP_061178.1|      .................DVVRSLLR...........R...G.A.....................
gi|53832024|ref|NP_001005474.1|   .................LIVQDLVN...........I...G.A.....................
gi|13899229|ref|NP_113607.1|      .................LIVQDLVN...........I...G.A.....................
gi|14149716|ref|NP_060077.1|      .................EVVRFLVE...........Q...G.A.....................
gi|39812133|ref|NP_065082.2|      .................EILEKLLD...........N...G.A.....................
gi|17981694|ref|NP_004927.2|      .................--------...........-...-.-.....................
gi|116063534|ref|NP_115515.2|     .................--------...........-...-.Daedtvsaadpefchplcqcpk
gi|4502749|ref|NP_000068.1|       .................--------...........-...-.-.....................
gi|304376272|ref|NP_001182061.1|  .................--------...........-...-.-.....................
gi|32483404|ref|NP_852092.1|      .................--------...........-...-.-.....................
gi|8051599|ref|NP_057739.1|       .................--------...........-...-.-.....................
gi|8051597|ref|NP_002032.2|       .................--------...........-...-.-.....................
gi|8051595|ref|NP_057738.1|       .................--------...........-...-.-.....................
gi|8051593|ref|NP_005245.2|       .................--------...........-...-.-.....................
gi|41327752|ref|NP_659431.5|      .................YLIDKYLT...........D...G.G.....................
gi|120587025|ref|NP_057232.2|     .................EVIRTLCL...........G...G.A.....................
gi|24586688|ref|NP_543139.4|      .................DCVRLLLT...........F...G.A.....................
gi|110815813|ref|NP_057460.3|     .................FAATFLIK...........N...G.A.....................
gi|22208964|ref|NP_665879.1|      .................DCVKILCD...........R...G.A.....................
gi|157743292|ref|NP_997721.2|     .................ACVRLLLQ...........H...R.A.....................
gi|7706379|ref|NP_057200.1|       .................DCVKILCD...........R...G.A.....................
gi|217416350|ref|NP_001136115.1|  .................EPVRLLLR...........A...S.A.....................
gi|226817313|ref|NP_036441.2|     .................EVIKALKN...........G...G.A.....................
gi|52426735|ref|NP_001139.3|      .................EVVKVLVK...........E...G.A.....................
gi|219842214|ref|NP_001137358.1|  .................-MVKFLVE...........N...G.A.....................
gi|13129098|ref|NP_077000.1|      .................DNVEDLIR...........G...G.A.....................
gi|21389427|ref|NP_653219.1|      .................--------...........-...-.-.....................
gi|271398185|ref|NP_001162002.1|  .................SCVKILLK...........H...G.A.....................
gi|122937241|ref|NP_001073889.1|  .................DLLKVLKN...........G...G.A.....................
gi|341915692|ref|XP_003403589.1|  .................EVVQLLLD...........R...R.C.....................
gi|320202942|ref|NP_001188512.1|  .................ACAKALLE...........N...G.A.....................
gi|116063534|ref|NP_115515.2|     .................SLIDLLVS...........K...G.A.....................
gi|18640738|ref|NP_570124.1|      .................SLVQELLD...........S...G.I.....................
gi|50897294|ref|NP_001002920.1|   .................EVVSLLLD...........R...Q.C.....................
gi|116534990|ref|NP_015628.2|     .................NTCQRLLQ...........D...I.S.....................
gi|154354990|ref|NP_055730.2|     .................EVVTLLVD...........R...K.C.....................
gi|341914820|ref|XP_003403870.1|  .................QVVTLLVN...........R...K.C.....................
gi|19718741|ref|NP_542164.2|      .................QVVQDLLK...........A...G.A.....................
gi|23510377|ref|NP_694856.1|      .................--------...........-...-.-.....................
gi|64464726|ref|NP_055973.2|      .................--------...........-...-.-.....................
gi|28605137|ref|NP_736606.1|      .................EIVEFLLQ...........L...G.V.....................
gi|289629249|ref|NP_001166206.1|  .................EIVKLLLS...........H...G.A.....................
gi|13376842|ref|NP_079511.1|      .................--------...........-...-.-.....................
gi|87239981|ref|NP_003738.2|      .................--------...........-...-.-.....................
gi|41281709|ref|NP_640332.1|      .................LIVEDLLN...........L...G.A.....................
gi|194018403|ref|NP_001123453.1|  .................--------...........-...-.-.....................
gi|41350198|ref|NP_060174.2|      .................--------...........-...-.-.....................
gi|169403957|ref|NP_079209.3|     .................--------...........-...-.-.....................
gi|169403959|ref|NP_001108588.1|  .................--------...........-...-.-.....................
gi|157504499|ref|NP_940873.2|     .................--------...........-...-.-.....................
gi|156142184|ref|NP_057550.3|     .................AVCQFLLE...........S...G.A.....................
gi|38569426|ref|NP_071379.3|      .................--------...........-...-.-.....................
gi|38569428|ref|NP_942093.1|      .................--------...........-...-.-.....................
gi|70995241|ref|NP_060134.2|      .................QCLVWLIQ...........A...G.A.....................
gi|209969812|ref|NP_001129663.1|  .................--------...........-...-.-.....................
gi|258613875|ref|NP_056308.3|     .................--------...........-...-.-.....................
gi|12746412|ref|NP_075526.1|      .................--------...........-...-.-.....................
gi|320461689|ref|NP_569059.3|     .................SCLQVLLA...........H...G.A.....................
gi|4758606|ref|NP_004508.1|       .................AVVEMLIM...........R...G.A.....................
gi|62420873|ref|NP_001014794.1|   .................AVVEMLIM...........R...G.A.....................
gi|62420875|ref|NP_001014795.1|   .................AVVEMLIM...........R...G.A.....................
gi|157266328|ref|NP_000456.2|     .................--------...........-...-.-.....................
gi|154091032|ref|NP_653191.2|     .................RIVSFLLR...........R...N.A.....................
gi|134948558|ref|NP_056023.3|     .................--------...........-...-.-.....................
gi|134948605|ref|NP_001077094.1|  .................--------...........-...-.-.....................
gi|323362985|ref|NP_001190985.1|  .................--------...........-...-.-.....................
gi|4506499|ref|NP_003712.1|       .................DIVGLLLE...........R...D.V.....................
gi|21956645|ref|NP_665807.1|      .................--------...........-...-.-.....................
gi|94721248|ref|NP_001035535.1|   .................SCVDFLIR...........K...G.A.....................
gi|156104862|ref|NP_859063.3|     .................SIVKLLLE...........T...GvC.....................
gi|56676397|ref|NP_037407.4|      .................--------...........-...-.-.....................
gi|41055989|ref|NP_059990.2|      .................--------...........-...-.-.....................
gi|304434690|ref|NP_001182073.1|  .................-CLEFLLQ...........N...D.A.....................
gi|19924156|ref|NP_604389.1|      .................--------...........-...-.-.....................
gi|256574792|ref|NP_001157915.1|  .................--------...........-...-.-.....................
gi|20270347|ref|NP_620152.1|      .................--------...........-...-.-.....................
gi|31317252|ref|NP_065791.1|      .................SIATTLVS...........H...K.A.....................
gi|320461543|ref|NP_001073933.2|  .................EAVTMLLQ...........R...G.V.....................
gi|21314682|ref|NP_061116.2|      .................EAAMVLME...........A...A.P.....................
gi|47933348|ref|NP_001001483.1|   .................--------...........-...-.-.....................
gi|267844887|ref|NP_001136205.2|  .................DAVALLLE...........Y...G.A.....................
gi|187608777|ref|NP_038460.4|     .................EIVRFLLD...........H...G.A.....................
gi|34304383|ref|NP_775748.2|      .................--------...........-...-.-.....................
gi|256574784|ref|NP_001157912.1|  .................IITNYLLN...........Yfp.G.L.....................
gi|8923516|ref|NP_060343.1|       .................DMVELLVH...........H...G.A.....................
gi|17505200|ref|NP_062815.2|      .................EAALVLME...........A...A.P.....................
gi|38257146|ref|NP_940683.1|      .................DICQLLHK...........F...G.A.....................
gi|321267560|ref|NP_001155907.2|  .................--------...........-...-.-.....................
gi|183396785|ref|NP_001116856.1|  .................--------...........-...-.-.....................
gi|183396783|ref|NP_001116855.1|  .................--------...........-...-.-.....................
gi|21071037|ref|NP_060215.4|      .................--------...........-...-.-.....................
gi|183396787|ref|NP_001116857.1|  .................--------...........-...-.-.....................
gi|299473797|ref|NP_001177408.1|  .................RFVRLLLE...........Q...G.A.....................
gi|284413734|ref|NP_653309.3|     .................SIICQLCN...........A...N.F.....................
gi|341915472|ref|XP_003403627.1|  .................EVVTLLVD...........R...K.R.....................
gi|341915476|ref|XP_003403594.1|  .................EVVTLLVD...........R...K.R.....................
gi|14150169|ref|NP_115736.1|      .................--------...........-...-.-.....................
gi|256574792|ref|NP_001157915.1|  .................--------...........-...-.-.....................
gi|67906195|ref|NP_775822.3|      .................--------...........-...-.-.....................
gi|28461129|ref|NP_064715.1|      .................--------...........-...-.-.....................
gi|166235148|ref|NP_036515.4|     .................--------...........-...-.-.....................
gi|148664246|ref|NP_665872.2|     .................--------...........-...-.-.....................
gi|76563940|ref|NP_005451.2|      .................--------...........-...-.-.....................
gi|257467559|ref|NP_001004441.2|  ..............skaKMVKYLLE...........N...N.A.....................
gi|226437606|ref|NP_001139813.1|  ..............sksKMVKYLLD...........N...R.A.....................
gi|188219549|ref|NP_115666.2|     .................--------...........-...-.-.....................
gi|13540606|ref|NP_110440.1|      .................QEVSRLLS...........E...G.A.....................
gi|89941470|ref|NP_001034977.1|   .................--------...........-...-.-.....................
gi|62953116|ref|NP_001017523.1|   .................AMVQMLLD...........A...G.A.....................
gi|4885643|ref|NP_005417.1|       .................--------...........-...-.-.....................
gi|112799849|ref|NP_001026855.2|  .................--------...........-...-.-.....................
gi|65786661|ref|NP_001018082.1|   .................AMVQMLLD...........A...G.A.....................
gi|56090539|ref|NP_001007534.1|   .................--------...........-...-.-.....................
gi|118498337|ref|NP_056197.2|     .................EMVEFLCE...........R...G.A.....................
gi|187608516|ref|NP_036419.3|     .................--------...........-...-.-.....................
gi|194097375|ref|NP_872414.3|     .................PLVSLLLN...........Yyv.G.L.....................
gi|320202962|ref|NP_001189332.1|  .................DMVELLVH...........H...G.A.....................
gi|31581522|ref|NP_004903.2|      .................EATRILLE...........K...GkC.....................
gi|37221182|ref|NP_919437.1|      .................EATRILLE...........K...GkC.....................
gi|37221184|ref|NP_919438.1|      .................EATRILLE...........K...GkC.....................
gi|37221187|ref|NP_919436.1|      .................EATRILLE...........K...GkC.....................
gi|121114287|ref|NP_056131.2|     .................HIVKFLLD...........F...G.V.....................
gi|194097377|ref|NP_001123487.1|  .................PLVSLLLN...........Yyv.G.L.....................
gi|300796386|ref|NP_665803.2|     .................AMVQMLID...........A...G.A.....................
gi|218563749|ref|NP_085152.2|     .................--------...........-...-.-.....................
gi|296179431|ref|NP_068765.3|     .................DILNILLE...........H...G.A.....................
gi|215820635|ref|NP_001135974.1|  .................SIVDFLIT...........A...G.A.....................
gi|63003907|ref|NP_006654.2|      .................SIVDFLIT...........A...G.A.....................
gi|168229256|ref|NP_689576.4|     .................--------...........-...-.-.....................
gi|148596953|ref|NP_061877.1|     alhprlarpteddfrraDCLQMILK...........Wk..G.A.....................
gi|7661880|ref|NP_055531.1|       .................--------...........-...-.-.....................
gi|21735483|ref|NP_659505.1|      .................EIVRILLAfaeendilgrfI...N.A.....................
gi|32171201|ref|NP_859077.1|      .................--------...........-...-.-.....................
gi|341915877|ref|XP_001134442.4|  .................--------...........-...-.-.....................
gi|75750529|ref|NP_057636.2|      .................RTIKLLLR...........R...G.A.....................
gi|68131557|ref|NP_056014.2|      .................--------...........-...-.-.....................
gi|38348298|ref|NP_940895.1|      .................ETLKALVE...........L...D.V.....................
gi|319803120|ref|NP_001188386.1|  .................KFVDVLVD...........Y...G.S.....................
gi|57863263|ref|NP_938207.2|      .................KFVDVLVD...........Y...G.S.....................
gi|57863261|ref|NP_112562.3|      .................KFVDVLVD...........Y...G.S.....................
gi|341914329|ref|XP_001717391.3|  .................--------...........-...-.-.....................
gi|51972284|ref|NP_001004354.1|   .................ELVKLLVK...........F...G.A.....................
gi|41393573|ref|NP_054749.2|      .................--------...........-...-.-.....................
gi|146231998|ref|NP_001078923.1|  .................--------...........-...-.-.....................
gi|313102999|ref|NP_001186197.1|  .................--------...........-...-.-.....................
gi|41872507|ref|NP_003637.2|      .................--------...........-...-.-.....................
gi|313102997|ref|NP_001186196.1|  .................--------...........-...-.-.....................
gi|313103001|ref|NP_963291.2|     .................--------...........-...-.-.....................
gi|41872522|ref|NP_963290.1|      .................--------...........-...-.-.....................
gi|13899267|ref|NP_113626.1|      .................--------...........-...-.-.....................
gi|157688564|ref|NP_001099010.1|  .................--------...........-...-.-.....................
gi|18390333|ref|NP_569058.1|      .................QCLELLIQ...........A...G.F.....................
gi|4758156|ref|NP_004708.1|       .................EIVKYILD...........H...G.P.....................
gi|206725420|ref|NP_001128685.1|  .................--------...........-...-.-.....................
gi|206725415|ref|NP_631940.2|     .................--------...........-...-.-.....................
gi|24308163|ref|NP_061178.1|      .................--------...........-...-.-.....................
gi|17149832|ref|NP_476511.1|      .................--------...........-...-.-.....................
gi|74315348|ref|NP_542435.2|      .................--------...........-...-.-.....................
gi|74315350|ref|NP_061197.4|      .................--------...........-...-.-.....................
gi|74315352|ref|NP_542436.2|      .................--------...........-...-.-.....................
gi|74315354|ref|NP_542437.2|      .................--------...........-...-.-.....................
gi|21237786|ref|NP_055591.2|      .................--------...........-...-.-.....................
gi|124517699|ref|NP_689558.4|     .................ELEKEVRA...........G...Q.V.....................
gi|206725422|ref|NP_001128686.1|  .................--------...........-...-.-.....................
gi|17149830|ref|NP_476510.1|      .................--------...........-...-.-.....................
gi|17864094|ref|NP_064562.1|      .................--------...........-...-.-.....................
gi|54607077|ref|NP_075392.2|      .................--------...........-...-.-.....................
gi|31982881|ref|NP_078968.3|      .................----EILK...........R...G.C.....................
gi|20336214|ref|NP_037399.2|      .................--------...........-...-.-.....................
gi|57863304|ref|NP_056340.2|      .................--------...........-...-.-.....................
gi|304361757|ref|NP_001182027.1|  .................TSALLILE...........K...I.T.....................
gi|304361760|ref|NP_001182028.1|  .................TSALLILE...........K...I.T.....................
gi|313102995|ref|NP_001186195.1|  .................--------...........-...-.-.....................
gi|20127551|ref|NP_057197.2|      .................--------...........-...-.-.....................
gi|38683799|ref|NP_149112.1|      .................--------...........-...-.-.....................
gi|166795254|ref|NP_110443.3|     .................--------...........-...-.H.....................
gi|18496983|ref|NP_056341.1|      .................----EILR...........R...G.C.....................
gi|313851097|ref|NP_001186499.1|  .................----EILR...........R...G.C.....................
gi|155969701|ref|NP_919288.2|     .................DCVKFLVQ...........Ra..Q.L.....................
gi|30089932|ref|NP_821066.1|      .................--------...........-...-.-.....................
gi|156104878|ref|NP_055720.3|     .................--------...........-...-.-.....................
gi|294459971|ref|NP_001170902.1|  .................HYVELLVA...........Q...G.A.....................
gi|22547184|ref|NP_067638.3|      .................HYVELLVA...........Q...G.A.....................
gi|7661962|ref|NP_055585.1|       .................--------...........-...-.-.....................
gi|117956371|ref|NP_001071154.1|  .................--------...........-...-.-.....................
gi|95147559|ref|NP_787069.3|      .................--------...........-...-.-.....................
gi|16418357|ref|NP_443087.1|      .................--------...........-...-.-.....................
gi|170650694|ref|NP_001116244.1|  .................--------...........-...-.-.....................
gi|150378537|ref|NP_001092877.1|  .................--------...........-...-.-.....................
gi|80978934|ref|NP_055729.2|      .................--------...........-...-.-.....................
gi|5730102|ref|NP_004612.2|       .................EITELLLK...........K...E.N.....................
gi|80978930|ref|NP_001032208.1|   .................--------...........-...-.-.....................
gi|269315852|ref|NP_997237.2|     .................ELEAALHS...........H...Q.H.....................
gi|255982572|ref|NP_001157637.1|  .................KCVELLLS...........S...G.A.....................
gi|7705831|ref|NP_057199.1|       .................KCVELLLS...........S...G.A.....................
gi|148806877|ref|NP_597704.1|     .................--------...........-...-.-.....................
gi|156104893|ref|NP_597703.2|     .................--------...........-...-.-.....................
gi|117956373|ref|NP_001071153.1|  .................--------...........-...-.-.....................
gi|221136914|ref|NP_001137472.1|  .................--------...........-...-.-.....................
gi|166851846|ref|NP_001071133.2|  .................--------...........-...-.-.....................
gi|339275867|ref|NP_001229858.1|  .................EVVKECVQ...........R...E.P.....................
gi|90991702|ref|NP_078928.3|      .................AVVQELLE...........S...L.P.....................
gi|71274172|ref|NP_001025041.1|   .................--------...........-...-.-.....................
gi|22547180|ref|NP_671737.1|      .................HYVELLVA...........Q...G.A.....................
gi|4507687|ref|NP_003296.1|       .................EVTELLLK...........K...E.N.....................
gi|6912736|ref|NP_036603.1|       .................EIMELLLN...........H...S.V.....................
gi|110227613|ref|NP_114152.3|     .................VFTQLLIW...........Y...G.V.....................
gi|194733735|ref|NP_001124170.1|  .................EVTELLLK...........K...E.N.....................
gi|209863030|ref|NP_001129429.1|  .................ELIELLLS...........F...N.V.....................
gi|209863028|ref|NP_001129428.1|  .................ELIELLLS...........F...N.V.....................
gi|209863026|ref|NP_001129427.1|  .................ELIELLLS...........F...N.V.....................
gi|7706747|ref|NP_057263.1|       .................ELIELLLS...........F...N.V.....................
gi|209863024|ref|NP_003297.1|     .................ELIELLLS...........F...N.V.....................
gi|262399375|ref|NP_001161048.1|  .................EVTELLLK...........K...E.N.....................
gi|262399379|ref|NP_001161049.1|  .................EVTELLLK...........K...E.N.....................
gi|9966865|ref|NP_065122.1|       .................EVTELLLK...........K...E.N.....................
gi|25777624|ref|NP_742024.1|      .................ELVLYLLA...........N...G.A.....................
gi|54112401|ref|NP_056030.1|      .................--------...........-...-.-.....................
gi|157743267|ref|NP_001099046.1|  .................--------...........-...-.-.....................
gi|110815813|ref|NP_057460.3|     .................AAALFLAT...........N...G.A.....................
gi|269847874|ref|NP_073739.3|     .................--------...........-...-.-.....................
gi|75750531|ref|NP_060314.2|      .................RTIKLLLR...........R...G.A.....................
gi|7657265|ref|NP_056137.1|       .................--------...........-...-.-.....................
gi|75750529|ref|NP_057636.2|      .................WICRILKD...........N...F.A.....................
gi|257467636|ref|NP_055646.2|     .................--LGCLID...........S...G.A.....................
gi|222352179|ref|NP_001138435.1|  .................--------...........-...-.-.....................
gi|222352177|ref|NP_001138434.1|  .................--------...........-...-.-.....................
gi|222352175|ref|NP_001138433.1|  .................--------...........-...-.-.....................
gi|222352173|ref|NP_004998.3|     .................--------...........-...-.-.....................
gi|61742817|ref|NP_001013424.1|   .................--------...........-...-.-.....................
gi|239744064|ref|XP_001714838.2|  .................--------...........-...-.-.....................
gi|222352168|ref|NP_001138432.1|  .................LILKAFVN...........Y...S.V.....................
gi|29826341|ref|NP_055914.2|      .................--------...........-...-.-.....................
gi|284005535|ref|NP_001164637.1|  .................--------...........-...-.-.....................
gi|284005543|ref|NP_001164639.1|  .................--------...........-...-.-.....................
gi|284005537|ref|NP_001164638.1|  .................--------...........-...-.-.....................
gi|4507685|ref|NP_003295.1|       .................DILQLLLD...........Y...G.Cqklmeriq.............
gi|15042961|ref|NP_149417.1|      .................--------...........-...-.-.....................
gi|312839866|ref|NP_001186166.1|  .................--------...........-...-.-.....................
gi|312839869|ref|NP_001186167.1|  .................--------...........-...-.-.....................
gi|312839871|ref|NP_001186168.1|  .................--------...........-...-.-.....................
gi|312839873|ref|NP_001186169.1|  .................--------...........-...-.-.....................
gi|109150425|ref|NP_060559.2|     .................--------...........-...-.-.....................
gi|109150435|ref|NP_001035869.1|  .................--------...........-...-.-.....................
gi|257467636|ref|NP_055646.2|     .................--------...........-...-.-.....................
gi|294459965|ref|NP_001170899.1|  .................--------...........-...-.-.....................
gi|209863032|ref|NP_001129430.1|  .................ELIELLLS...........F...N.V.....................
gi|148664230|ref|NP_055929.1|     .................DVVNVLSS...........H...H.L.....................
gi|114842396|ref|NP_694960.2|     .................--------...........-...-.-.....................
gi|294459977|ref|NP_001170904.1|  .................--------...........-...-.-.....................
gi|22748713|ref|NP_689539.1|      .................--------...........-...-.-.....................
gi|224465235|ref|NP_001138999.1|  .................--------...........-...-.-.....................
gi|98985804|ref|NP_478104.2|      .................--------...........-...-.-.....................
gi|17981696|ref|NP_511042.1|      .................--------...........-...-.-.....................
gi|260763963|ref|NP_001120979.2|  .................--------...........-...-.-.....................
gi|27477049|ref|NP_543144.1|      .................--------...........-...-.-.....................
gi|260763966|ref|NP_001077376.2|  .................--------...........-...-.-.....................
gi|260763960|ref|NP_060405.4|     .................--------...........-...-.-.....................
gi|75750531|ref|NP_060314.2|      .................--------...........-...-.-.....................


                                                                     100                           1
                                                                       |                            
d1s70b_                             ............................N.....INQ..............P....DNE..GWI
gi|21361135|ref|NP_002494.2|      ............................Gtey..MDL..............Q....NDL..GQT
gi|70780355|ref|NP_065210.2|      ............................S.....QAC..............M....TKK..GFT
gi|215598574|ref|NP_001135918.1|  ............................S.....QAC..............M....TKK..GFT
gi|70780353|ref|NP_065208.2|      ............................S.....QAC..............M....TKK..GFT
gi|70780359|ref|NP_065209.2|      ............................S.....QAC..............M....TKK..GFT
gi|70780357|ref|NP_000028.3|      ............................S.....QAC..............M....TKK..GFT
gi|325053666|ref|NP_001191332.1|  ............................S.....PDA..............A....GKS..GLT
gi|325053668|ref|NP_001191333.1|  ............................S.....PDA..............A....GKS..GLT
gi|32967601|ref|NP_066267.2|      ............................S.....PDA..............A....GKS..GLT
gi|188595682|ref|NP_001120965.1|  ............................A.....ADS..............A....GKN..GLT
gi|52426737|ref|NP_066187.2|      ............................A.....ADS..............A....GKN..GLT
gi|52426735|ref|NP_001139.3|      ............................A.....ADS..............A....GKN..GLT
gi|268607595|ref|NP_001161354.1|  ............................R.....TNE..............I....DND..GRI
gi|62988328|ref|NP_065070.1|      ............................R.....TNE..............I....DND..GRI
gi|48928017|ref|NP_001001716.1|   ............................-.....MDL..............Q....NDL..GQT
gi|70780353|ref|NP_065208.2|      ....................avllqndpN.....PDV..............L....SKT..GFT
gi|70780355|ref|NP_065210.2|      ....................avllqndpN.....PDV..............L....SKT..GFT
gi|70780359|ref|NP_065209.2|      ....................avllqndpN.....PDV..............L....SKT..GFT
gi|70780357|ref|NP_000028.3|      ....................avllqndpN.....PDV..............L....SKT..GFT
gi|215598574|ref|NP_001135918.1|  ....................avllqndpN.....PDV..............L....SKT..GFT
gi|325053668|ref|NP_001191333.1|  ............................A.....VDF..............T....ARN..DIT
gi|32967601|ref|NP_066267.2|      ............................A.....VDF..............T....ARN..DIT
gi|304434687|ref|NP_710181.2|     ............................N.....INA..............F....DKK..DRR
gi|30425444|ref|NP_848605.1|      ............................C.....VDA..............Q....ERE..GWT
gi|304361757|ref|NP_001182027.1|  ............................I.....VNQ..............K....NEK..GFT
gi|304361760|ref|NP_001182028.1|  ............................I.....VNQ..............K....NEK..GFT
gi|46519151|ref|NP_060448.1|      ............................G.....INT..............Hs...NEF..KES
gi|46519154|ref|NP_078944.2|      ............................G.....INT..............Hs...NEF..KES
gi|157743284|ref|NP_775866.2|     ............................D.....LGC..............K....DRK..GYG
gi|55741641|ref|NP_065789.1|      ............................N.....PSV..............T....GLY..SVY
gi|10863929|ref|NP_066956.1|      ............................D.....VNE..............C....DFY..GFT
gi|308044526|ref|NP_001183959.1|  ............................N.....IED..............H....NEN..GHT
gi|41327754|ref|NP_065690.2|      ............................S.....VNE..............V....DFE..GRT
gi|38683816|ref|NP_942592.1|      ............................N.....KEH..............R....NVS..DYT
gi|38683807|ref|NP_115593.3|      ............................N.....KEH..............R....NVS..DYT
gi|304434690|ref|NP_001182073.1|  ............................D.....VNA..............R....DKN..WQT
gi|46519147|ref|NP_060217.1|      ............................N.....LEE..............V....NDE..GYT
gi|37620163|ref|NP_065741.3|      ............................N.....LEE..............V....NDE..GYT
gi|304361757|ref|NP_001182027.1|  ............................A.....VDI..............Q....DGN..GQT
gi|304361760|ref|NP_001182028.1|  ............................A.....VDI..............Q....DGN..GQT
gi|37620163|ref|NP_065741.3|      ............................E.....INS..............Rtg..SKL..GIS
gi|46519147|ref|NP_060217.1|      ............................E.....INS..............Rtg..SKL..GIS
gi|68131557|ref|NP_056014.2|      ............................D.....VNA..............R....DKN..WQT
gi|96975023|ref|NP_874362.3|      ............................D.....HNV..............K....DKE..GNT
gi|10092619|ref|NP_065390.1|      ............................D.....PEL..............R....DFR..GNT
gi|38683816|ref|NP_942592.1|      ............................S.....IED..............H....NEN..GHT
gi|38683807|ref|NP_115593.3|      ............................S.....IED..............H....NEN..GHT
gi|157739945|ref|NP_079461.2|     aaasmgyteivsylldlpekdeeeveraQ.....INS..............F....DSLw.GET
gi|18252778|ref|NP_057234.2|      ............................E.....PDI..............S....NKS..RET
gi|89363047|ref|NP_004929.2|      ............................N.....PNI..............Q....DKE..EET
gi|321117514|ref|NP_001189358.1|  ............................E.....PDI..............S....NKS..RET
gi|223634006|ref|NP_001138682.1|  ............................S.....AAA..............R....SGT..GLT
gi|341914599|ref|XP_001714535.3|  ............................D.....LNQ..............P....DEK..GRK
gi|341915319|ref|XP_001128459.4|  ............................D.....LNQ..............P....DEK..GRK
gi|34304379|ref|NP_899068.1|      ..............ddvlrtmlslksdiD.....INM..............A....DKY..GGT
gi|225543463|ref|NP_001139381.1|  .....aaasmghssvvqcllgmekehevE.....VNG..............T....DTLw.GET
gi|34304381|ref|NP_055240.2|      ..............ddvlrtmlslksdiD.....INM..............A....DKY..GGT
gi|225543461|ref|NP_203752.2|     .....aaasmghssvvqcllgmekehevE.....VNG..............T....DTLw.GET
gi|325053666|ref|NP_001191332.1|  ............................K.....IDA..............K....TRD..GLT
gi|68131557|ref|NP_056014.2|      ............................K.....CLL..............R....DSR..GRT
gi|52426735|ref|NP_001139.3|      ............................Q.....IDA..............K....TRD..GLT
gi|4506217|ref|NP_002805.1|       ............................P.....VND..............K....DDA..GWS
gi|188595682|ref|NP_001120965.1|  ............................Q.....IDA..............K....TRD..GLT
gi|52426737|ref|NP_066187.2|      ............................Q.....IDA..............K....TRD..GLT
gi|224465233|ref|NP_079033.4|     ............................L.....VDP..............K....DAE..GST
gi|164664508|ref|NP_005169.2|     ............................S.....PMA..............L....DRH..GQT
gi|7705748|ref|NP_057062.1|       ............................D.....VNV..............S....GEV..GDR
gi|313569861|ref|NP_001186256.1|  ............................D.....VNV..............S....GEV..GDR
gi|163914396|ref|NP_001106279.1|  ............................D.....VNV..............S....GEV..GDR
gi|87239981|ref|NP_003738.2|      ............................K.....MNA..............L....DTL..GQT
gi|13376842|ref|NP_079511.1|      ............................K.....VNA..............L....DNL..GQT
gi|7705831|ref|NP_057199.1|       ............................D.....PNA..............T....TLE..ETT
gi|255982572|ref|NP_001157637.1|  ............................D.....PNA..............T....TLE..ETT
gi|338797777|ref|NP_001229742.1|  ............................A.....LDR..............Q....DKD..GNT
gi|338797775|ref|NP_055757.3|     ............................A.....LDR..............Q....DKD..GNT
gi|338797766|ref|NP_001229738.1|  ............................A.....LDR..............Q....DKD..GNT
gi|338797770|ref|NP_001229740.1|  ............................A.....LDR..............Q....DKD..GNT
gi|206597522|ref|NP_001128663.1|  ............................-.....---..............-....---..---
gi|4502249|ref|NP_003878.1|       ............................-.....---..............-....---..---
gi|304434690|ref|NP_001182073.1|  ............................S.....ILC..............K....DSR..GRT
gi|157743284|ref|NP_775866.2|     ............................F.....VLC..............R....DFK..GRT
gi|46094081|ref|NP_060952.2|      ............................-.....---..............-....---..---
gi|13376842|ref|NP_079511.1|      ............................D.....PNA..............R....DNW..NYT
gi|87239981|ref|NP_003738.2|      ............................D.....PNA..............R....DNW..NYT
gi|156142197|ref|NP_006700.3|     ............................C.....VYS..............K....EED..GST
gi|156142199|ref|NP_079532.5|     ............................C.....VYS..............K....EED..GST
gi|92087060|ref|NP_563616.3|      ............................N.....VHL..............R....DGF..GVT
gi|70995267|ref|NP_775776.2|      ............................S.....TEF..............R....TKD..GGT
gi|219842212|ref|NP_001137357.1|  ............................N.....INQ..............P....DNE..GWI
gi|4505317|ref|NP_002471.1|       ............................N.....INQ..............P....DNE..GWI
gi|116534990|ref|NP_015628.2|     ............................D.....VNL..............E....GEN..GNT
gi|282394038|ref|NP_001164160.1|  ............................R.....ADA..............I....NST..QST
gi|282394032|ref|NP_001164157.1|  ............................R.....ADA..............I....NST..QST
gi|282394030|ref|NP_543151.2|     ............................R.....ADA..............I....NST..QST
gi|282394036|ref|NP_001164159.1|  ............................R.....ADA..............I....NST..QST
gi|282394034|ref|NP_001164158.1|  ............................R.....ADA..............I....NST..QST
gi|58331111|ref|NP_061919.1|      ............................A.....VDC..............L....KKA..DWT
gi|58331113|ref|NP_001009941.1|   ............................A.....VDC..............L....KKA..DWT
gi|268607595|ref|NP_001161354.1|  ............................D.....LEI..............E....DAH..GHT
gi|62988328|ref|NP_065070.1|      ............................D.....LEI..............E....DAH..GHT
gi|221307473|ref|NP_001137250.1|  ............................-.....---..............-....---..---
gi|19923540|ref|NP_060177.2|      ............................-.....---..............-....---..---
gi|140161500|ref|NP_056060.2|     ............................Shtr..VNE..............Q....NND..NET
gi|224809478|ref|NP_001138997.1|  ............................D.....VTA..............Q....DTT..GHS
gi|224809468|ref|NP_056392.2|     ............................D.....VTA..............Q....DTT..GHS
gi|224809470|ref|NP_001138992.1|  ............................D.....VTA..............Q....DTT..GHS
gi|224809472|ref|NP_001138993.1|  ............................D.....VTA..............Q....DTT..GHS
gi|224809474|ref|NP_001138994.1|  ............................D.....VTA..............Q....DTT..GHS
gi|18079216|ref|NP_065815.1|      ............................A.....VNI..............P....SDE..GHI
gi|224809476|ref|NP_001138995.1|  ............................D.....VTA..............Q....DTT..GHS
gi|217416347|ref|NP_065804.2|     ............................A.....VNA..............A....SLD..GQI
gi|341915690|ref|XP_003403588.1|  ............................Q.....LNV..............L....DNK..KRT
gi|239745058|ref|XP_002343353.1|  ............................Q.....LNV..............L....DNK..KRT
gi|341915688|ref|XP_003403587.1|  ............................Q.....LNV..............L....DNK..KRT
gi|310118968|ref|XP_003118905.1|  ............................E.....LNL..............C....DRE..DRT
gi|30348954|ref|NP_065825.1|      ............................D.....LNA..............R....NKR..RQT
gi|310118966|ref|XP_001717815.3|  ............................E.....LNL..............C....DRE..DRT
gi|71274109|ref|NP_004547.2|      ............................S.....RAL..............Q....DRH..GDT
gi|110431370|ref|NP_113663.2|     ............................D.....PTA..............A....TDM..GAL
gi|256222430|ref|NP_079466.3|     ............................E.....LNL..............C....DRE..DRT
gi|28626517|ref|NP_056383.1|      ............................N.....VNA..............K....DNE..LWT
gi|53828703|ref|NP_001005365.2|   ............................Q.....LHV..............F....DSK..KRT
gi|239747114|ref|XP_002343914.1|  ............................Q.....LNV..............L....DNK..KRT
gi|153792284|ref|NP_778146.2|     ............................Q.....LNV..............L....DNK..KRT
gi|52856434|ref|NP_001005356.1|   ............................Q.....LNI..............L....DNK..KRT
gi|50511945|ref|NP_690001.3|      ............................Shsr..VNE..............Q....NNE..NET
gi|148596917|ref|NP_660278.3|     ............................D.....VNL..............K....NGS..GKD
gi|209977003|ref|NP_001129685.1|  ............................Q.....LNI..............L....DNK..KRT
gi|212549546|ref|NP_001131143.1|  ............................Q.....LNV..............L....DNK..KRT
gi|256222280|ref|NP_001157787.1|  ............................E.....LNL..............C....DRE..DRT
gi|224282147|ref|NP_001138914.1|  ............................Q.....LNI..............L....DNK..KRT
gi|259155302|ref|NP_001158884.1|  ............................D.....LSL..............L....DRL..GNS
gi|121582655|ref|NP_653299.3|     ............................D.....INS..............K....NED..GST
gi|68131557|ref|NP_056014.2|      ............................D.....TAK..............R....GIH..GMF
gi|34577122|ref|NP_003989.2|      ............................D.....LSL..............L....DRL..GNS
gi|153791352|ref|NP_001093241.1|  ............................Q.....LNV..............L....DNK..KRT
gi|103471993|ref|NP_056151.2|     ............................I.....VDQ..............L....GGDl.NST
gi|134133226|ref|NP_001077007.1|  ............................Q.....LNV..............L....DNK..KRT
gi|268607514|ref|NP_001161330.1|  ............................N.....VNQ..............Q....DNE..GWT
gi|268607512|ref|NP_001161329.1|  ............................N.....VNQ..............Q....DNE..GWT
gi|30089994|ref|NP_078984.2|      ............................Rsdi..INA..............K....SND..GWT
gi|22208957|ref|NP_078977.2|      ............................Q.....VDA..............R....NID..GST
gi|22208951|ref|NP_665862.1|      ............................N.....VNG..............S....HSMc.GWN
gi|320202950|ref|NP_001188894.1|  ............................N.....VNG..............S....HSMc.GWN
gi|37620163|ref|NP_065741.3|      ............................D.....VNS..............Q....SAT..GNT
gi|46519147|ref|NP_060217.1|      ............................D.....VNS..............Q....SAT..GNT
gi|38176283|ref|NP_937886.1|      ............................Rsdi..INA..............K....SND..GWT
gi|88953571|ref|XP_933678.1|      ............................Q.....LNV..............L....DNK..KRT
gi|113413200|ref|XP_934799.2|     ............................Q.....LNV..............L....DNK..KRT
gi|268607506|ref|NP_002472.2|     ............................N.....VNQ..............Q....DNE..GWT
gi|118150656|ref|NP_062618.2|     ............................K.....INV..............R....DSE..NKS
gi|38683816|ref|NP_942592.1|      ............................D.....IEL..............G....---..CST
gi|38683807|ref|NP_115593.3|      ............................D.....IEL..............G....---..CST
gi|304434690|ref|NP_001182073.1|  ............................E.....IDC..............V....DKD..GNT
gi|215598806|ref|NP_543147.2|     ............................D.....PNI..............A....DQD..GKR
gi|52486194|ref|NP_003551.2|      ............................G.....LNQ..............V....NNQ..GLT
gi|294337038|ref|NP_001135932.2|  ............................D.....PNI..............A....DQD..GKR
gi|294337037|ref|NP_001135931.2|  ............................D.....PNI..............A....DQD..GKR
gi|116875852|ref|NP_065822.2|     ............................D.....VNI..............C....NNE..GLT
gi|117320527|ref|NP_002493.3|     ............................D.....PAL..............L....DRH..GDS
gi|117320540|ref|NP_001070961.1|  ............................D.....PAL..............L....DRH..GDS
gi|117320531|ref|NP_001070962.1|  ............................D.....PAL..............L....DRH..GDS
gi|313760592|ref|NP_001186491.1|  ............................G.....LNQ..............V....NNQ..GLT
gi|52486251|ref|NP_001004426.1|   ............................G.....LNQ..............V....NNQ..GLT
gi|16975496|ref|NP_219499.1|      ............................Q.....VNA..............A....DKN..GFT
gi|52426737|ref|NP_066187.2|      ............................N.....INA..............Q....SQN..GFT
gi|341914805|ref|XP_003403867.1|  ............................Q.....INI..............C....DRL..NRT
gi|60115723|ref|NP_001012421.1|   ............................Q.....IDV..............C....DKE..NRT
gi|60460920|ref|NP_001012419.1|   ............................Q.....IDV..............C....DKE..NRT
gi|156104901|ref|NP_115626.2|     ............................Q.....IDV..............C....DKE..NRT
gi|341914105|ref|XP_001715780.3|  ............................Q.....LNL..............T....DSE..NRT
gi|149363679|ref|NP_001092275.1|  ............................Q.....IDV..............C....DKE..NRT
gi|188595682|ref|NP_001120965.1|  ............................N.....INA..............Q....SQN..GFT
gi|14249672|ref|NP_116291.1|      ............................N.....INA..............C....DSE..CWT
gi|341915999|ref|XP_292717.9|     ............................Q.....LNL..............T....DSE..NRT
gi|157743284|ref|NP_775866.2|     ............................D.....LRR..............R....DKF..GRT
gi|222537750|ref|NP_001138501.1|  ............................Q.....LNV..............L....DGE..GRT
gi|325053666|ref|NP_001191332.1|  ............................N.....VNA..............Q....SQN..GFT
gi|283549153|ref|NP_671728.2|     ............................Q.....IDI..............C....DRL..NRT
gi|155969701|ref|NP_919288.2|     ............................S.....VNR..............R....TRS..GAS
gi|312147315|ref|NP_001185879.1|  ............................N.....VNH..............Q....DED..FWT
gi|62177127|ref|NP_055826.1|      ............................N.....VNH..............Q....DED..FWT
gi|90186267|ref|NP_078945.2|      ............................K.....HNI..............P....DKN..GRL
gi|134244285|ref|NP_000426.2|     ............................Q.....LGA..............Rt...DRT..GET
gi|56550047|ref|NP_001008225.1|   ............................D.....ITT..............S....DTA..GRN
gi|67906195|ref|NP_775822.3|      ............................S.....VNS..............R....NHY..GWS
gi|267844887|ref|NP_001136205.2|  ............................N.....PNA..............K....NFE..GNS
gi|47933346|ref|NP_061901.2|      ............................V.....VDQ..............L....GGDl.NST
gi|110815813|ref|NP_057460.3|     ............................N.....VNA..............Q....DAE..GRT
gi|55770876|ref|NP_004548.3|      ............................C.....PQA..............H....TVGt.GET
gi|59850762|ref|NP_060473.2|      ............................D.....ITT..............S....DTA..GRN
gi|18254476|ref|NP_543150.1|      ............................N.....VNA..............I....TID..GVT
gi|310114187|ref|XP_003119912.1|  ............................E.....LNL..............C....DRE..DRT
gi|148833508|ref|NP_060087.3|     ............................Sl....HNQ..............T....DRT..GET
gi|7657265|ref|NP_056137.1|       ............................N.....VNH..............T....TVT..NST
gi|34304379|ref|NP_899068.1|      ............................N.....WMQ..............K....DLE..EMT
gi|34304381|ref|NP_055240.2|      ............................N.....WMQ..............K....DLE..EMT
gi|38327522|ref|NP_055206.2|      ............................N.....PDV..............C....DEY..KRT
gi|115495445|ref|NP_443723.2|     ............................Q.....LDV..............L....DGE..HRT
gi|17981699|ref|NP_523240.1|      ............................-.....---..............-....---..---
gi|4502751|ref|NP_001253.1|       ............................-.....---..............-....---..---
gi|24041035|ref|NP_077719.2|      ............................S.....LQA..............Qt...DRT..GEM
gi|17864094|ref|NP_064562.1|      ............................S.....VNN..............T....TLT..NST
gi|42734375|ref|NP_597707.1|      ............................D.....LNK..............K....NGG..GWT
gi|13443014|ref|NP_076992.1|      ............................Q.....VNG..............V....TAD..WHT
gi|271398201|ref|NP_001162003.1|  ............................Q.....VNG..............V....TAD..WHT
gi|60218887|ref|NP_001012428.1|   ............................H.....VNG..............V....TVH..GAT
gi|58331117|ref|NP_001009943.1|   ............................A.....VDC..............L....KKA..DWT
gi|72534772|ref|NP_001026909.1|   ............................Q.....VNG..............V....TAD..WHT
gi|18254474|ref|NP_543149.1|      ............................H.....VNG..............V....TVH..GAT
gi|338797779|ref|NP_001229743.1|  ............................D.....LDV..............Q....DDG..DQT
gi|116325987|ref|NP_872409.2|     ............................D.....PSV..............T....DKR..EWR
gi|17981702|ref|NP_524145.1|      ............................-.....---..............-....---..---
gi|4502753|ref|NP_001791.1|       ............................-.....---..............-....---..---
gi|126723390|ref|NP_597732.1|     ............................N.....VMS..............A....DGA..GYN
gi|38569426|ref|NP_071379.3|      ............................D.....MTI..............V....DNE..GKG
gi|38569428|ref|NP_942093.1|      ............................D.....MTI..............V....DNE..GKG
gi|24308163|ref|NP_061178.1|      ............................S.....VNR..............T....TRT..NST
gi|53832024|ref|NP_001005474.1|   ............................Q.....VNT..............T....DCW..GRT
gi|13899229|ref|NP_113607.1|      ............................Q.....VNT..............T....DCW..GRT
gi|14149716|ref|NP_060077.1|      ............................T.....VNQ..............A....DNE..GWT
gi|39812133|ref|NP_065082.2|      ............................T.....VDF..............Q....DRL..DCT
gi|17981694|ref|NP_004927.2|      ............................-.....---..............-....---..---
gi|116063534|ref|NP_115515.2|     ............capaqkrlakvpasglG.....VNV..............T....SQD..GSS
gi|4502749|ref|NP_000068.1|       ............................-.....---..............-....---..---
gi|304376272|ref|NP_001182061.1|  ............................-.....---..............-....---..---
gi|32483404|ref|NP_852092.1|      ............................-.....---..............-....---..---
gi|8051599|ref|NP_057739.1|       ............................-.....---..............-....---..---
gi|8051597|ref|NP_002032.2|       ............................-.....---..............-....---..---
gi|8051595|ref|NP_057738.1|       ............................-.....---..............-....---..---
gi|8051593|ref|NP_005245.2|       ............................-.....---..............-....---..---
gi|41327752|ref|NP_659431.5|      ............................D.....PNA..............H....DKL..HRT
gi|120587025|ref|NP_057232.2|     ............................H.....IDF..............R....ARD..GMT
gi|24586688|ref|NP_543139.4|      ............................K.....ANV..............L....TEE..GTT
gi|110815813|ref|NP_057460.3|     ............................F.....VNA..............A....TLGa.QET
gi|22208964|ref|NP_665879.1|      ............................K.....LNC..............Y....SLS..GHT
gi|157743292|ref|NP_997721.2|     ............................D.....PDL..............L....SAE..GLA
gi|7706379|ref|NP_057200.1|       ............................K.....LNC..............Y....SLS..GHT
gi|217416350|ref|NP_001136115.1|  ............................A.....VNA..............A....SLD..GQI
gi|226817313|ref|NP_036441.2|     ............................H.....LDF..............R....AKD..GMT
gi|52426735|ref|NP_001139.3|      ............................N.....INA..............Q....SQN..GFT
gi|219842214|ref|NP_001137358.1|  ............................N.....INQ..............P....DNE..GWI
gi|13129098|ref|NP_077000.1|      ............................D.....VNC..............T....-HG..TLK
gi|21389427|ref|NP_653219.1|      ............................-.....---..............-....---..---
gi|271398185|ref|NP_001162002.1|  ............................Q.....VNG..............V....TAD..WHT
gi|122937241|ref|NP_001073889.1|  ............................H.....LDF..............R....TRD..GLT
gi|341915692|ref|XP_003403589.1|  ............................Q.....LNV..............L....DNK..KRT
gi|320202942|ref|NP_001188512.1|  ............................H.....VNG..............V....TVH..GAT
gi|116063534|ref|NP_115515.2|     ............................M.....VNA..............T....DYH..GAT
gi|18640738|ref|NP_570124.1|      ............................S.....VDS..............N....FQY..GWT
gi|50897294|ref|NP_001002920.1|   ............................Q.....LHV..............F....DSK..KRT
gi|116534990|ref|NP_015628.2|     ............................Dtrl..LNE..............G....DLH..GMT
gi|154354990|ref|NP_055730.2|     ............................Q.....LNV..............C....DNE..NRT
gi|341914820|ref|XP_003403870.1|  ............................Q.....IDV..............C....DKE..NRT
gi|19718741|ref|NP_542164.2|      ............................E.....VNV..............L....NDM..GDT
gi|23510377|ref|NP_694856.1|      ............................-.....INL..............A....DGN..GNT
gi|64464726|ref|NP_055973.2|      ............................-.....INL..............A....DGN..GNT
gi|28605137|ref|NP_736606.1|      ............................P.....VND..............K....DDA..GWS
gi|289629249|ref|NP_001166206.1|  ............................N.....VNA..............K....DNE..LWT
gi|13376842|ref|NP_079511.1|      ............................-.....---..............-....---..-DA
gi|87239981|ref|NP_003738.2|      ............................-.....---..............-....---..GDA
gi|41281709|ref|NP_640332.1|      ............................E.....PNA..............A....DHQ..GRS
gi|194018403|ref|NP_001123453.1|  ............................-.....---..............-....---..---
gi|41350198|ref|NP_060174.2|      ............................-.....---..............-....---..---
gi|169403957|ref|NP_079209.3|     ............................-.....---..............-....---..---
gi|169403959|ref|NP_001108588.1|  ............................-.....---..............-....---..---
gi|157504499|ref|NP_940873.2|     ............................-.....VNL..............A....DGN..GNT
gi|156142184|ref|NP_057550.3|     ............................K.....CDA..............Q....THG..GAT
gi|38569426|ref|NP_071379.3|      ............................-.....---..............-....---..---
gi|38569428|ref|NP_942093.1|      ............................-.....---..............-....---..---
gi|70995241|ref|NP_060134.2|      ............................N.....INK..............P....DCE..GET
gi|209969812|ref|NP_001129663.1|  ............................-.....VNI..............A....DSN..GNT
gi|258613875|ref|NP_056308.3|     ............................-.....VNI..............A....DSN..GNT
gi|12746412|ref|NP_075526.1|      ............................-.....---..............-....---..---
gi|320461689|ref|NP_569059.3|     ............................D.....VDS..............L....DVK..AQT
gi|4758606|ref|NP_004508.1|       ............................R.....INV..............M....NRG..DDT
gi|62420873|ref|NP_001014794.1|   ............................R.....INV..............M....NRG..DDT
gi|62420875|ref|NP_001014795.1|   ............................R.....INV..............M....NRG..DDT
gi|157266328|ref|NP_000456.2|     ............................-.....---..............-....---..---
gi|154091032|ref|NP_653191.2|     ............................N.....VNL..............K....NQK..ERT
gi|134948558|ref|NP_056023.3|     ............................-.....---..............-....---..---
gi|134948605|ref|NP_001077094.1|  ............................-.....---..............-....---..---
gi|323362985|ref|NP_001190985.1|  ............................-.....---..............-....---..---
gi|4506499|ref|NP_003712.1|       ............................D.....INI..............Y....DWN..GGT
gi|21956645|ref|NP_665807.1|      ............................-.....---..............-....---..---
gi|94721248|ref|NP_001035535.1|   ............................E.....VDL..............V....DVK..GQT
gi|156104862|ref|NP_859063.3|     ............................N.....VDH..............Q....NKA..GYT
gi|56676397|ref|NP_037407.4|      ............................-.....---..............-....---..---
gi|41055989|ref|NP_059990.2|      ............................-.....---..............-....---..---
gi|304434690|ref|NP_001182073.1|  ............................N.....PSI..............R....DKE..GYN
gi|19924156|ref|NP_604389.1|      ............................L.....VNK..............P....DER..GFT
gi|256574792|ref|NP_001157915.1|  ............................-.....---..............-....---..---
gi|20270347|ref|NP_620152.1|      ............................-.....---..............-....---..---
gi|31317252|ref|NP_065791.1|      ............................D.....VDM..............V....DKS..GWS
gi|320461543|ref|NP_001073933.2|  ............................D.....VNT..............R....DTD..GFS
gi|21314682|ref|NP_061116.2|      ............................ElvfepMTS..............E....LYE..GQT
gi|47933348|ref|NP_001001483.1|   ............................-.....---..............-....---..---
gi|267844887|ref|NP_001136205.2|  ............................D.....ANI..............P....KNS..GHL
gi|187608777|ref|NP_038460.4|     ............................A.....VDD..............Pggq.GCE..GIT
gi|34304383|ref|NP_775748.2|      ............................-.....---..............-....---..---
gi|256574784|ref|NP_001157912.1|  ............................D.....LER..............R....NAF..GFT
gi|8923516|ref|NP_060343.1|       ............................D.....VNR..............R....DRIh.ESS
gi|17505200|ref|NP_062815.2|      ............................ElvfepTTC..............E....AFA..GQT
gi|38257146|ref|NP_940683.1|      ............................D.....LLA..............T....DYQ..GNT
gi|321267560|ref|NP_001155907.2|  ............................-.....---..............-....-WN..DRT
gi|183396785|ref|NP_001116856.1|  ............................-.....---..............-....---..---
gi|183396783|ref|NP_001116855.1|  ............................-.....---..............-....---..---
gi|21071037|ref|NP_060215.4|      ............................-.....---..............-....---..---
gi|183396787|ref|NP_001116857.1|  ............................-.....---..............-....---..---
gi|299473797|ref|NP_001177408.1|  ............................A.....VNL..............R....DER..GRT
gi|284413734|ref|NP_653309.3|     ............................K.....VNQ..............RrfvtFSQ..GPT
gi|341915472|ref|XP_003403627.1|  ............................Q.....VDV..............L....DGE..NRT
gi|341915476|ref|XP_003403594.1|  ............................Q.....VDV..............L....DGE..NRT
gi|14150169|ref|NP_115736.1|      ............................-.....---..............-....---..---
gi|256574792|ref|NP_001157915.1|  ............................-.....---..............-....---..---
gi|67906195|ref|NP_775822.3|      ............................-.....---..............-....---..---
gi|28461129|ref|NP_064715.1|      ............................-.....---..............-....---..---
gi|166235148|ref|NP_036515.4|     ............................-.....---..............-....---..---
gi|148664246|ref|NP_665872.2|     ............................-.....---..............-....---..---
gi|76563940|ref|NP_005451.2|      ............................-.....---..............-....NTE..KLT
gi|257467559|ref|NP_001004441.2|  ............................D.....PNI..............Q....DKS..GKT
gi|226437606|ref|NP_001139813.1|  ............................D.....PNI..............Q....DKS..GKT
gi|188219549|ref|NP_115666.2|     ............................-.....---..............-....---..---
gi|13540606|ref|NP_110440.1|      ............................D.....VNA..............K....HRL..GWT
gi|89941470|ref|NP_001034977.1|   ............................-.....---..............-....---..---
gi|62953116|ref|NP_001017523.1|   ............................D.....LNVevvstphkypsvh.P....ETR..HWT
gi|4885643|ref|NP_005417.1|       ............................-.....---..............-....---..---
gi|112799849|ref|NP_001026855.2|  ............................-.....---..............-....---..---
gi|65786661|ref|NP_001018082.1|   ............................D.....LNVevvstphkypsvh.P....ETR..HWT
gi|56090539|ref|NP_001007534.1|   ............................-.....---..............-....---..---
gi|118498337|ref|NP_056197.2|     ............................D.....VNR..............-....-GQ..RSS
gi|187608516|ref|NP_036419.3|     ............................-.....---..............-....---..---
gi|194097375|ref|NP_872414.3|     ............................D.....LER..............R....DQR..GLT
gi|320202962|ref|NP_001189332.1|  ............................D.....VNR..............R....DRIh.ESS
gi|31581522|ref|NP_004903.2|      ............................N.....PNL..............L....NGQ..LSS
gi|37221182|ref|NP_919437.1|      ............................N.....PNL..............L....NGQ..LSS
gi|37221184|ref|NP_919438.1|      ............................N.....PNL..............L....NGQ..LSS
gi|37221187|ref|NP_919436.1|      ............................N.....PNL..............L....NGQ..LSS
gi|121114287|ref|NP_056131.2|     ............................N.....VNA..............A....DSD..GWT
gi|194097377|ref|NP_001123487.1|  ............................D.....LER..............R....DQR..GLT
gi|300796386|ref|NP_665803.2|     ............................N.....LDIqvpsnsprhpsih.P....DSR..HWT
gi|218563749|ref|NP_085152.2|     ............................-.....---..............-....---..---
gi|296179431|ref|NP_068765.3|     ............................N.....VNC..............S....AQD..GTR
gi|215820635|ref|NP_001135974.1|  ............................N.....VNS..............P....DSH..GWT
gi|63003907|ref|NP_006654.2|      ............................N.....VNS..............P....DSH..GWT
gi|168229256|ref|NP_689576.4|     ............................-.....---..............-....---..---
gi|148596953|ref|NP_061877.1|     ............................K.....LDQ..............-....---..---
gi|7661880|ref|NP_055531.1|       ............................-.....---..............-....---..---
gi|21735483|ref|NP_659505.1|      ............................E.....YTE..............E....AYE..GQT
gi|32171201|ref|NP_859077.1|      ............................-.....---..............-....---..---
gi|341915877|ref|XP_001134442.4|  ............................-.....---..............-....---..---
gi|75750529|ref|NP_057636.2|      ............................D.....PNL..............C....-CV..PMQ
gi|68131557|ref|NP_056014.2|      ............................-.....---..............-....---..---
gi|38348298|ref|NP_940895.1|      ............................D.....IEA..............L....NFR..EER
gi|319803120|ref|NP_001188386.1|  ............................D.....PNH..............R....CFD..GST
gi|57863263|ref|NP_938207.2|      ............................D.....PNH..............R....CFD..GST
gi|57863261|ref|NP_112562.3|      ............................D.....PNH..............R....CFD..GST
gi|341914329|ref|XP_001717391.3|  ............................-.....---..............-....---..---
gi|51972284|ref|NP_001004354.1|   ............................D.....IRL..............A....NRD..GWS
gi|41393573|ref|NP_054749.2|      ............................-.....---..............-....---..---
gi|146231998|ref|NP_001078923.1|  ............................-.....---..............-....---..---
gi|313102999|ref|NP_001186197.1|  ............................-.....---..............-....---..---
gi|41872507|ref|NP_003637.2|      ............................-.....---..............-....---..---
gi|313102997|ref|NP_001186196.1|  ............................-.....---..............-....---..---
gi|313103001|ref|NP_963291.2|     ............................-.....---..............-....---..---
gi|41872522|ref|NP_963290.1|      ............................-.....---..............-....---..---
gi|13899267|ref|NP_113626.1|      ............................-.....---..............-....---..---
gi|157688564|ref|NP_001099010.1|  ............................-.....---..............-....---..---
gi|18390333|ref|NP_569058.1|      ............................D.....VNFmldqrinkh.....Y....DDH..RKS
gi|4758156|ref|NP_004708.1|       ............................Sel...LDM..............A....DSEt.GET
gi|206725420|ref|NP_001128685.1|  ............................-.....---..............-....---..---
gi|206725415|ref|NP_631940.2|     ............................-.....---..............-....---..---
gi|24308163|ref|NP_061178.1|      ............................-.....---..............-....---..---
gi|17149832|ref|NP_476511.1|      ............................-.....---..............-....---..---
gi|74315348|ref|NP_542435.2|      ............................-.....---..............-....-YK..GQT
gi|74315350|ref|NP_061197.4|      ............................-.....---..............-....-YK..GQT
gi|74315352|ref|NP_542436.2|      ............................-.....---..............-....-YK..GQT
gi|74315354|ref|NP_542437.2|      ............................-.....---..............-....-YK..GQT
gi|21237786|ref|NP_055591.2|      ............................-.....---..............-....---..---
gi|124517699|ref|NP_689558.4|     ............................D.....IEQ..............L....DPR..GRT
gi|206725422|ref|NP_001128686.1|  ............................-.....---..............-....---..---
gi|17149830|ref|NP_476510.1|      ............................-.....---..............-....---..---
gi|17864094|ref|NP_064562.1|      ............................-.....---..............-....---..---
gi|54607077|ref|NP_075392.2|      ............................-.....---..............-....---..---
gi|31982881|ref|NP_078968.3|      ............................N.....VND..............R....DGLt.DMT
gi|20336214|ref|NP_037399.2|      ............................-.....---..............-....---..---
gi|57863304|ref|NP_056340.2|      ............................-.....---..............-....---..---
gi|304361757|ref|NP_001182027.1|  ............................Drnl..INA..............T....NAA..LQT
gi|304361760|ref|NP_001182028.1|  ............................Drnl..INA..............T....NAA..LQT
gi|313102995|ref|NP_001186195.1|  ............................-.....---..............-....---..---
gi|20127551|ref|NP_057197.2|      ............................-.....---..............-....--R..GHS
gi|38683799|ref|NP_149112.1|      ............................-.....---..............-....---..---
gi|166795254|ref|NP_110443.3|     ............................N.....IGQ..............K....DNH..GNT
gi|18496983|ref|NP_056341.1|      ............................H.....VND..............R....DGLt.DMT
gi|313851097|ref|NP_001186499.1|  ............................H.....VND..............R....DGLt.DMT
gi|155969701|ref|NP_919288.2|     ............................P.....GNQ..............R....AHN..GAT
gi|30089932|ref|NP_821066.1|      ............................-.....---..............-....---..---
gi|156104878|ref|NP_055720.3|     ............................-.....---..............-....---..---
gi|294459971|ref|NP_001170902.1|  ............................D.....VHAqargrffqpkdeggY....FYF..GEL
gi|22547184|ref|NP_067638.3|      ............................D.....VHAqargrffqpkdeggY....FYF..GEL
gi|7661962|ref|NP_055585.1|       ............................-.....---..............-....---..---
gi|117956371|ref|NP_001071154.1|  ............................-.....---..............-....---..---
gi|95147559|ref|NP_787069.3|      ............................-.....---..............-....---..---
gi|16418357|ref|NP_443087.1|      ............................-.....---..............-....---..---
gi|170650694|ref|NP_001116244.1|  ............................-.....---..............-....---..---
gi|150378537|ref|NP_001092877.1|  ............................-.....---..............-....---..---
gi|80978934|ref|NP_055729.2|      ............................-.....---..............-....---..---
gi|5730102|ref|NP_004612.2|       ............................L.....SRV..............G....D--..---
gi|80978930|ref|NP_001032208.1|   ............................-.....---..............-....---..---
gi|269315852|ref|NP_997237.2|     ............................D.....IEQ..............E....DPR..GRT
gi|255982572|ref|NP_001157637.1|  ............................D.....PDL..............Y....CNEdsWQL
gi|7705831|ref|NP_057199.1|       ............................D.....PDL..............Y....CNEdsWQL
gi|148806877|ref|NP_597704.1|     ............................-.....---..............-....---..---
gi|156104893|ref|NP_597703.2|     ............................-.....---..............-....---..---
gi|117956373|ref|NP_001071153.1|  ............................-.....---..............-....---..---
gi|221136914|ref|NP_001137472.1|  ............................-.....---..............-....---..---
gi|166851846|ref|NP_001071133.2|  ............................-.....---..............-....---..---
gi|339275867|ref|NP_001229858.1|  ............................-.....---..............-....-IC..GFT
gi|90991702|ref|NP_078928.3|      ............................G.....PCS..............P....QRL..LNW
gi|71274172|ref|NP_001025041.1|   ............................-.....---..............-....---..---
gi|22547180|ref|NP_671737.1|      ............................D.....VHAqargrffqpkdeggY....FYF..GEL
gi|4507687|ref|NP_003296.1|       ............................L.....ARI..............G....D--..---
gi|6912736|ref|NP_036603.1|       ............................Y.....VGD..............-....---..---
gi|110227613|ref|NP_114152.3|     ............................D.....VRS..............R....DAR..GLT
gi|194733735|ref|NP_001124170.1|  ............................L.....ARI..............G....D--..---
gi|209863030|ref|NP_001129429.1|  ............................Y.....VGD..............-....---..---
gi|209863028|ref|NP_001129428.1|  ............................Y.....VGD..............-....---..---
gi|209863026|ref|NP_001129427.1|  ............................Y.....VGD..............-....---..---
gi|7706747|ref|NP_057263.1|       ............................Y.....VGD..............-....---..---
gi|209863024|ref|NP_003297.1|     ............................Y.....VGD..............-....---..---
gi|262399375|ref|NP_001161048.1|  ............................L.....ARV..............G....D--..---
gi|262399379|ref|NP_001161049.1|  ............................L.....ARV..............G....D--..---
gi|9966865|ref|NP_065122.1|       ............................L.....ARV..............G....D--..---
gi|25777624|ref|NP_742024.1|      ............................R.....CEA..............N....TFD..GER
gi|54112401|ref|NP_056030.1|      ............................-.....---..............-....---..---
gi|157743267|ref|NP_001099046.1|  ............................-.....---..............-....---..---
gi|110815813|ref|NP_057460.3|     ............................H.....VNH..............R....NKW..GET
gi|269847874|ref|NP_073739.3|     ............................-.....---..............-....---..---
gi|75750531|ref|NP_060314.2|      ............................D.....PNL..............C....-CV..PMQ
gi|7657265|ref|NP_056137.1|       ............................-.....---..............-....---..---
gi|75750529|ref|NP_057636.2|      ............................S.....ADV..............A....DAK..GYT
gi|257467636|ref|NP_055646.2|     ............................L.....PDG..............L....QES..QER
gi|222352179|ref|NP_001138435.1|  ............................-.....---..............-....---..--P
gi|222352177|ref|NP_001138434.1|  ............................-.....---..............-....---..--P
gi|222352175|ref|NP_001138433.1|  ............................-.....---..............-....---..--P
gi|222352173|ref|NP_004998.3|     ............................-.....---..............-....---..--P
gi|61742817|ref|NP_001013424.1|   ............................-.....---..............-....---..---
gi|239744064|ref|XP_001714838.2|  ............................-.....---..............-....---..---
gi|222352168|ref|NP_001138432.1|  ............................Lc....LEC..............K....NAA..GQT
gi|29826341|ref|NP_055914.2|      ............................-.....---..............-....---..---
gi|284005535|ref|NP_001164637.1|  ............................-.....---..............-....---..---
gi|284005543|ref|NP_001164639.1|  ............................-.....---..............-....---..---
gi|284005537|ref|NP_001164638.1|  ............................-.....---..............-....---..---
gi|4507685|ref|NP_003295.1|       ............................N.....PEY..............S....TTM..DVA
gi|15042961|ref|NP_149417.1|      ............................-.....---..............-....---..---
gi|312839866|ref|NP_001186166.1|  ............................-.....---..............-....---..---
gi|312839869|ref|NP_001186167.1|  ............................-.....---..............-....---..---
gi|312839871|ref|NP_001186168.1|  ............................-.....---..............-....---..---
gi|312839873|ref|NP_001186169.1|  ............................-.....---..............-....---..---
gi|109150425|ref|NP_060559.2|     ............................-.....---..............-....---..---
gi|109150435|ref|NP_001035869.1|  ............................-.....---..............-....---..---
gi|257467636|ref|NP_055646.2|     ............................-.....---..............-....---..---
gi|294459965|ref|NP_001170899.1|  ............................-.....---..............-....---..GEL
gi|209863032|ref|NP_001129430.1|  ............................Y.....VGD..............-....---..---
gi|148664230|ref|NP_055929.1|     ............................Iv....KNS..............R....NKY..DKT
gi|114842396|ref|NP_694960.2|     ............................-.....---..............-....---..---
gi|294459977|ref|NP_001170904.1|  ............................-.....---..............-....---..GEL
gi|22748713|ref|NP_689539.1|      ............................-.....---..............-....---..---
gi|224465235|ref|NP_001138999.1|  ............................-.....---..............-....---..---
gi|98985804|ref|NP_478104.2|      ............................-.....---..............-....---..---
gi|17981696|ref|NP_511042.1|      ............................-.....---..............-....---..---
gi|260763963|ref|NP_001120979.2|  ............................-.....---..............-....---..---
gi|27477049|ref|NP_543144.1|      ............................-.....---..............-....---..---
gi|260763966|ref|NP_001077376.2|  ............................-.....---..............-....---..---
gi|260763960|ref|NP_060405.4|     ............................-.....---..............-....---..---
gi|75750531|ref|NP_060314.2|      ............................-.....---..............-....---..---


                                    10                      120                          130        
                                     |                        |                            |        
d1s70b_                             PLHAAASC..G..Y...........LDIAEYL..........I.SQ....G....A........
gi|21361135|ref|NP_002494.2|      ALHLAAIL..G..E...........TSTVEKL..........Y.AA....G....A........
gi|70780355|ref|NP_065210.2|      PLHVAAKY..G..K...........VRVAELL..........L.ER....D....A........
gi|215598574|ref|NP_001135918.1|  PLHVAAKY..G..K...........VRVAELL..........L.ER....D....A........
gi|70780353|ref|NP_065208.2|      PLHVAAKY..G..K...........VRVAELL..........L.ER....D....A........
gi|70780359|ref|NP_065209.2|      PLHVAAKY..G..K...........VRVAELL..........L.ER....D....A........
gi|70780357|ref|NP_000028.3|      PLHVAAKY..G..K...........VRVAELL..........L.ER....D....A........
gi|325053666|ref|NP_001191332.1|  PLHVAAHY..D..N...........QKVALLL..........L.DQ....G....A........
gi|325053668|ref|NP_001191333.1|  PLHVAAHY..D..N...........QKVALLL..........L.DQ....G....A........
gi|32967601|ref|NP_066267.2|      PLHVAAHY..D..N...........QKVALLL..........L.DQ....G....A........
gi|188595682|ref|NP_001120965.1|  PLHVAAHY..D..N...........QKVALLL..........L.EK....G....A........
gi|52426737|ref|NP_066187.2|      PLHVAAHY..D..N...........QKVALLL..........L.EK....G....A........
gi|52426735|ref|NP_001139.3|      PLHVAAHY..D..N...........QKVALLL..........L.EK....G....A........
gi|268607595|ref|NP_001161354.1|  PFILASQE..G..H...........YDCVQIL..........L.EN....K....S........
gi|62988328|ref|NP_065070.1|      PFILASQE..G..H...........YDCVQIL..........L.EN....K....S........
gi|48928017|ref|NP_001001716.1|   ALHLAAIL..G..E...........TSTVEKL..........Y.AA....G....A........
gi|70780353|ref|NP_065208.2|      PLHIAAHY..E..N...........LNVAQLL..........L.NR....G....A........
gi|70780355|ref|NP_065210.2|      PLHIAAHY..E..N...........LNVAQLL..........L.NR....G....A........
gi|70780359|ref|NP_065209.2|      PLHIAAHY..E..N...........LNVAQLL..........L.NR....G....A........
gi|70780357|ref|NP_000028.3|      PLHIAAHY..E..N...........LNVAQLL..........L.NR....G....A........
gi|215598574|ref|NP_001135918.1|  PLHIAAHY..E..N...........LNVAQLL..........L.NR....G....A........
gi|325053668|ref|NP_001191333.1|  PLHVASKR..G..N...........ANMVKLL..........L.DR....G....A........
gi|32967601|ref|NP_066267.2|      PLHVASKR..G..N...........ANMVKLL..........L.DR....G....A........
gi|304434687|ref|NP_710181.2|     ALHWAAYM..G..H...........LDVVALL..........I.NH....G....A........
gi|30425444|ref|NP_848605.1|      PLHLAAQN..N..F...........ENVARLL..........V.SR....Q....A........
gi|304361757|ref|NP_001182027.1|  PLHFAAAS..T..Hg..........ALCLELL..........V.GN....G....A........
gi|304361760|ref|NP_001182028.1|  PLHFAAAS..T..Hg..........ALCLELL..........V.GN....G....A........
gi|46519151|ref|NP_060448.1|      ALTLACYK..G..H...........LDMVRFL..........L.EA....G....A........
gi|46519154|ref|NP_078944.2|      ALTLACYK..G..H...........LDMVRFL..........L.EA....G....A........
gi|157743284|ref|NP_775866.2|     LLHTAAAS..G..Q...........IEVVKYL..........L.RM....G....A........
gi|55741641|ref|NP_065789.1|      PIIWAAGR..G..H...........ADIVHLL..........L.QN....G....A........
gi|10863929|ref|NP_066956.1|      AFMEAAVY..G..K...........VKALKFL..........Y.KR....G....A........
gi|308044526|ref|NP_001183959.1|  PLMEAASA..G..H...........VEVARVL..........L.DH....G....A........
gi|41327754|ref|NP_065690.2|      PMHVACQH..G..Q...........ENIVRIL..........L.RR....G....V........
gi|38683816|ref|NP_942592.1|      PLSLAASG..G..Y...........VNIIKIL..........L.NA....G....A........
gi|38683807|ref|NP_115593.3|      PLSLAASG..G..Y...........VNIIKIL..........L.NA....G....A........
gi|304434690|ref|NP_001182073.1|  PLHVAAAN..K..A...........VKCAEVI..........I.PL....L....S........
gi|46519147|ref|NP_060217.1|      PLMEAARE..G..H...........EEMVALL..........L.AQ....G....A........
gi|37620163|ref|NP_065741.3|      PLMEAARE..G..H...........EEMVALL..........L.AQ....G....A........
gi|304361757|ref|NP_001182027.1|  PLMLSVLN..G..H...........TDCVYSL..........L.NK....G....A........
gi|304361760|ref|NP_001182028.1|  PLMLSVLN..G..H...........TDCVYSL..........L.NK....G....A........
gi|37620163|ref|NP_065741.3|      PLMLAAMN..G..H...........VPAVKLL..........L.DM....G....S........
gi|46519147|ref|NP_060217.1|      PLMLAAMN..G..H...........VPAVKLL..........L.DM....G....S........
gi|68131557|ref|NP_056014.2|      PLHIAAAN..K..A...........VKCAEAL..........V.PL....L....S........
gi|96975023|ref|NP_874362.3|      ALHLAAGR..G..H...........MAVLQRL..........V.DI....G....L........
gi|10092619|ref|NP_065390.1|      PLHLACEQ..G..C...........LASVGVL..........T.QS....C....T........
gi|38683816|ref|NP_942592.1|      PLMEAGSA..G..H...........VEVARLL..........L.EN....G....A........
gi|38683807|ref|NP_115593.3|      PLMEAGSA..G..H...........VEVARLL..........L.EN....G....A........
gi|157739945|ref|NP_079461.2|     ALTAAAGR..G..K...........LEVCRLL..........L.EQ....G....A........
gi|18252778|ref|NP_057234.2|      PLYKACER..K..N...........AEAVKIL..........V.QH....N....A........
gi|89363047|ref|NP_004929.2|      PLHCAAWH..G..Y...........YSVAKAL..........C.EA....G....C........
gi|321117514|ref|NP_001189358.1|  PLYKACER..K..N...........AEAVKIL..........V.QH....N....A........
gi|223634006|ref|NP_001138682.1|  PLHWAAAL..G..H...........TLLAARL..........L.EApgpgP....A........
gi|341914599|ref|XP_001714535.3|  PFLLAAER..G..H...........VEMIEKL..........T.FL....N....L........
gi|341915319|ref|XP_001128459.4|  PFLLAAER..G..H...........VEMIEKL..........T.FL....N....L........
gi|34304379|ref|NP_899068.1|      ALHAAALS..G..H...........VSTVKLL..........L.EN....N....A........
gi|225543463|ref|NP_001139381.1|  ALTAAAGR..G..K...........LEVCELL..........L.GH....G....A........
gi|34304381|ref|NP_055240.2|      ALHAAALS..G..H...........VSTVKLL..........L.EN....N....A........
gi|225543461|ref|NP_203752.2|     ALTAAAGR..G..K...........LEVCELL..........L.GH....G....A........
gi|325053666|ref|NP_001191332.1|  PLHCGARS..G..H...........EQVVEML..........L.DR....A....A........
gi|68131557|ref|NP_056014.2|      PIHLSAAC..G..H...........IGVLGAL..........L.QSaasmD....A........
gi|52426735|ref|NP_001139.3|      PLHCAARS..G..H...........DQVVELL..........L.ER....G....A........
gi|4506217|ref|NP_002805.1|       PLHIAASA..G..R...........DEIVKAL..........L.GK....G....A........
gi|188595682|ref|NP_001120965.1|  PLHCAARS..G..H...........DQVVELL..........L.ER....G....A........
gi|52426737|ref|NP_066187.2|      PLHCAARS..G..H...........DQVVELL..........L.ER....G....A........
gi|224465233|ref|NP_079033.4|     CLHLAAKK..G..H...........YEVVQYL..........L.SN....Gq...M........
gi|164664508|ref|NP_005169.2|     AAHLACEH..R..S...........PTCLRAL..........L.DSaapgT....L........
gi|7705748|ref|NP_057062.1|       PLHLASAK..G..F...........LNIAKLL..........M.EE....Gsk..A........
gi|313569861|ref|NP_001186256.1|  PLHLASAK..G..F...........LNIAKLL..........M.EE....Gsk..A........
gi|163914396|ref|NP_001106279.1|  PLHLASAK..G..F...........LNIAKLL..........M.EE....Gsk..A........
gi|87239981|ref|NP_003738.2|      ALHRAALA..G..H...........LQTCRLL..........L.SY....G....S........
gi|13376842|ref|NP_079511.1|      SLHRAAYC..G..H...........LQTCRLL..........L.SY....G....C........
gi|7705831|ref|NP_057199.1|       PLFLAVEN..G..Q...........IDVLRLL..........L.QH....G....A........
gi|255982572|ref|NP_001157637.1|  PLFLAVEN..G..Q...........IDVLRLL..........L.QH....G....A........
gi|338797777|ref|NP_001229742.1|  ALHEASWH..G..F...........SQSAKLL..........I.KA....G....A........
gi|338797775|ref|NP_055757.3|     ALHEASWH..G..F...........SQSAKLL..........I.KA....G....A........
gi|338797766|ref|NP_001229738.1|  ALHEASWH..G..F...........SQSAKLL..........I.KA....G....A........
gi|338797770|ref|NP_001229740.1|  ALHEASWH..G..F...........SQSAKLL..........I.KA....G....A........
gi|206597522|ref|NP_001128663.1|  --------..-..-...........-------..........-.--....-....-........
gi|4502249|ref|NP_003878.1|       --------..-..-...........-------..........-.--....-....-........
gi|304434690|ref|NP_001182073.1|  PLHYAAAR..G..H...........ATWLSEL..........L.QMals.E....E........
gi|157743284|ref|NP_775866.2|     PIHLASAC..G..H...........TAVLRTL..........L.QA....A....L........
gi|46094081|ref|NP_060952.2|      --------..-..-...........-------..........-.--....-....-........
gi|13376842|ref|NP_079511.1|      PLHEAAIK..G..K...........IDVCIVL..........L.QH....G....A........
gi|87239981|ref|NP_003738.2|      PLHEAAIK..G..K...........IDVCIVL..........L.QH....G....A........
gi|156142197|ref|NP_006700.3|     CLHHAAKI..G..N...........LEMVSLL..........L.ST....Gq...V........
gi|156142199|ref|NP_079532.5|     CLHHAAKI..G..N...........LEMVSLL..........L.ST....Gq...V........
gi|92087060|ref|NP_563616.3|      PLGVAAEY..G..H...........CDVLEHL..........I.HK....G....G........
gi|70995267|ref|NP_775776.2|      ALLAASQY..G..H...........MQVVETL..........L.KH....G....A........
gi|219842212|ref|NP_001137357.1|  PLHAAASC..G..Y...........LDIAEFL..........I.GQ....G....A........
gi|4505317|ref|NP_002471.1|       PLHAAASC..G..Y...........LDIAEFL..........I.GQ....G....A........
gi|116534990|ref|NP_015628.2|     AVIIACTT..N..N...........SEALQIL..........L.KK....G....A........
gi|282394038|ref|NP_001164160.1|  ALHVAVQR..G..F...........LEVVRAL..........C.ER....G....C........
gi|282394032|ref|NP_001164157.1|  ALHVAVQR..G..F...........LEVVRAL..........C.ER....G....C........
gi|282394030|ref|NP_543151.2|     ALHVAVQR..G..F...........LEVVRAL..........C.ER....G....C........
gi|282394036|ref|NP_001164159.1|  ALHVAVQR..G..F...........LEVVRAL..........C.ER....G....C........
gi|282394034|ref|NP_001164158.1|  ALHVAVQR..G..F...........LEVVRAL..........C.ER....G....C........
gi|58331111|ref|NP_061919.1|      PLMMACTR..K..N...........LGVIQEL..........V.EH....G....A........
gi|58331113|ref|NP_001009941.1|   PLMMACTR..K..N...........LGVIQEL..........V.EH....G....A........
gi|268607595|ref|NP_001161354.1|  PLTLAARQ..G..H...........TKVVNCL..........I.GC....G....A........
gi|62988328|ref|NP_065070.1|      PLTLAARQ..G..H...........TKVVNCL..........I.GC....G....A........
gi|221307473|ref|NP_001137250.1|  --------..-..-...........-------..........-.--....-....-........
gi|19923540|ref|NP_060177.2|      --------..-..-...........-------..........-.--....-....-........
gi|140161500|ref|NP_056060.2|     ALHCAAQY..G..H...........TEVVKVL..........L.EE....L....T........
gi|224809478|ref|NP_001138997.1|  ALHLAAKN..S..H...........HECIRKL..........L.QS....K....C........
gi|224809468|ref|NP_056392.2|     ALHLAAKN..S..H...........HECIRKL..........L.QS....K....C........
gi|224809470|ref|NP_001138992.1|  ALHLAAKN..S..H...........HECIRKL..........L.QS....K....C........
gi|224809472|ref|NP_001138993.1|  ALHLAAKN..S..H...........HECIRKL..........L.QS....K....C........
gi|224809474|ref|NP_001138994.1|  ALHLAAKN..S..H...........HECIRKL..........L.QS....K....C........
gi|18079216|ref|NP_065815.1|      PLHLAAQH..G..H...........YDVSEML..........L.QH....Q....S........
gi|224809476|ref|NP_001138995.1|  ALHLAAKN..S..H...........HECIRKL..........L.QS....K....C........
gi|217416347|ref|NP_065804.2|     PLHLAAQY..G..H...........YEVSEML..........L.QH....Q....S........
gi|341915690|ref|XP_003403588.1|  ALIKAVQC..Q..E...........DECVLML..........L.EH....G....A........
gi|239745058|ref|XP_002343353.1|  ALIKAVQC..Q..E...........DECVLML..........L.EH....G....A........
gi|341915688|ref|XP_003403587.1|  ALIKAVQC..Q..E...........DECVLML..........L.EH....G....A........
gi|310118968|ref|XP_003118905.1|  PLIKAVQL..R..Q...........EACATLL..........L.QN....G....A........
gi|30348954|ref|NP_065825.1|      PLHIAVNK..G..H...........LQVVKTL..........L.DF....G....C........
gi|310118966|ref|XP_001717815.3|  PLIKAVQL..R..Q...........EACATLL..........L.QN....G....A........
gi|71274109|ref|NP_004547.2|      ALHVACQR..Q..H...........LACARCLlegrpepgrgT.SH....S....L........
gi|110431370|ref|NP_113663.2|     PIHYAAAK..G..D...........FPSLRLL..........V.EHy...P....E........
gi|256222430|ref|NP_079466.3|     PLIKAVQL..R..Q...........EACATLL..........L.QN....G....A........
gi|28626517|ref|NP_056383.1|      PLHAAATC..G..H...........INLVKIL..........V.QY....G....A........
gi|53828703|ref|NP_001005365.2|   ALIKAVQC..Q..E...........DECALML..........L.QH....G....T........
gi|239747114|ref|XP_002343914.1|  ALIKAIQC..Q..E...........DECVLML..........L.EH....G....A........
gi|153792284|ref|NP_778146.2|     ALIKAIQC..Q..E...........DECVLML..........L.EH....G....A........
gi|52856434|ref|NP_001005356.1|   ALTKAVQC..R..E...........DECALML..........L.EH....G....T........
gi|50511945|ref|NP_690001.3|      ALHCAAQY..G..H...........SEVVAVL..........L.EE....L....T........
gi|148596917|ref|NP_660278.3|     SLMLACYA..G..H...........LDVVKYL..........R.RH....G....A........
gi|209977003|ref|NP_001129685.1|  ALTKAVQC..Q..E...........DECALML..........L.EH....G....T........
gi|212549546|ref|NP_001131143.1|  ALIKAVQC..Q..E...........DECVLML..........L.EH....G....A........
gi|256222280|ref|NP_001157787.1|  PLIKAVQL..R..Q...........EACATLL..........L.QN....G....A........
gi|224282147|ref|NP_001138914.1|  ALTKAVQC..Q..E...........DECALML..........L.EH....G....T........
gi|259155302|ref|NP_001158884.1|  VLHLAAKE..G..H...........DKVLSIL..........L.KH....Kk...A........
gi|121582655|ref|NP_653299.3|     ALHLATIS..C..Q...........PQCVKVL..........L.QH....G....A........
gi|68131557|ref|NP_056014.2|      PLHLAALS..G..F...........SDCCRKL..........L.SS....G....F........
gi|34577122|ref|NP_003989.2|      VLHLAAKE..G..H...........DKVLSIL..........L.KH....Kk...A........
gi|153791352|ref|NP_001093241.1|  ALIKAVQC..Q..E...........DECALML..........L.EH....G....T........
gi|103471993|ref|NP_056151.2|     PLHWATRQ..G..H...........LSMVVQL..........M.KY....G....A........
gi|134133226|ref|NP_001077007.1|  ALIKAVQC..Q..E...........DECALML..........L.EH....G....T........
gi|268607514|ref|NP_001161330.1|  PLHAAASC..G..Y...........LNIAEYF..........I.NH....G....A........
gi|268607512|ref|NP_001161329.1|  PLHAAASC..G..Y...........LNIAEYF..........I.NH....G....A........
gi|30089994|ref|NP_078984.2|      PLHVAAHY..G..R...........DSFVRLL..........L.EF....K....A........
gi|22208957|ref|NP_078977.2|      PLCDACAS..G..S...........IECVKLL..........L.SY....G....A........
gi|22208951|ref|NP_665862.1|      SLHQASFQ..E..N...........AEIIKLL..........L.RK....G....A........
gi|320202950|ref|NP_001188894.1|  SLHQASFQ..E..N...........AEIIKLL..........L.RK....G....A........
gi|37620163|ref|NP_065741.3|      ALTYACAG..G..F...........VDIVKVL..........L.NE....G....A........
gi|46519147|ref|NP_060217.1|      ALTYACAG..G..F...........VDIVKVL..........L.NE....G....A........
gi|38176283|ref|NP_937886.1|      PLHVAAHY..G..R...........DSFVRLL..........L.EF....K....A........
gi|88953571|ref|XP_933678.1|      ALTKAVQC..Q..E...........DECALML..........L.EH....G....T........
gi|113413200|ref|XP_934799.2|     ALTKAVQC..Q..E...........DECALML..........L.EH....G....T........
gi|268607506|ref|NP_002472.2|     PLHAAASC..G..Y...........LNIAEYF..........I.NH....G....A........
gi|118150656|ref|NP_062618.2|     PLIKAVQC..Q..N...........EDCATIL..........L.NF....G....A........
gi|38683816|ref|NP_942592.1|      PLMEAAQE..G..H...........LELVKYL..........L.AA....G....A........
gi|38683807|ref|NP_115593.3|      PLMEAAQE..G..H...........LELVKYL..........L.AA....G....A........
gi|304434690|ref|NP_001182073.1|  PLHVAARY..G..H...........ELLINTL..........I.TS....G....A........
gi|215598806|ref|NP_543147.2|     PLHLCRGP..G..T...........LECAELL..........L.RF....G....A........
gi|52486194|ref|NP_003551.2|      PLHLACQL..G..K...........QEMVRVL..........L.LC....N....A........
gi|294337038|ref|NP_001135932.2|  PLHLCRGP..G..T...........LECAELL..........L.RF....G....A........
gi|294337037|ref|NP_001135931.2|  PLHLCRGP..G..T...........LECAELL..........L.RF....G....A........
gi|116875852|ref|NP_065822.2|     AIHWLAVN..G..R...........TELLHDL..........V.QH....V....S........
gi|117320527|ref|NP_002493.3|     AMHLALRA..GagA...........PELLRAL..........L.QS....G....A........
gi|117320540|ref|NP_001070961.1|  AMHLALRA..GagA...........PELLRAL..........L.QS....G....A........
gi|117320531|ref|NP_001070962.1|  AMHLALRA..GagA...........PELLRAL..........L.QS....G....A........
gi|313760592|ref|NP_001186491.1|  PLHLACQL..G..K...........QEMVRVL..........L.LC....N....A........
gi|52486251|ref|NP_001004426.1|   PLHLACQL..G..K...........QEMVRVL..........L.LC....N....A........
gi|16975496|ref|NP_219499.1|      PLCAAAAQ..G..H...........FECVELL..........I.SY....D....A........
gi|52426737|ref|NP_066187.2|      PLYMAAQE..N..H...........IDVVKYL..........L.EN....G....A........
gi|341914805|ref|XP_003403867.1|  PLMKAVHC..Q..E...........EACAIIL..........L.KR....G....A........
gi|60115723|ref|NP_001012421.1|   PLIQAVHC..Q..E...........EACAVIL..........L.EH....G....A........
gi|60460920|ref|NP_001012419.1|   PLIQAVHC..Q..E...........EACAVIL..........L.EH....G....A........
gi|156104901|ref|NP_115626.2|     PLIQAVHC..Q..E...........EACAVIL..........L.EH....G....A........
gi|341914105|ref|XP_001715780.3|  ALIKAVQC..Q..E...........EVCASIL..........L.EH....G....A........
gi|149363679|ref|NP_001092275.1|  PLIQAVHC..Q..E...........EACAVIL..........L.EH....G....A........
gi|188595682|ref|NP_001120965.1|  PLYMAAQE..N..H...........IDVVKYL..........L.EN....G....A........
gi|14249672|ref|NP_116291.1|      PLHAAATC..G..H...........LHLVELL..........I.AS....G....A........
gi|341915999|ref|XP_292717.9|     ALIKAVQC..Q..E...........EVCASIL..........L.EH....G....A........
gi|157743284|ref|NP_775866.2|     PLHYAAAN..G..S...........YQCAVTL..........V.TA....G....A........
gi|222537750|ref|NP_001138501.1|  PLMKALQC..E..R...........EACANIL..........I.DA....G....A........
gi|325053666|ref|NP_001191332.1|  PLYMAAQE..N..H...........LEVVKFL..........L.DN....G....A........
gi|283549153|ref|NP_671728.2|     PLMKAVHS..Q..E...........EACAIVL..........L.EC....G....A........
gi|155969701|ref|NP_919288.2|     PLYLACQE..G..H...........LHLAQFL..........VkDC....G....A........
gi|312147315|ref|NP_001185879.1|  PMHIACAC..D..N...........PDIVLLL..........V.LA....G....A........
gi|62177127|ref|NP_055826.1|      PMHIACAC..D..N...........PDIVLLL..........V.LA....G....A........
gi|90186267|ref|NP_078945.2|      PLHAATAE..P..D...........MRLLTVL..........L.QQ....Sni..S........
gi|134244285|ref|NP_000426.2|     ALHLAARY..A..R...........ADAAKRL..........L.DA....G....A........
gi|56550047|ref|NP_001008225.1|   ALHLAAKY..G..H...........ALCLQKL..........L.QY....N....C........
gi|67906195|ref|NP_775822.3|      ALMQAARF..G..H...........VSVAHLL..........L.DH....G....A........
gi|267844887|ref|NP_001136205.2|  PLLAAVLR..D..C...........YDMAALL..........I.NY....G....A........
gi|47933346|ref|NP_061901.2|      PLHWAIRQ..G..H...........LPMVILL..........L.QH....G....A........
gi|110815813|ref|NP_057460.3|     PIHVAISS..Q..H...........GVIIQLL..........V.SHp...D....I........
gi|55770876|ref|NP_004548.3|      PLHLAARF..S..R...........PTAARRL..........L.EA....G....A........
gi|59850762|ref|NP_060473.2|      ALHLAAKY..G..H...........ALCLQKL..........L.QY....N....C........
gi|18254476|ref|NP_543150.1|      PLFNACSQ..G..S...........PSCAELL..........L.EY....G....A........
gi|310114187|ref|XP_003119912.1|  PLIKAVQL..R..Q...........EACATLL..........L.QN....G....A........
gi|148833508|ref|NP_060087.3|     ALHLAARY..S..R...........SDAAKRL..........L.EA....S....A........
gi|7657265|ref|NP_056137.1|       PLRAACFD..G..R...........LDIVKYL..........V.EN....N....A........
gi|34304379|ref|NP_899068.1|      PLHLTTRH..R..S...........PKCLALL..........L.KFma..P....G........
gi|34304381|ref|NP_055240.2|      PLHLTTRH..R..S...........PKCLALL..........L.KFma..P....G........
gi|38327522|ref|NP_055206.2|      ALHRACLE..G..H...........LAIVEKL..........M.EA....G....A........
gi|115495445|ref|NP_443723.2|     PLMKALQC..H..Q...........EACANIL..........I.DS....G....A........
gi|17981699|ref|NP_523240.1|      -LASAAAR..G..D...........LEQLTSL..........L.QN....N....V........
gi|4502751|ref|NP_001253.1|       -LASAAAR..G..D...........LEQLTSL..........L.QN....N....V........
gi|24041035|ref|NP_077719.2|      ALHLAARY..S..R...........ADAAKRL..........L.DA....G....A........
gi|17864094|ref|NP_064562.1|      PLRAACFD..G..H...........LEIVKYL..........V.EH....K....A........
gi|42734375|ref|NP_597707.1|      PLMYASYI..G..H...........DTIVHLL..........L.EA....G....V........
gi|13443014|ref|NP_076992.1|      PLFNACVS..G..S...........WDCVNLL..........L.QH....G....A........
gi|271398201|ref|NP_001162003.1|  PLFNACVS..G..S...........WDCVNLL..........L.QH....G....A........
gi|60218887|ref|NP_001012428.1|   PLFNACCS..G..S...........AACVNVL..........L.EF....G....A........
gi|58331117|ref|NP_001009943.1|   PLMMACTR..K..N...........LGVIQEL..........V.EH....G....A........
gi|72534772|ref|NP_001026909.1|   PLFNACVS..G..S...........WDCVNLL..........L.QH....G....A........
gi|18254474|ref|NP_543149.1|      PLFNACCS..G..S...........AACVNVL..........L.EF....G....A........
gi|338797779|ref|NP_001229743.1|  ALHRATVV..G..N...........TEIIAAL..........I.HE....G....C........
gi|116325987|ref|NP_872409.2|     PVHYAAFH..G..R...........LGCLQLL..........V.KW....G....C........
gi|17981702|ref|NP_524145.1|      --------..-..-...........-------..........-.--....-....V........
gi|4502753|ref|NP_001791.1|       --------..-..-...........-------..........-.--....-....V........
gi|126723390|ref|NP_597732.1|     ALHLAAKY..G..H...........PQCLKQL..........L.QA....S....C........
gi|38569426|ref|NP_071379.3|      VLFYCILPtkR..H...........YRCALIA..........L.EH....G....A........
gi|38569428|ref|NP_942093.1|      VLFYCILPtkR..H...........YRCALIA..........L.EH....G....A........
gi|24308163|ref|NP_061178.1|      PLRAACFD..G..H...........LEVVRYL..........VgEH....Q....A........
gi|53832024|ref|NP_001005474.1|   PLHVCAEK..G..H...........SQVLQAI..........Q.KGav..GsnqfV........
gi|13899229|ref|NP_113607.1|      PLHVCAEK..G..H...........SQVLQAI..........Q.KGav..GsnqfV........
gi|14149716|ref|NP_060077.1|      PLHVAASC..G..Y...........LDIARYL..........L.SH....G....A........
gi|39812133|ref|NP_065082.2|      AMHWACRG..G..H...........LEVVKLL..........Q.SH....G....-........
gi|17981694|ref|NP_004927.2|      --------..-..-...........-------..........-.--....-....-........
gi|116063534|ref|NP_115515.2|     PLHVAALH..G..R...........ADLIPLL..........L.KH....G....A........
gi|4502749|ref|NP_000068.1|       --------..-..-...........-------..........-.--....-....-........
gi|304376272|ref|NP_001182061.1|  --------..-..-...........-------..........-.--....-....-........
gi|32483404|ref|NP_852092.1|      -LLEAARA..G..Q...........DDEVRIL..........M.AN....G....A........
gi|8051599|ref|NP_057739.1|       -LLEAARA..G..Q...........DDEVRIL..........M.AN....G....A........
gi|8051597|ref|NP_002032.2|       -LLEAARA..G..Q...........DDEVRIL..........M.AN....G....A........
gi|8051595|ref|NP_057738.1|       -LLEAARA..G..Q...........DDEVRIL..........M.AN....G....A........
gi|8051593|ref|NP_005245.2|       -LLEAARA..G..Q...........DDEVRIL..........M.AN....G....A........
gi|41327752|ref|NP_659431.5|      ALHWACLK..G..H...........SQLVNKL..........L.VA....G....A........
gi|120587025|ref|NP_057232.2|     ALHKAACA..R..H...........CLALTAL..........L.DL....G....G........
gi|24586688|ref|NP_543139.4|      PLHLCTIP..E..S...........LQCAKLL..........L.EA....G....A........
gi|110815813|ref|NP_057460.3|     PLHLVALY..S..SkkhsadvmsemAQIAEAL..........L.QA....G....A........
gi|22208964|ref|NP_665879.1|      ALHFCTTP..S..S...........ILCAKQL..........V.WR....G....A........
gi|157743292|ref|NP_997721.2|     PLHLCRTA..A..S...........LGCAQAL..........L.EH....G....A........
gi|7706379|ref|NP_057200.1|       ALHFCTTP..S..S...........ILCAKQL..........V.WR....G....A........
gi|217416350|ref|NP_001136115.1|  PLHLAAQY..G..H...........YEVSEML..........L.QH....Q....S........
gi|226817313|ref|NP_036441.2|     ALHKAARA..R..N...........QVALKTL..........L.EL....G....A........
gi|52426735|ref|NP_001139.3|      PLYMAAQE..N..H...........IDVVKYL..........L.EN....G....A........
gi|219842214|ref|NP_001137358.1|  PLHAAASC..G..Y...........LDIAEFL..........I.GQ....G....A........
gi|13129098|ref|NP_077000.1|      PLHCACMV..S..D...........ADCVELL..........L.EK....G....A........
gi|21389427|ref|NP_653219.1|      -LLEAARK..G..Q...........DDEVRTL..........M.AN....G....A........
gi|271398185|ref|NP_001162002.1|  PLFNACVS..G..S...........WDCVNLL..........L.QH....G....A........
gi|122937241|ref|NP_001073889.1|  AVHCATRQ..R..N...........AAALTTL..........L.DL....G....A........
gi|341915692|ref|XP_003403589.1|  ALIKAVQC..Q..E...........DECVLML..........L.EH....G....A........
gi|320202942|ref|NP_001188512.1|  PLFNACCS..G..S...........AACVNVL..........L.EF....G....A........
gi|116063534|ref|NP_115515.2|     PLHLACQK..G..Y...........QSVTLLL..........L.HY....K....A........
gi|18640738|ref|NP_570124.1|      PLMYAASV..A..N...........AELVRVL..........L.DR....G....A........
gi|50897294|ref|NP_001002920.1|   ALIKAVQC..Q..E...........DECALML..........L.QH....G....T........
gi|116534990|ref|NP_015628.2|     PLHLAAKN..G..H...........DKVVQLL..........L.KK....G....A........
gi|154354990|ref|NP_055730.2|     ALMKAVQC..Q..E...........EKCATIL..........L.EH....G....A........
gi|341914820|ref|XP_003403870.1|  PLIQAVHC..Q..E...........EACAVIL..........L.EH....G....A........
gi|19718741|ref|NP_542164.2|      PLHRAAFT..G..R...........KELVMLL..........L.EY....N....A........
gi|23510377|ref|NP_694856.1|      ALHYSVSH..S..N...........FEIVKLL..........L.DA....Dv...C........
gi|64464726|ref|NP_055973.2|      ALHYSVSH..S..N...........FEIVKLL..........L.DA....Dv...C........
gi|28605137|ref|NP_736606.1|      PLHIAASA..G..R...........DEIVKAL..........L.GK....G....A........
gi|289629249|ref|NP_001166206.1|  PLHAAATC..G..H...........INLVKIL..........V.QY....G....A........
gi|13376842|ref|NP_079511.1|      ALLDAAKK..G..C...........LARVKKL..........S.SP....-....D........
gi|87239981|ref|NP_003738.2|      ALLDAAKK..G..C...........LARVQKL..........C.TPe...N....I........
gi|41281709|ref|NP_640332.1|      VLHVAATY..G..L...........PGVLLAV..........L.NS....Gvq..V........
gi|194018403|ref|NP_001123453.1|  ---KAAVE..G..K...........MKVIEKF..........L.AD....G....G........
gi|41350198|ref|NP_060174.2|      LLLWAAEK..N..R...........LTTVRRL..........LsEK....A....T........
gi|169403957|ref|NP_079209.3|     --------..-..-...........-------..........-.--....-....-........
gi|169403959|ref|NP_001108588.1|  --------..-..-...........-------..........-.--....-....-........
gi|157504499|ref|NP_940873.2|     ALHYSVSH..G..N...........LAIASLL..........L.DT....Ga...C........
gi|156142184|ref|NP_057550.3|     ALHRASYC..G..H...........TEIARLL..........L.SH....G....S........
gi|38569426|ref|NP_071379.3|      --------..G..D...........LASLKKA..........F.ES....G....I........
gi|38569428|ref|NP_942093.1|      --------..G..D...........LASLKKA..........F.ES....G....I........
gi|70995241|ref|NP_060134.2|      PIHKAARS..G..S...........LECISAL..........V.AN....G....A........
gi|209969812|ref|NP_001129663.1|  ALHYSVSH..A..N...........FPVVQQL..........L.DS....Gv...C........
gi|258613875|ref|NP_056308.3|     ALHYSVSH..A..N...........FPVVQQL..........L.DS....Gv...C........
gi|12746412|ref|NP_075526.1|      --------..-..-...........-------..........-.--....-....-........
gi|320461689|ref|NP_569059.3|     PLFTAVSH..G..H...........LDCVRVL..........L.EA....G....A........
gi|4758606|ref|NP_004508.1|       PLHLAASH..G..H...........RDIVQKL..........L.QY....K....A........
gi|62420873|ref|NP_001014794.1|   PLHLAASH..G..H...........RDIVQKL..........L.QY....K....A........
gi|62420875|ref|NP_001014795.1|   PLHLAASH..G..H...........RDIVQKL..........L.QY....K....A........
gi|157266328|ref|NP_000456.2|     --------..-..-...........-------..........-.--....-....-........
gi|154091032|ref|NP_653191.2|     CLHYAVKK..K..F...........TFIDYLL..........I.IL....-....-........
gi|134948558|ref|NP_056023.3|     --------..-..-...........-------..........-.--....-....-........
gi|134948605|ref|NP_001077094.1|  --------..-..-...........-------..........-.--....-....-........
gi|323362985|ref|NP_001190985.1|  --------..-..-...........-------..........-.--....-....-........
gi|4506499|ref|NP_003712.1|       PLLYAVRG..N..H...........VKCVEAL..........L.AR....G....A........
gi|21956645|ref|NP_665807.1|      --------..-..-...........-------..........-.--....-....-........
gi|94721248|ref|NP_001035535.1|   ALYVAVVN..G..H...........LESTQIL..........L.EA....G....A........
gi|156104862|ref|NP_859063.3|     AVMI----..-..-...........-------..........-.--....-....-........
gi|56676397|ref|NP_037407.4|      --------..-..-...........-------..........-.--....-....-........
gi|41055989|ref|NP_059990.2|      --------..-..-...........-------..........-.--....-....-........
gi|304434690|ref|NP_001182073.1|  SIHYAAAY..G..H...........RQCLELL..........L.ERt...N....S........
gi|19924156|ref|NP_604389.1|      PLIWASAF..G..E...........IETVRFL..........L.EW....G....A........
gi|256574792|ref|NP_001157915.1|  --------..-..-...........-------..........-.--....-....-........
gi|20270347|ref|NP_620152.1|      --------..-..-...........-------..........-.--....-....-........
gi|31317252|ref|NP_065791.1|      LLHKGIQR..G..D...........LFAATFL..........I.KN....G....A........
gi|320461543|ref|NP_001073933.2|  PLLLAVRG..R..H...........PGVIGLL..........R.EA....G....A........
gi|21314682|ref|NP_061116.2|      ALHIAVVN..Q..N...........MNLVRAL..........L.AR....R....A........
gi|47933348|ref|NP_001001483.1|   --------..-..-...........--MVILL..........L.QH....G....A........
gi|267844887|ref|NP_001136205.2|  PIHVAADR..G..H...........LLALKIL..........I.PV....-....T........
gi|187608777|ref|NP_038460.4|     PLHDALNC..G..H...........FEVAELL..........L.ER....G....A........
gi|34304383|ref|NP_775748.2|      --------..-..-...........-------..........-.--....-....-........
gi|256574784|ref|NP_001157912.1|  ALMKAAMQ..G..R...........TDCIRAL..........M.LA....G....A........
gi|8923516|ref|NP_060343.1|       PLDLASEE..Pe.R...........LPCLQRL..........L.DL....G....A........
gi|17505200|ref|NP_062815.2|      ALHIAVVN..Q..N...........VNLVRAL..........L.TR....R....A........
gi|38257146|ref|NP_940683.1|      ALHLC---..G..H...........VDTIQFL..........V.SN....G....L........
gi|321267560|ref|NP_001155907.2|  PLHWAAIK..G..Q...........MEVIRLL..........I.EY....G....A........
gi|183396785|ref|NP_001116856.1|  --------..-..-...........-------..........-.--....-....-........
gi|183396783|ref|NP_001116855.1|  --------..-..-...........-------..........-.--....-....-........
gi|21071037|ref|NP_060215.4|      --------..-..-...........-------..........-.--....-....-........
gi|183396787|ref|NP_001116857.1|  --------..-..-...........-------..........-.--....-....-........
gi|299473797|ref|NP_001177408.1|  ALSLACER..G..H...........LDAVQLL..........V.QF....S....G........
gi|284413734|ref|NP_653309.3|     PLHLAAQA..C..S...........LETTVCL..........L.CS....K....A........
gi|341915472|ref|XP_003403627.1|  PLMKALQC..Q..R...........EACANIL..........I.DS....G....A........
gi|341915476|ref|XP_003403594.1|  PLMKALQC..Q..R...........EACANIL..........I.DS....G....A........
gi|14150169|ref|NP_115736.1|      --------..-..-...........-------..........-.--....-....-........
gi|256574792|ref|NP_001157915.1|  --------..-..-...........-------..........-.--....-....-........
gi|67906195|ref|NP_775822.3|      --------..-..-...........-------..........-.--....-....-........
gi|28461129|ref|NP_064715.1|      --------..-..-...........-------..........-.--....-....-........
gi|166235148|ref|NP_036515.4|     --------..-..-...........-------..........-.--....-....-........
gi|148664246|ref|NP_665872.2|     --------..-..-...........-------..........-.--....-....-........
gi|76563940|ref|NP_005451.2|      PAGLAIKN..G..Q...........LECVRWM..........V.SE....T....E........
gi|257467559|ref|NP_001004441.2|  ALMHACLE..Ka.G...........PEVVSLL..........L.KS....G....A........
gi|226437606|ref|NP_001139813.1|  ALIHACIR..R..Ag..........GEVVSLL..........L.EN....G....A........
gi|188219549|ref|NP_115666.2|     --------..-..-...........-------..........-.--....-....-........
gi|13540606|ref|NP_110440.1|      ALMVAAIN..R..N...........NSVVQVL..........L.AA....G....A........
gi|89941470|ref|NP_001034977.1|   --------..-..-...........-------..........-.--....-....-........
gi|62953116|ref|NP_001017523.1|   ALTFAVLH..G..H...........IPVVQLL..........L.DA....G....A........
gi|4885643|ref|NP_005417.1|       --------..-..-...........-------..........-.--....-....-........
gi|112799849|ref|NP_001026855.2|  --------..-..-...........-------..........-.--....-....-........
gi|65786661|ref|NP_001018082.1|   ALTFAVLH..G..H...........IPVVQLL..........L.DA....G....A........
gi|56090539|ref|NP_001007534.1|   --------..-..-...........-------..........-.--....-....-........
gi|118498337|ref|NP_056197.2|     SLHYAACF..G..R...........PQVAKTL..........L.RH....G....A........
gi|187608516|ref|NP_036419.3|     --------..-..-...........-------..........-.--....-....-........
gi|194097375|ref|NP_872414.3|     ALMKAAMR..N..-...........-------..........-.--....-....-........
gi|320202962|ref|NP_001189332.1|  PLDLASEE..Pe.R...........LPCLQRL..........L.DL....G....A........
gi|31581522|ref|NP_004903.2|      PLHFAAGG..G..H...........AEIVQIL..........L.NHp...E....T........
gi|37221182|ref|NP_919437.1|      PLHFAAGG..G..H...........AEIVQIL..........L.NHp...E....T........
gi|37221184|ref|NP_919438.1|      PLHFAAGG..G..H...........AEIVQIL..........L.NHp...E....T........
gi|37221187|ref|NP_919436.1|      PLHFAAGG..G..H...........AEIVQIL..........L.NHp...E....T........
gi|121114287|ref|NP_056131.2|     PLHCAASC..N..S...........VHLCKQL..........V.ES....G....A........
gi|194097377|ref|NP_001123487.1|  ALMKAAMR..N..R...........CECVATL..........L.MA....G....A........
gi|300796386|ref|NP_665803.2|     SLTFAVLH..G..H...........ISVVQLL..........L.DA....G....A........
gi|218563749|ref|NP_085152.2|     --------..-..-...........-------..........-.--....-....-........
gi|296179431|ref|NP_068765.3|     PVHDAVVN..D..N...........LETIWLL..........L.SY....G....A........
gi|215820635|ref|NP_001135974.1|  PLHCAASC..N..D...........TVICMAL..........V.QH....G....A........
gi|63003907|ref|NP_006654.2|      PLHCAASC..N..D...........TVICMAL..........V.QH....G....A........
gi|168229256|ref|NP_689576.4|     --------..-..-...........-------..........-.--....-....-........
gi|148596953|ref|NP_061877.1|     --------..-..-...........-------..........-.--....-....-........
gi|7661880|ref|NP_055531.1|       --------..-..-...........-------..........-.--....-....-........
gi|21735483|ref|NP_659505.1|      ALNIAIER..R..Q...........GDIAALL..........I.AA....G....A........
gi|32171201|ref|NP_859077.1|      --------..-..-...........-------..........-.--....-....-........
gi|341915877|ref|XP_001134442.4|  --------..-..-...........-------..........-.--....-....-........
gi|75750529|ref|NP_057636.2|      VLFLAVKA..G..D...........VDGVRLL..........L.EH....G....A........
gi|68131557|ref|NP_056014.2|      --------..-..-...........--CLEYL..........L.RN....D....A........
gi|38348298|ref|NP_940895.1|      ARDVAARY..S..Q...........TECVEFL..........D.WA....D....A........
gi|319803120|ref|NP_001188386.1|  PVHAAAFS..G..N...........QWILSKL..........L.DA....G....G........
gi|57863263|ref|NP_938207.2|      PVHAAAFS..G..N...........QWILSKL..........L.DA....G....G........
gi|57863261|ref|NP_112562.3|      PVHAAAFS..G..N...........QWILSKL..........L.DA....G....G........
gi|341914329|ref|XP_001717391.3|  --------..-..-...........-------..........-.--....-....-........
gi|51972284|ref|NP_001004354.1|   ALHIAAFG..G..H...........QDIVLYL..........I.T-....-....-........
gi|41393573|ref|NP_054749.2|      --------..-..-...........-------..........-.--....-....-........
gi|146231998|ref|NP_001078923.1|  --------..-..-...........-------..........-.--....-....-........
gi|313102999|ref|NP_001186197.1|  --------..-..-...........-------..........-.--....-....-........
gi|41872507|ref|NP_003637.2|      --------..-..-...........-------..........-.--....-....-........
gi|313102997|ref|NP_001186196.1|  --------..-..-...........-------..........-.--....-....-........
gi|313103001|ref|NP_963291.2|     --------..-..-...........-------..........-.--....-....-........
gi|41872522|ref|NP_963290.1|      --------..-..-...........-------..........-.--....-....-........
gi|13899267|ref|NP_113626.1|      --------..-..-...........-------..........-.--....-....-........
gi|157688564|ref|NP_001099010.1|  --------..-..-...........-------..........-.--....-....-........
gi|18390333|ref|NP_569058.1|      ALYFAVSN..S..D...........LSSVKLL..........L.SA....G....A........
gi|4758156|ref|NP_004708.1|       ALHKAACQ..R..N...........RAVCQLL..........V.DA....G....A........
gi|206725420|ref|NP_001128685.1|  --------..-..-...........-------..........-.--....-....-........
gi|206725415|ref|NP_631940.2|     --------..-..-...........-------..........-.--....-....-........
gi|24308163|ref|NP_061178.1|      --------..-..-...........-------..........-.--....-....-........
gi|17149832|ref|NP_476511.1|      --------..-..-...........-------..........-.--....-....-........
gi|74315348|ref|NP_542435.2|      ALHIAIER..R..N...........MALVTLL..........V.EN....G....A........
gi|74315350|ref|NP_061197.4|      ALHIAIER..R..N...........MALVTLL..........V.EN....G....A........
gi|74315352|ref|NP_542436.2|      ALHIAIER..R..N...........MALVTLL..........V.EN....G....A........
gi|74315354|ref|NP_542437.2|      ALHIAIER..R..N...........MALVTLL..........V.EN....G....A........
gi|21237786|ref|NP_055591.2|      --------..-..-...........-------..........-.--....-....-........
gi|124517699|ref|NP_689558.4|     PLHLATTL..G..H...........LECARVL..........L.AH....G....A........
gi|206725422|ref|NP_001128686.1|  --------..-..-...........-------..........-.--....-....-........
gi|17149830|ref|NP_476510.1|      --------..-..-...........-------..........-.--....-....-........
gi|17864094|ref|NP_064562.1|      --------..-..-...........-------..........-.--....-....-........
gi|54607077|ref|NP_075392.2|      --------..-..-...........-------..........-.--....-....-........
gi|31982881|ref|NP_078968.3|      LLHYTCKS..G..Ahgigdveta..VKFATQL..........I.DL....G....A........
gi|20336214|ref|NP_037399.2|      --------..-..-...........-------..........-.--....-....-........
gi|57863304|ref|NP_056340.2|      --------..-..-...........-------..........-.--....-....-........
gi|304361757|ref|NP_001182027.1|  PLHVAARN..G..L...........TMVVQEL..........L.GK....G....A........
gi|304361760|ref|NP_001182028.1|  PLHVAARN..G..L...........TMVVQEL..........L.GK....G....A........
gi|313102995|ref|NP_001186195.1|  --------..-..-...........-------..........-.--....-....-........
gi|20127551|ref|NP_057197.2|      ALHIAIEK..R..S...........LQCVKLL..........V.EN....G....A........
gi|38683799|ref|NP_149112.1|      --------..-..-...........-------..........-.--....-....-........
gi|166795254|ref|NP_110443.3|     PLHLAVML..G..N...........KECAHLL..........L.AH....N....A........
gi|18496983|ref|NP_056341.1|      LLHYACKA..G..Ahgvgdpaaa..VRLSQQL..........L.AL....G....A........
gi|313851097|ref|NP_001186499.1|  LLHYACKA..G..Ahgvgdpaaa..VRLSQQL..........L.AL....G....A........
gi|155969701|ref|NP_919288.2|     PAHDAAAT..G..S...........LAELCWL..........VrEG....G....C........
gi|30089932|ref|NP_821066.1|      --------..-..-...........-------..........-.--....-....-........
gi|156104878|ref|NP_055720.3|     --------..-..-...........-------..........-.--....-....-........
gi|294459971|ref|NP_001170902.1|  PLSLAACT..N..Q...........PHIVNYL..........T.ENphk.K....A........
gi|22547184|ref|NP_067638.3|      PLSLAACT..N..Q...........PHIVNYL..........T.ENphk.K....A........
gi|7661962|ref|NP_055585.1|       --------..-..-...........-------..........-.--....-....-........
gi|117956371|ref|NP_001071154.1|  --------..-..-...........-------..........-.--....-....-........
gi|95147559|ref|NP_787069.3|      --------..-..-...........-------..........-.--....-....-........
gi|16418357|ref|NP_443087.1|      --------..-..-...........-------..........-.--....-....-........
gi|170650694|ref|NP_001116244.1|  --------..-..-...........-------..........-.--....-....-........
gi|150378537|ref|NP_001092877.1|  --------..-..-...........-------..........-.--....-....-........
gi|80978934|ref|NP_055729.2|      --------..-..-...........-------..........-.--....-....-........
gi|5730102|ref|NP_004612.2|       ALLLAISK..G..Y...........VRIVEAI..........L.SH....P....Afaegkrla
gi|80978930|ref|NP_001032208.1|   --------..-..-...........-------..........-.--....-....-........
gi|269315852|ref|NP_997237.2|     PLELAVSL..G..N...........LESVRVL..........L.RH....N....A........
gi|255982572|ref|NP_001157637.1|  PIHAAAQM..G..H...........TKILDLL..........I.PL....T....N........
gi|7705831|ref|NP_057199.1|       PIHAAAQM..G..H...........TKILDLL..........I.PL....T....N........
gi|148806877|ref|NP_597704.1|     --------..-..-...........-------..........-.--....-....-........
gi|156104893|ref|NP_597703.2|     --------..-..-...........-------..........-.--....-....-........
gi|117956373|ref|NP_001071153.1|  --------..-..-...........-------..........-.--....-....-........
gi|221136914|ref|NP_001137472.1|  --------..-..-...........-------..........-.--....-....-........
gi|166851846|ref|NP_001071133.2|  --------..-..-...........-------..........-.--....-....-........
gi|339275867|ref|NP_001229858.1|  PLMEAAAA..G..H...........EIIVQYF..........L.NH....G....V........
gi|90991702|ref|NP_078928.3|      MLALACQR..G..H...........LGVVKLL..........VlTH....G....A........
gi|71274172|ref|NP_001025041.1|   --------..-..-...........-------..........-.--....-....-........
gi|22547180|ref|NP_671737.1|      PLSLAACT..N..Q...........PHIVNYL..........T.ENphk.K....A........
gi|4507687|ref|NP_003296.1|       ALLLAISK..G..Y...........VRIVEAI..........L.NHp...G....Faaskrltl
gi|6912736|ref|NP_036603.1|       ALLYAIRK..E..V...........VGAVELL..........L.SY....R....Rpsgekqvp
gi|110227613|ref|NP_114152.3|     PLAYARRA..G..S...........QECADIL..........I.QH....G....-........
gi|194733735|ref|NP_001124170.1|  ALLLAISK..G..Y...........VRIVEAI..........L.NHp...G....Faaskrltl
gi|209863030|ref|NP_001129429.1|  ALLHAIRK..E..V...........VGAVELL..........L.NH....K....K........
gi|209863028|ref|NP_001129428.1|  ALLHAIRK..E..V...........VGAVELL..........L.NH....K....K........
gi|209863026|ref|NP_001129427.1|  ALLHAIRK..E..V...........VGAVELL..........L.NH....K....K........
gi|7706747|ref|NP_057263.1|       ALLHAIRK..E..V...........VGAVELL..........L.NH....K....K........
gi|209863024|ref|NP_003297.1|     ALLHAIRK..E..V...........VGAVELL..........L.NH....K....K........
gi|262399375|ref|NP_001161048.1|  ALLLAISK..G..Y...........VRIVEAI..........L.NH....P....Afaqgqrlt
gi|262399379|ref|NP_001161049.1|  ALLLAISK..G..Y...........VRIVEAI..........L.NH....P....Afaqgqrlt
gi|9966865|ref|NP_065122.1|       ALLLAISK..G..Y...........VRIVEAI..........L.NH....P....Afaqgqrlt
gi|25777624|ref|NP_742024.1|      CLYGA---..-..-...........-------..........-.--....-....-........
gi|54112401|ref|NP_056030.1|      --------..-..-...........-------..........-.--....-....-........
gi|157743267|ref|NP_001099046.1|  --ILAAAE..G..R...........YEVLREL..........L.EA....E....P........
gi|110815813|ref|NP_057460.3|     PLHTACRH..G..L...........ANLTAEL..........L.QQ....G....A........
gi|269847874|ref|NP_073739.3|     --------..-..-...........-------..........-.--....-....-........
gi|75750531|ref|NP_060314.2|      VLFLAVKA..G..D...........VDGVRLL..........L.EH....G....A........
gi|7657265|ref|NP_056137.1|       --------..-..-...........-------..........-.--....-....-........
gi|75750529|ref|NP_057636.2|      VLAAAATH..C..H...........NDIVNLL..........L.DC....G....A........
gi|257467636|ref|NP_055646.2|     PVVTCLKH..E..D...........FELAFLL..........L.TK....G....A........
gi|222352179|ref|NP_001138435.1|  PLHRACAR..H..D...........APALCLL..........L.RL....G....A........
gi|222352177|ref|NP_001138434.1|  PLHRACAR..H..D...........APALCLL..........L.RL....G....A........
gi|222352175|ref|NP_001138433.1|  PLHRACAR..H..D...........APALCLL..........L.RL....G....A........
gi|222352173|ref|NP_004998.3|     PLHRACAR..H..D...........APALCLL..........L.RL....G....A........
gi|61742817|ref|NP_001013424.1|   --------..-..-...........-------..........-.--....-....-........
gi|239744064|ref|XP_001714838.2|  --------..-..-...........-------..........-.--....-....-........
gi|222352168|ref|NP_001138432.1|  PLTIVFKH..K..H...........KDCVLYL..........L.S-....-....-........
gi|29826341|ref|NP_055914.2|      --------..-..-...........-------..........-.--....-....-........
gi|284005535|ref|NP_001164637.1|  --------..-..-...........-------..........-.--....-....-........
gi|284005543|ref|NP_001164639.1|  --------..-..-...........-------..........-.--....-....-........
gi|284005537|ref|NP_001164638.1|  --------..-..-...........-------..........-.--....-....-........
gi|4507685|ref|NP_003295.1|       PVILAAHR..N..N...........YEILTML..........L.KQ....D....V........
gi|15042961|ref|NP_149417.1|      --------..-..-...........-------..........-.--....-....-........
gi|312839866|ref|NP_001186166.1|  --------..-..-...........-------..........-.--....-....-........
gi|312839869|ref|NP_001186167.1|  --------..-..-...........-------..........-.--....-....-........
gi|312839871|ref|NP_001186168.1|  --------..-..-...........-------..........-.--....-....-........
gi|312839873|ref|NP_001186169.1|  --------..-..-...........-------..........-.--....-....-........
gi|109150425|ref|NP_060559.2|     --------..-..-...........-------..........-.--....-....-........
gi|109150435|ref|NP_001035869.1|  --------..-..-...........-------..........-.--....-....-........
gi|257467636|ref|NP_055646.2|     --------..-..-...........-------..........-.--....-....-........
gi|294459965|ref|NP_001170899.1|  PLSLAACT..N..Q...........PHIVNYL..........T.ENphk.K....A........
gi|209863032|ref|NP_001129430.1|  ALLHAIRK..E..V...........VGAVELL..........L.NH....-....-........
gi|148664230|ref|NP_055929.1|     P-------..-..-...........-------..........-.--....-....-........
gi|114842396|ref|NP_694960.2|     AMFEAVEQ..Q..D...........MDAVQIL..........L.YQytpeE....L........
gi|294459977|ref|NP_001170904.1|  PLSLAACT..N..Q...........PHIVNYL..........T.ENphk.K....A........
gi|22748713|ref|NP_689539.1|      --------..-..-...........-------..........-.--....-....-........
gi|224465235|ref|NP_001138999.1|  --------..-..-...........-------..........-.--....-....-........
gi|98985804|ref|NP_478104.2|      --------..-..-...........-------..........-.--....-....-........
gi|17981696|ref|NP_511042.1|      --------..-..-...........-------..........-.--....-....-........
gi|260763963|ref|NP_001120979.2|  --------..-..-...........-------..........-.--....-....-........
gi|27477049|ref|NP_543144.1|      --------..-..-...........-------..........-.--....-....-........
gi|260763966|ref|NP_001077376.2|  --------..-..-...........-------..........-.--....-....-........
gi|260763960|ref|NP_060405.4|     --------..-..-...........-------..........-.--....-....-........
gi|75750531|ref|NP_060314.2|      --------..-..-...........-------..........-.--....-....-........


                                                                                                   1
                                                                                                    
d1s70b_                             ...........H.....VG....A...............................V...NS..E
gi|21361135|ref|NP_002494.2|      ...........G.....LC....V...............................A...ER..R
gi|70780355|ref|NP_065210.2|      ...........H.....PN....A...............................A...GK..N
gi|215598574|ref|NP_001135918.1|  ...........H.....PN....A...............................A...GK..N
gi|70780353|ref|NP_065208.2|      ...........H.....PN....A...............................A...GK..N
gi|70780359|ref|NP_065209.2|      ...........H.....PN....A...............................A...GK..N
gi|70780357|ref|NP_000028.3|      ...........H.....PN....A...............................A...GK..N
gi|325053666|ref|NP_001191332.1|  ...........S.....PH....A...............................A...AK..N
gi|325053668|ref|NP_001191333.1|  ...........S.....PH....A...............................A...AK..N
gi|32967601|ref|NP_066267.2|      ...........S.....PH....A...............................A...AK..N
gi|188595682|ref|NP_001120965.1|  ...........S.....PH....A...............................T...AK..N
gi|52426737|ref|NP_066187.2|      ...........S.....PH....A...............................T...AK..N
gi|52426735|ref|NP_001139.3|      ...........S.....PH....A...............................T...AK..N
gi|268607595|ref|NP_001161354.1|  ...........N.....ID....Q...............................R...GY..D
gi|62988328|ref|NP_065070.1|      ...........N.....ID....Q...............................R...GY..D
gi|48928017|ref|NP_001001716.1|   ...........G.....LC....V...............................A...ER..R
gi|70780353|ref|NP_065208.2|      ...........S.....VN....F...............................T...PQ..N
gi|70780355|ref|NP_065210.2|      ...........S.....VN....F...............................T...PQ..N
gi|70780359|ref|NP_065209.2|      ...........S.....VN....F...............................T...PQ..N
gi|70780357|ref|NP_000028.3|      ...........S.....VN....F...............................T...PQ..N
gi|215598574|ref|NP_001135918.1|  ...........S.....VN....F...............................T...PQ..N
gi|325053668|ref|NP_001191333.1|  ...........K.....ID....A...............................K...TR..D
gi|32967601|ref|NP_066267.2|      ...........K.....ID....A...............................K...TR..D
gi|304434687|ref|NP_710181.2|     ...........E.....VT....C...............................K...DK..K
gi|30425444|ref|NP_848605.1|      ...........D.....PN....L...............................H...EA..E
gi|304361757|ref|NP_001182027.1|  ...........D.....VN....M...............................K...SK..D
gi|304361760|ref|NP_001182028.1|  ...........D.....VN....M...............................K...SK..D
gi|46519151|ref|NP_060448.1|      ...........D.....QE....H...............................K...TD..E
gi|46519154|ref|NP_078944.2|      ...........D.....QE....H...............................K...TD..E
gi|157743284|ref|NP_775866.2|     ...........E.....ID....E...............................P...NA..F
gi|55741641|ref|NP_065789.1|      ...........K.....VN....C...............................S...DK..Y
gi|10863929|ref|NP_066956.1|      ...........N.....VN....Lrrktkedqer.....................L...RK..G
gi|308044526|ref|NP_001183959.1|  ...........G.....IN....T...............................Hs..NE..F
gi|41327754|ref|NP_065690.2|      ...........D.....VS....L...............................Q...GK..D
gi|38683816|ref|NP_942592.1|      ...........E.....IN....S...............................Rtg.SK..L
gi|38683807|ref|NP_115593.3|      ...........E.....IN....S...............................Rtg.SK..L
gi|304434690|ref|NP_001182073.1|  ...........S.....VN....V...............................S...DR..G
gi|46519147|ref|NP_060217.1|      ...........N.....IN....AqteetqetaltlaccggfsevadflikagadI...EL..G
gi|37620163|ref|NP_065741.3|      ...........N.....IN....AqteetqetaltlaccggfsevadflikagadI...EL..G
gi|304361757|ref|NP_001182027.1|  ...........N.....VD....A...............................K...DK..W
gi|304361760|ref|NP_001182028.1|  ...........N.....VD....A...............................K...DK..W
gi|37620163|ref|NP_065741.3|      ...........D.....IN....A...............................Qi..ET..N
gi|46519147|ref|NP_060217.1|      ...........D.....IN....A...............................Qi..ET..N
gi|68131557|ref|NP_056014.2|      ...........N.....VN....V...............................S...DR..A
gi|96975023|ref|NP_874362.3|      ...........D.....LE....E...............................Q...NA..E
gi|10092619|ref|NP_065390.1|      ...........T.....PH....-...............................-...--..-
gi|38683816|ref|NP_942592.1|      ...........G.....IN....T...............................Hs..NE..F
gi|38683807|ref|NP_115593.3|      ...........G.....IN....T...............................Hs..NE..F
gi|157739945|ref|NP_079461.2|     ...........A.....VA....Q...............................P...NR..R
gi|18252778|ref|NP_057234.2|      ...........D.....TN....H...............................R...CN..R
gi|89363047|ref|NP_004929.2|      ...........N.....VN....I...............................K...NR..E
gi|321117514|ref|NP_001189358.1|  ...........D.....TN....H...............................R...CN..R
gi|223634006|ref|NP_001138682.1|  ...........A.....AE....A...............................E...DA..R
gi|341914599|ref|XP_001714535.3|  ...........H.....TS....E...............................K...DK..G
gi|341915319|ref|XP_001128459.4|  ...........H.....TS....E...............................K...DK..G
gi|34304379|ref|NP_899068.1|      ...........Q.....VD....A...............................T...DV..M
gi|225543463|ref|NP_001139381.1|  ...........A.....VS....R...............................T...NR..R
gi|34304381|ref|NP_055240.2|      ...........Q.....VD....A...............................T...DV..M
gi|225543461|ref|NP_203752.2|     ...........A.....VS....R...............................T...NR..R
gi|325053666|ref|NP_001191332.1|  ...........P.....IL....S...............................K...TK..N
gi|68131557|ref|NP_056014.2|      ...........N.....PA....T...............................A...DN..H
gi|52426735|ref|NP_001139.3|      ...........P.....LL....A...............................R...TK..N
gi|4506217|ref|NP_002805.1|       ...........Q.....VN....A...............................V...NQ..N
gi|188595682|ref|NP_001120965.1|  ...........P.....LL....A...............................R...TK..N
gi|52426737|ref|NP_066187.2|      ...........P.....LL....A...............................R...TK..N
gi|224465233|ref|NP_079033.4|     ...........D.....VN....C...............................Q...DD..G
gi|164664508|ref|NP_005169.2|     ...........D.....LE....A...............................R...NY..D
gi|7705748|ref|NP_057062.1|       ...........D.....VN....A...............................Q...DN..E
gi|313569861|ref|NP_001186256.1|  ...........D.....VN....A...............................Q...DN..E
gi|163914396|ref|NP_001106279.1|  ...........D.....VN....A...............................Q...DN..E
gi|87239981|ref|NP_003738.2|      ...........D.....PS....I...............................I...SL..Q
gi|13376842|ref|NP_079511.1|      ...........D.....PN....I...............................I...SL..Q
gi|7705831|ref|NP_057199.1|       ...........N.....VNg...S...............................H...SM..C
gi|255982572|ref|NP_001157637.1|  ...........N.....VNg...S...............................H...SM..C
gi|338797777|ref|NP_001229742.1|  ...........N.....VL....A...............................K...NK..A
gi|338797775|ref|NP_055757.3|     ...........N.....VL....A...............................K...NK..A
gi|338797766|ref|NP_001229738.1|  ...........N.....VL....A...............................K...NK..A
gi|338797770|ref|NP_001229740.1|  ...........N.....VL....A...............................K...NK..A
gi|206597522|ref|NP_001128663.1|  ...........-.....--....-...............................-...--..-
gi|4502249|ref|NP_003878.1|       ...........-.....--....-...............................-...--..-
gi|304434690|ref|NP_001182073.1|  ...........D.....CC....F...............................K...DN..Q
gi|157743284|ref|NP_775866.2|     ...........S.....TDpldaG...............................V...DY..S
gi|46094081|ref|NP_060952.2|      ...........-.....--....-...............................-...--..-
gi|13376842|ref|NP_079511.1|      ...........E.....PT....I...............................R...NT..D
gi|87239981|ref|NP_003738.2|      ...........D.....PN....I...............................R...NT..D
gi|156142197|ref|NP_006700.3|     ...........D.....VN....A...............................Q...DS..G
gi|156142199|ref|NP_079532.5|     ...........D.....VN....A...............................Q...DS..G
gi|92087060|ref|NP_563616.3|      ...........D.....VL....A...............................L...AD..D
gi|70995267|ref|NP_775776.2|      ...........N.....IH....D...............................Q...LY..D
gi|219842212|ref|NP_001137357.1|  ...........H.....VG....A...............................V...NS..E
gi|4505317|ref|NP_002471.1|       ...........H.....VG....A...............................V...NS..E
gi|116534990|ref|NP_015628.2|     ...........K.....PC....K...............................S...NK..W
gi|282394038|ref|NP_001164160.1|  ...........D.....VN....L...............................P...DA..H
gi|282394032|ref|NP_001164157.1|  ...........D.....VN....L...............................P...DA..H
gi|282394030|ref|NP_543151.2|     ...........D.....VN....L...............................P...DA..H
gi|282394036|ref|NP_001164159.1|  ...........D.....VN....L...............................P...DA..H
gi|282394034|ref|NP_001164158.1|  ...........D.....VN....L...............................P...DA..H
gi|58331111|ref|NP_061919.1|      ...........N.....PL....L...............................K...NK..D
gi|58331113|ref|NP_001009941.1|   ...........N.....PL....L...............................K...NK..D
gi|268607595|ref|NP_001161354.1|  ...........N.....IN....H...............................T...DQ..D
gi|62988328|ref|NP_065070.1|      ...........N.....IN....H...............................T...DQ..D
gi|221307473|ref|NP_001137250.1|  ...........-.....--....-...............................-...--..-
gi|19923540|ref|NP_060177.2|      ...........-.....--....-...............................-...--..-
gi|140161500|ref|NP_056060.2|     ...........D.....PT....M...............................R...NN..K
gi|224809478|ref|NP_001138997.1|  ...........P.....AE....S...............................V...DS..S
gi|224809468|ref|NP_056392.2|     ...........P.....AE....S...............................V...DS..S
gi|224809470|ref|NP_001138992.1|  ...........P.....AE....S...............................V...DS..S
gi|224809472|ref|NP_001138993.1|  ...........P.....AE....S...............................V...DS..S
gi|224809474|ref|NP_001138994.1|  ...........P.....AE....S...............................V...DS..S
gi|18079216|ref|NP_065815.1|      ...........N.....PC....M...............................V...DN..S
gi|224809476|ref|NP_001138995.1|  ...........P.....AE....S...............................V...DS..S
gi|217416347|ref|NP_065804.2|     ...........N.....PC....L...............................V...NK..A
gi|341915690|ref|XP_003403588.1|  ...........D.....GN....I...............................Q...DE..Y
gi|239745058|ref|XP_002343353.1|  ...........D.....GN....I...............................Q...DE..Y
gi|341915688|ref|XP_003403587.1|  ...........D.....GN....I...............................Q...DE..Y
gi|310118968|ref|XP_003118905.1|  ...........D.....PN....I...............................T...DV..F
gi|30348954|ref|NP_065825.1|      ...........H.....PS....L...............................Q...DS..E
gi|310118966|ref|XP_001717815.3|  ...........D.....PN....I...............................T...DV..F
gi|71274109|ref|NP_004547.2|      ...........D.....LQ....L...............................Q...NW..Q
gi|110431370|ref|NP_113663.2|     ...........G.....VN....A...............................Q...TK..N
gi|256222430|ref|NP_079466.3|     ...........D.....PN....I...............................T...DV..F
gi|28626517|ref|NP_056383.1|      ...........D.....LL....A...............................V...NS..D
gi|53828703|ref|NP_001005365.2|   ...........D.....PN....L...............................P...DM..Y
gi|239747114|ref|XP_002343914.1|  ...........D.....RN....I...............................P...DE..Y
gi|153792284|ref|NP_778146.2|     ...........D.....RN....I...............................P...DE..Y
gi|52856434|ref|NP_001005356.1|   ...........D.....PN....I...............................P...DE..Y
gi|50511945|ref|NP_690001.3|      ...........D.....PT....I...............................R...NS..K
gi|148596917|ref|NP_660278.3|     ...........S.....WQ....A...............................R...DL..G
gi|209977003|ref|NP_001129685.1|  ...........D.....PN....I...............................P...DE..Y
gi|212549546|ref|NP_001131143.1|  ...........D.....QN....I...............................P...DE..Y
gi|256222280|ref|NP_001157787.1|  ...........N.....PN....I...............................T...DF..F
gi|224282147|ref|NP_001138914.1|  ...........D.....PN....I...............................P...DE..Y
gi|259155302|ref|NP_001158884.1|  ...........All...LD....H...............................P...NG..D
gi|121582655|ref|NP_653299.3|     ...........N.....ED....A...............................V...DA..E
gi|68131557|ref|NP_056014.2|      ...........D.....ID....T...............................P...DD..F
gi|34577122|ref|NP_003989.2|      ...........All...LD....H...............................P...NG..D
gi|153791352|ref|NP_001093241.1|  ...........D.....PN....I...............................P...DE..Y
gi|103471993|ref|NP_056151.2|     ...........D.....PS....L...............................I...DG..E
gi|134133226|ref|NP_001077007.1|  ...........D.....PN....I...............................P...DE..Y
gi|268607514|ref|NP_001161330.1|  ...........S.....VG....I...............................V...NS..E
gi|268607512|ref|NP_001161329.1|  ...........S.....VG....I...............................V...NS..E
gi|30089994|ref|NP_078984.2|      ...........E.....VD....P...............................L...SD..K
gi|22208957|ref|NP_078977.2|      ...........K.....VN....-...............................P...PL..Y
gi|22208951|ref|NP_665862.1|      ...........N.....KE....C...............................Q...DD..F
gi|320202950|ref|NP_001188894.1|  ...........N.....KE....C...............................Q...DD..F
gi|37620163|ref|NP_065741.3|      ...........N.....IE....D...............................H...NE..N
gi|46519147|ref|NP_060217.1|      ...........N.....IE....D...............................H...NE..N
gi|38176283|ref|NP_937886.1|      ...........E.....VD....P...............................L...SD..K
gi|88953571|ref|XP_933678.1|      ...........D.....PN....I...............................P...DE..Y
gi|113413200|ref|XP_934799.2|     ...........D.....PN....I...............................P...DE..Y
gi|268607506|ref|NP_002472.2|     ...........S.....VG....I...............................V...NS..E
gi|118150656|ref|NP_062618.2|     ...........D.....PD....L...............................R...DI..R
gi|38683816|ref|NP_942592.1|      ...........N.....VH....A...............................T...TA..T
gi|38683807|ref|NP_115593.3|      ...........N.....VH....A...............................T...TA..T
gi|304434690|ref|NP_001182073.1|  ...........D.....TA....K...............................C...GI..H
gi|215598806|ref|NP_543147.2|     ...........R.....VD....G...............................R...SEe.E
gi|52486194|ref|NP_003551.2|      ...........R.....CN....I...............................M...GP..N
gi|294337038|ref|NP_001135932.2|  ...........R.....VD....G...............................R...SEe.E
gi|294337037|ref|NP_001135931.2|  ...........R.....VD....G...............................R...SEe.E
gi|116875852|ref|NP_065822.2|     ...........D.....VD....V...............................E...DA..M
gi|117320527|ref|NP_002493.3|     ...........PavpqlLH....M...............................P...DF..E
gi|117320540|ref|NP_001070961.1|  ...........PavpqlLH....M...............................P...DF..E
gi|117320531|ref|NP_001070962.1|  ...........PavpqlLH....M...............................P...DF..E
gi|313760592|ref|NP_001186491.1|  ...........R.....CN....I...............................M...GP..N
gi|52486251|ref|NP_001004426.1|   ...........R.....CN....I...............................M...GP..N
gi|16975496|ref|NP_219499.1|      ...........N.....IN....H...............................A...AD..G
gi|52426737|ref|NP_066187.2|      ...........N.....QS....T...............................A...TE..D
gi|341914805|ref|XP_003403867.1|  ...........N.....PN....I...............................K...DI..Y
gi|60115723|ref|NP_001012421.1|   ...........N.....PN....L...............................K...DI..Y
gi|60460920|ref|NP_001012419.1|   ...........N.....PN....L...............................K...DI..Y
gi|156104901|ref|NP_115626.2|     ...........N.....PN....L...............................K...DI..Y
gi|341914105|ref|XP_001715780.3|  ...........N.....PN....V...............................R...DM..Y
gi|149363679|ref|NP_001092275.1|  ...........N.....PN....L...............................K...DI..Y
gi|188595682|ref|NP_001120965.1|  ...........N.....QS....T...............................A...TE..D
gi|14249672|ref|NP_116291.1|      ...........N.....LL....A...............................V...NT..D
gi|341915999|ref|XP_292717.9|     ...........N.....PN....V...............................R...DM..Y
gi|157743284|ref|NP_775866.2|     ...........G.....VN....E...............................A...DC..K
gi|222537750|ref|NP_001138501.1|  ...........D.....LN....Y...............................V...DV..Y
gi|325053666|ref|NP_001191332.1|  ...........S.....QS....L...............................A...TE..D
gi|283549153|ref|NP_671728.2|     ...........N.....PN....I...............................E...DI..Y
gi|155969701|ref|NP_919288.2|     ...........D.....VH....L...............................R...AL..D
gi|312147315|ref|NP_001185879.1|  ...........N.....VL....L...............................Q...DV..N
gi|62177127|ref|NP_055826.1|      ...........N.....VL....L...............................Q...DV..N
gi|90186267|ref|NP_078945.2|      ...........E.....IN....H...............................Q...DN..E
gi|134244285|ref|NP_000426.2|     ...........D.....TN....A...............................Q...DH..S
gi|56550047|ref|NP_001008225.1|   ...........P.....TE....H...............................A...DL..Q
gi|67906195|ref|NP_775822.3|      ...........D.....VN....A...............................Q...NR..L
gi|267844887|ref|NP_001136205.2|  ...........D.....VN....L...............................R...CA..N
gi|47933346|ref|NP_061901.2|      ...........D.....PT....L...............................I...DG..E
gi|110815813|ref|NP_057460.3|     ...........H.....LN....V...............................R...DR..Q
gi|55770876|ref|NP_004548.3|      ...........N.....PN....Q...............................P...DR..A
gi|59850762|ref|NP_060473.2|      ...........P.....TE....H...............................A...DL..Q
gi|18254476|ref|NP_543150.1|      ...........K.....AQ....-...............................L...ES..C
gi|310114187|ref|XP_003119912.1|  ...........D.....PN....I...............................T...DV..F
gi|148833508|ref|NP_060087.3|     ...........D.....AN....I...............................Q...DN..M
gi|7657265|ref|NP_056137.1|       ...........N.....IS....I...............................A...NK..Y
gi|34304379|ref|NP_899068.1|      ...........E.....VD....T...............................Q...DK..N
gi|34304381|ref|NP_055240.2|      ...........E.....VD....T...............................Q...DK..N
gi|38327522|ref|NP_055206.2|      ...........Q.....IE....F...............................R...DM..L
gi|115495445|ref|NP_443723.2|     ...........D.....IN....L...............................V...DV..Y
gi|17981699|ref|NP_523240.1|      ...........N.....VN....A...............................Q...NG..F
gi|4502751|ref|NP_001253.1|       ...........N.....VN....A...............................Q...NG..F
gi|24041035|ref|NP_077719.2|      ...........D.....AN....A...............................Q...DN..M
gi|17864094|ref|NP_064562.1|      ...........D.....LE....V...............................S...NR..H
gi|42734375|ref|NP_597707.1|      ...........S.....VN....V...............................P...TP..E
gi|13443014|ref|NP_076992.1|      ...........S.....VQ....-...............................P...ES..D
gi|271398201|ref|NP_001162003.1|  ...........S.....VQ....-...............................P...ES..D
gi|60218887|ref|NP_001012428.1|   ...........K.....AQ....-...............................L...EV..H
gi|58331117|ref|NP_001009943.1|   ...........N.....PL....L...............................K...NK..D
gi|72534772|ref|NP_001026909.1|   ...........S.....VQ....-...............................P...ES..D
gi|18254474|ref|NP_543149.1|      ...........K.....AQ....-...............................L...EV..H
gi|338797779|ref|NP_001229743.1|  ...........A.....LD....R...............................Q...DK..A
gi|116325987|ref|NP_872409.2|     ...........S.....IE....D...............................V...DY..N
gi|17981702|ref|NP_524145.1|      ...........H.....PD....A...............................L...NR..F
gi|4502753|ref|NP_001791.1|       ...........H.....PD....A...............................L...NR..F
gi|126723390|ref|NP_597732.1|     ...........V.....VD....V...............................V...DS..S
gi|38569426|ref|NP_071379.3|      ...........D.....VN....N...............................S...TY..E
gi|38569428|ref|NP_942093.1|      ...........D.....VN....N...............................S...TY..E
gi|24308163|ref|NP_061178.1|      ...........D.....LE....V...............................A...NR..H
gi|53832024|ref|NP_001005474.1|   ...........D.....LE....A...............................T...NY..D
gi|13899229|ref|NP_113607.1|      ...........D.....LE....A...............................T...NY..D
gi|14149716|ref|NP_060077.1|      ...........N.....IA....A...............................V...NS..D
gi|39812133|ref|NP_065082.2|      ...........-.....--....-...............................-...--..-
gi|17981694|ref|NP_004927.2|      ...........-.....--....-...............................-...--..-
gi|116063534|ref|NP_115515.2|     ...........N.....AG....A...............................R...NA..D
gi|4502749|ref|NP_000068.1|       ...........-.....--....-...............................-...--..-
gi|304376272|ref|NP_001182061.1|  ...........-.....--....-...............................-...--..-
gi|32483404|ref|NP_852092.1|      ...........P.....FT....-...............................T...DW..L
gi|8051599|ref|NP_057739.1|       ...........P.....FT....-...............................T...DW..L
gi|8051597|ref|NP_002032.2|       ...........P.....FT....-...............................T...DW..L
gi|8051595|ref|NP_057738.1|       ...........P.....FT....-...............................T...DW..L
gi|8051593|ref|NP_005245.2|       ...........P.....FT....-...............................T...DW..L
gi|41327752|ref|NP_659431.5|      ...........T.....VD....A...............................R...DL..L
gi|120587025|ref|NP_057232.2|     ...........S.....PN....Y...............................K...DR..R
gi|24586688|ref|NP_543139.4|      ...........T.....VN....L...............................Aa..GE..S
gi|110815813|ref|NP_057460.3|     ...........N.....PN....M...............................Q...DS..K
gi|22208964|ref|NP_665879.1|      ...........N.....VN....M...............................Ktn.NQ..D
gi|157743292|ref|NP_997721.2|     ...........S.....VQ....R...............................V...GG..T
gi|7706379|ref|NP_057200.1|       ...........N.....VN....M...............................Ktn.NQ..D
gi|217416350|ref|NP_001136115.1|  ...........N.....PC....L...............................V...NK..A
gi|226817313|ref|NP_036441.2|     ...........S.....PD....Y...............................K...DS..Y
gi|52426735|ref|NP_001139.3|      ...........N.....QS....T...............................A...TE..D
gi|219842214|ref|NP_001137358.1|  ...........H.....VG....A...............................V...NS..E
gi|13129098|ref|NP_077000.1|      ...........E.....VN....A...............................L...DG..Y
gi|21389427|ref|NP_653219.1|      ...........P.....FT....-...............................T...DW..L
gi|271398185|ref|NP_001162002.1|  ...........S.....VQ....-...............................P...ES..D
gi|122937241|ref|NP_001073889.1|  ...........S.....PD....Y...............................K...DS..R
gi|341915692|ref|XP_003403589.1|  ...........D.....GN....I...............................Q...DE..Y
gi|320202942|ref|NP_001188512.1|  ...........K.....AQ....-...............................L...EV..H
gi|116063534|ref|NP_115515.2|     ...........S.....AE....V...............................Q...DN..N
gi|18640738|ref|NP_570124.1|      ...........N.....AS....F...............................E...-K..D
gi|50897294|ref|NP_001002920.1|   ...........D.....PN....L...............................P...DM..Y
gi|116534990|ref|NP_015628.2|     ...........-.....LF....L...............................S...DH..N
gi|154354990|ref|NP_055730.2|     ...........D.....PN....L...............................A...DV..H
gi|341914820|ref|XP_003403870.1|  ...........N.....PN....L...............................K...DI..Y
gi|19718741|ref|NP_542164.2|      ...........D.....TT....I...............................V...NG..S
gi|23510377|ref|NP_694856.1|      ...........N.....VD....H...............................Q...NK..A
gi|64464726|ref|NP_055973.2|      ...........N.....VD....H...............................Q...NK..A
gi|28605137|ref|NP_736606.1|      ...........Q.....VN....A...............................V...NQ..N
gi|289629249|ref|NP_001166206.1|  ...........D.....LL....A...............................V...NS..D
gi|13376842|ref|NP_079511.1|      ...........N.....VN....C...............................R...DT..Q
gi|87239981|ref|NP_003738.2|      ...........N.....CR....D...............................T...QG..R
gi|41281709|ref|NP_640332.1|      ...........D.....LE....A...............................R...DF..E
gi|194018403|ref|NP_001123453.1|  ...........S.....AD....T...............................C...DQ..F
gi|41350198|ref|NP_060174.2|      ...........H.....VN....T...............................R...DE..D
gi|169403957|ref|NP_079209.3|     ...........-.....--....-...............................-...--..-
gi|169403959|ref|NP_001108588.1|  ...........-.....--....-...............................-...--..-
gi|157504499|ref|NP_940873.2|     ...........E.....VN....R...............................Q...NR..A
gi|156142184|ref|NP_057550.3|     ...........N.....PR....V...............................V...DD..D
gi|38569426|ref|NP_071379.3|      ...........P.....VD....M...............................K...DN..Y
gi|38569428|ref|NP_942093.1|      ...........P.....VD....M...............................K...DN..Y
gi|70995241|ref|NP_060134.2|      ...........H.....VD....L...............................R...NA..S
gi|209969812|ref|NP_001129663.1|  ...........K.....VD....K...............................Q...NR..A
gi|258613875|ref|NP_056308.3|     ...........K.....VD....K...............................Q...NR..A
gi|12746412|ref|NP_075526.1|      ...........-.....IN....H...............................T...DE..E
gi|320461689|ref|NP_569059.3|     ...........S.....PG....G...............................S...IY..N
gi|4758606|ref|NP_004508.1|       ...........D.....IN....A...............................V...NE..H
gi|62420873|ref|NP_001014794.1|   ...........D.....IN....A...............................V...NE..H
gi|62420875|ref|NP_001014795.1|   ...........D.....IN....A...............................V...NE..H
gi|157266328|ref|NP_000456.2|     ...........-.....--....-...............................R...NH..R
gi|154091032|ref|NP_653191.2|     ...........-.....--....-...............................-...--..-
gi|134948558|ref|NP_056023.3|     ...........-.....VN....K...............................R...NE..R
gi|134948605|ref|NP_001077094.1|  ...........-.....VN....K...............................R...NE..R
gi|323362985|ref|NP_001190985.1|  ...........-.....VN....K...............................R...NE..R
gi|4506499|ref|NP_003712.1|       ...........D.....LT....T...............................E...AD..S
gi|21956645|ref|NP_665807.1|      ...........-.....--....-...............................-...--..-
gi|94721248|ref|NP_001035535.1|   ...........D.....PN....G...............................S...RH..H
gi|156104862|ref|NP_859063.3|     ...........-.....--....-...............................-...--..-
gi|56676397|ref|NP_037407.4|      ...........-.....VN....K...............................R...NE..R
gi|41055989|ref|NP_059990.2|      ...........-.....--....-...............................-...DS..S
gi|304434690|ref|NP_001182073.1|  ...........G.....FE....E...............................S...DSg.A
gi|19924156|ref|NP_604389.1|      ...........D.....PH....-...............................-...--..-
gi|256574792|ref|NP_001157915.1|  ...........-.....IN....K...............................R...NA..R
gi|20270347|ref|NP_620152.1|      ...........-.....--....-...............................-...--..-
gi|31317252|ref|NP_065791.1|      ...........F.....VN....A...............................A...TLg.A
gi|320461543|ref|NP_001073933.2|  ...........S.....LS....T...............................Q...ELe.E
gi|21314682|ref|NP_061116.2|      ...........S.....VS....A...............................R...AT..G
gi|47933348|ref|NP_001001483.1|   ...........D.....PT....L...............................I...DG..E
gi|267844887|ref|NP_001136205.2|  ...........D.....LA....A...............................I...KQ..S
gi|187608777|ref|NP_038460.4|     ...........S.....VT....L...............................R...TR..K
gi|34304383|ref|NP_775748.2|      ...........-.....--....-...............................-...--..-
gi|256574784|ref|NP_001157912.1|  ...........D.....VH....A...............................R...DPr.R
gi|8923516|ref|NP_060343.1|       ...........D.....VN....A...............................A...DK..H
gi|17505200|ref|NP_062815.2|      ...........S.....VS....A...............................R...AT..G
gi|38257146|ref|NP_940683.1|      ...........K.....ID....I...............................C...NH..Q
gi|321267560|ref|NP_001155907.2|  ...........R.....PC....L...............................V...TS..V
gi|183396785|ref|NP_001116856.1|  ...........-.....--....-...............................-...--..-
gi|183396783|ref|NP_001116855.1|  ...........-.....--....-...............................-...--..-
gi|21071037|ref|NP_060215.4|      ...........-.....--....-...............................-...--..-
gi|183396787|ref|NP_001116857.1|  ...........-.....--....-...............................-...--..-
gi|299473797|ref|NP_001177408.1|  ...........D.....PE....A...............................A...DS..A
gi|284413734|ref|NP_653309.3|     ...........D.....YT....L...............................S...EK..R
gi|341915472|ref|XP_003403627.1|  ...........D.....PN....I...............................V...DV..Y
gi|341915476|ref|XP_003403594.1|  ...........D.....PN....I...............................V...DV..Y
gi|14150169|ref|NP_115736.1|      ...........-.....--....-...............................-...--..-
gi|256574792|ref|NP_001157915.1|  ...........-.....IN....R...............................R...NI..F
gi|67906195|ref|NP_775822.3|      ...........-.....--....-...............................-...--..-
gi|28461129|ref|NP_064715.1|      ...........-.....--....-...............................-...--..-
gi|166235148|ref|NP_036515.4|     ...........-.....--....-...............................-...--..-
gi|148664246|ref|NP_665872.2|     ...........-.....--....-...............................-...--..-
gi|76563940|ref|NP_005451.2|      ...........A.....IAel..S...............................C...SK..D
gi|257467559|ref|NP_001004441.2|  ...........D.....LS....L...............................Q...DH..S
gi|226437606|ref|NP_001139813.1|  ...........D.....PS....L...............................E...DR..T
gi|188219549|ref|NP_115666.2|     ...........N.....FH....K...............................T...NL..K
gi|13540606|ref|NP_110440.1|      ...........D.....PN....L...............................G...DD..F
gi|89941470|ref|NP_001034977.1|   ...........-.....--....-...............................-...--..-
gi|62953116|ref|NP_001017523.1|   ...........K.....VE....G...............................S...--..-
gi|4885643|ref|NP_005417.1|       ...........-.....--....-...............................-...--..-
gi|112799849|ref|NP_001026855.2|  ...........-.....--....-...............................-...--..-
gi|65786661|ref|NP_001018082.1|   ...........K.....VE....G...............................S...--..-
gi|56090539|ref|NP_001007534.1|   ...........-.....--....-...............................-...--..-
gi|118498337|ref|NP_056197.2|     ...........N.....PD....L...............................R...DE..D
gi|187608516|ref|NP_036419.3|     ...........-.....--....-...............................-...--..-
gi|194097375|ref|NP_872414.3|     ...........-.....--....-...............................-...--..-
gi|320202962|ref|NP_001189332.1|  ...........D.....VN....A...............................A...DK..-
gi|31581522|ref|NP_004903.2|      ...........D.....RH....I...............................T...DQ..Q
gi|37221182|ref|NP_919437.1|      ...........D.....RH....I...............................T...DQ..Q
gi|37221184|ref|NP_919438.1|      ...........D.....RH....I...............................T...DQ..Q
gi|37221187|ref|NP_919436.1|      ...........D.....RH....I...............................T...DQ..Q
gi|121114287|ref|NP_056131.2|     ...........A.....IF....A...............................S...T-..-
gi|194097377|ref|NP_001123487.1|  ...........D.....LT....A...............................V...DPv.R
gi|300796386|ref|NP_665803.2|     ...........H.....VE....-...............................-...--..-
gi|218563749|ref|NP_085152.2|     ...........-.....--....-...............................-...--..-
gi|296179431|ref|NP_068765.3|     ...........D.....PT....L...............................A...TY..S
gi|215820635|ref|NP_001135974.1|  ...........A.....IF....A...............................T...TLs.D
gi|63003907|ref|NP_006654.2|      ...........A.....IF....A...............................T...TLs.D
gi|168229256|ref|NP_689576.4|     ...........-.....--....-...............................-...--..-
gi|148596953|ref|NP_061877.1|     ...........-.....--....-...............................-...--..-
gi|7661880|ref|NP_055531.1|       ...........-.....--....-...............................-...--..-
gi|21735483|ref|NP_659505.1|      ...........D.....VN....Ahakgaffnpkyqhe.................G...FY..F
gi|32171201|ref|NP_859077.1|      ...........-.....--....-...............................-...--..-
gi|341915877|ref|XP_001134442.4|  ...........-.....--....-...............................-...--..D
gi|75750529|ref|NP_057636.2|      ...........R.....TD....I...............................CfppQL..S
gi|68131557|ref|NP_056014.2|      ...........N.....PG....I...............................R...DK..Q
gi|38348298|ref|NP_940895.1|      ...........R.....L-....-...............................-...--..-
gi|319803120|ref|NP_001188386.1|  ...........D.....LR....L...............................H...DE..R
gi|57863263|ref|NP_938207.2|      ...........D.....LR....L...............................H...DE..R
gi|57863261|ref|NP_112562.3|      ...........D.....LR....L...............................H...DE..R
gi|341914329|ref|XP_001717391.3|  ...........-.....--....-...............................-...--..D
gi|51972284|ref|NP_001004354.1|   ...........-.....--....-...............................-...--..-
gi|41393573|ref|NP_054749.2|      ...........-.....--....-...............................-...--..-
gi|146231998|ref|NP_001078923.1|  ...........-.....--....-...............................-...--..-
gi|313102999|ref|NP_001186197.1|  ...........-.....--....-...............................-...--..-
gi|41872507|ref|NP_003637.2|      ...........-.....--....-...............................-...--..-
gi|313102997|ref|NP_001186196.1|  ...........-.....--....-...............................-...--..-
gi|313103001|ref|NP_963291.2|     ...........-.....--....-...............................-...--..-
gi|41872522|ref|NP_963290.1|      ...........-.....--....-...............................-...--..-
gi|13899267|ref|NP_113626.1|      ...........-.....--....-...............................-...--..-
gi|157688564|ref|NP_001099010.1|  ...........-.....--....-...............................-...--..-
gi|18390333|ref|NP_569058.1|      ...........L.....PN....-...............................-...-Q..D
gi|4758156|ref|NP_004708.1|       ...........S.....LR....K...............................T...DS..K
gi|206725420|ref|NP_001128685.1|  ...........-.....--....-...............................-...--..-
gi|206725415|ref|NP_631940.2|     ...........-.....--....-...............................-...--..-
gi|24308163|ref|NP_061178.1|      ...........-.....--....-...............................-...GK..N
gi|17149832|ref|NP_476511.1|      ...........-.....--....-...............................-...--..-
gi|74315348|ref|NP_542435.2|      ...........D.....VQ....Aaahgdffkktkgrp.................G...FY..F
gi|74315350|ref|NP_061197.4|      ...........D.....VQ....Aaahgdffkktkgrp.................G...FY..F
gi|74315352|ref|NP_542436.2|      ...........D.....VQ....Aaahgdffkktkgrp.................G...FY..F
gi|74315354|ref|NP_542437.2|      ...........D.....VQ....Aaahgdffkktkgrp.................G...FY..F
gi|21237786|ref|NP_055591.2|      ...........-.....--....-...............................-...--..-
gi|124517699|ref|NP_689558.4|     ...........D.....VG....R...............................E...NR..S
gi|206725422|ref|NP_001128686.1|  ...........-.....--....-...............................-...--..-
gi|17149830|ref|NP_476510.1|      ...........-.....--....-...............................-...--..-
gi|17864094|ref|NP_064562.1|      ...........-.....--....-...............................-...--..-
gi|54607077|ref|NP_075392.2|      ...........-.....--....-...............................-...--..-
gi|31982881|ref|NP_078968.3|      ...........D.....IS....L...............................R...SRw.T
gi|20336214|ref|NP_037399.2|      ...........-.....--....-...............................-...--..-
gi|57863304|ref|NP_056340.2|      ...........-.....--....-...............................-...--..-
gi|304361757|ref|NP_001182027.1|  ...........S.....VL....A...............................V...DE..N
gi|304361760|ref|NP_001182028.1|  ...........S.....VL....A...............................V...DE..N
gi|313102995|ref|NP_001186195.1|  ...........-.....--....-...............................-...--..-
gi|20127551|ref|NP_057197.2|      ...........N.....VH....Aracgrffqkgqgt..................C...--..-
gi|38683799|ref|NP_149112.1|      ...........-.....--....-...............................-...-A..G
gi|166795254|ref|NP_110443.3|     ...........P.....VK....V...............................K...NA..Q
gi|18496983|ref|NP_056341.1|      ...........D.....VT....L...............................R...SRw.T
gi|313851097|ref|NP_001186499.1|  ...........D.....VT....L...............................R...SRw.T
gi|155969701|ref|NP_919288.2|     ...........G.....LQ....D...............................Q...DA..S
gi|30089932|ref|NP_821066.1|      ...........-.....--....-...............................-...--..-
gi|156104878|ref|NP_055720.3|     ...........-.....--....-...............................-...--..-
gi|294459971|ref|NP_001170902.1|  ...........D.....MR....R...............................Q...DS..R
gi|22547184|ref|NP_067638.3|      ...........D.....MR....R...............................Q...DS..R
gi|7661962|ref|NP_055585.1|       ...........-.....--....-...............................-...--..-
gi|117956371|ref|NP_001071154.1|  ...........-.....--....-...............................-...--..-
gi|95147559|ref|NP_787069.3|      ...........-.....--....-...............................-...--..-
gi|16418357|ref|NP_443087.1|      ...........-.....--....-...............................-...--..-
gi|170650694|ref|NP_001116244.1|  ...........-.....--....-...............................-...--..-
gi|150378537|ref|NP_001092877.1|  ...........-.....--....-...............................-...--..-
gi|80978934|ref|NP_055729.2|      ...........-.....--....-...............................-...--..-
gi|5730102|ref|NP_004612.2|       tspsqselqqdD.....FY....A...............................Y...DE..D
gi|80978930|ref|NP_001032208.1|   ...........-.....--....-...............................-...--..-
gi|269315852|ref|NP_997237.2|     ...........N.....VG....K...............................E...NR..Q
gi|255982572|ref|NP_001157637.1|  ...........R.....AC....D...............................T...GL..N
gi|7705831|ref|NP_057199.1|       ...........R.....AC....D...............................T...GL..N
gi|148806877|ref|NP_597704.1|     ...........-.....--....-...............................-...--..-
gi|156104893|ref|NP_597703.2|     ...........-.....--....-...............................-...--..-
gi|117956373|ref|NP_001071153.1|  ...........-.....--....-...............................-...--..-
gi|221136914|ref|NP_001137472.1|  ...........-.....--....-...............................-...--..-
gi|166851846|ref|NP_001071133.2|  ...........-.....--....-...............................-...--..-
gi|339275867|ref|NP_001229858.1|  ...........K.....VD....A...............................R...DH..S
gi|90991702|ref|NP_078928.3|      ...........D.....PE....-...............................-...--..-
gi|71274172|ref|NP_001025041.1|   ...........-.....--....-...............................-...--..-
gi|22547180|ref|NP_671737.1|      ...........D.....MR....R...............................Q...DS..R
gi|4507687|ref|NP_003296.1|       .spceqelqddD.....FY....A...............................Y...DE..D
gi|6912736|ref|NP_036603.1|       tlmmdtqfsefT.....--....-...............................-...--..P
gi|110227613|ref|NP_114152.3|     ...........-.....--....-...............................-...--..-
gi|194733735|ref|NP_001124170.1|  .spceqelqddD.....FY....A...............................Y...DE..D
gi|209863030|ref|NP_001129429.1|  ...........P.....S-....-...............................-...--..-
gi|209863028|ref|NP_001129428.1|  ...........P.....S-....-...............................-...--..-
gi|209863026|ref|NP_001129427.1|  ...........P.....S-....-...............................-...--..-
gi|7706747|ref|NP_057263.1|       ...........P.....S-....-...............................-...--..-
gi|209863024|ref|NP_003297.1|     ...........P.....S-....-...............................-...--..-
gi|262399375|ref|NP_001161048.1|  lspleqelrddD.....FY....A...............................Y...DE..D
gi|262399379|ref|NP_001161049.1|  lspleqelrddD.....FY....A...............................Y...DE..D
gi|9966865|ref|NP_065122.1|       lspleqelrddD.....FY....A...............................Y...DE..D
gi|25777624|ref|NP_742024.1|      ...........-.....--....-...............................-...--..-
gi|54112401|ref|NP_056030.1|      ...........-.....--....S...............................K...TF..R
gi|157743267|ref|NP_001099046.1|  ...........E.....LL....L...............................R...GDpiT
gi|110815813|ref|NP_057460.3|     ...........N.....PN....L...............................Q...TE..E
gi|269847874|ref|NP_073739.3|     ...........-.....--....-...............................-...--..-
gi|75750531|ref|NP_060314.2|      ...........R.....TD....I...............................CfppQL..S
gi|7657265|ref|NP_056137.1|       ...........-.....--....-...............................-...--..-
gi|75750529|ref|NP_057636.2|      ...........D.....VN....K...............................C...SD..E
gi|257467636|ref|NP_055646.2|     ...........D.....PR....A...............................I...SLt.E
gi|222352179|ref|NP_001138435.1|  ...........D.....PA....H...............................Q...DR..H
gi|222352177|ref|NP_001138434.1|  ...........D.....PA....H...............................Q...DR..H
gi|222352175|ref|NP_001138433.1|  ...........D.....PA....H...............................Q...DR..H
gi|222352173|ref|NP_004998.3|     ...........D.....PA....H...............................Q...DR..H
gi|61742817|ref|NP_001013424.1|   ...........-.....--....-...............................-...--..-
gi|239744064|ref|XP_001714838.2|  ...........-.....--....-...............................-...--..-
gi|222352168|ref|NP_001138432.1|  ...........-.....--....-...............................-...--..-
gi|29826341|ref|NP_055914.2|      ...........-.....--....-...............................-...--..-
gi|284005535|ref|NP_001164637.1|  ...........-.....--....-...............................-...--..-
gi|284005543|ref|NP_001164639.1|  ...........-.....--....-...............................-...--..-
gi|284005537|ref|NP_001164638.1|  ...........-.....--....-...............................-...--..-
gi|4507685|ref|NP_003295.1|       ...........S.....L-....-...............................-...--..-
gi|15042961|ref|NP_149417.1|      ...........-.....--....-...............................-...--..-
gi|312839866|ref|NP_001186166.1|  ...........-.....--....-...............................-...--..-
gi|312839869|ref|NP_001186167.1|  ...........-.....--....-...............................-...--..-
gi|312839871|ref|NP_001186168.1|  ...........-.....--....-...............................-...--..-
gi|312839873|ref|NP_001186169.1|  ...........-.....--....-...............................-...--..-
gi|109150425|ref|NP_060559.2|     ...........-.....--....-...............................-...--..-
gi|109150435|ref|NP_001035869.1|  ...........-.....--....-...............................-...--..-
gi|257467636|ref|NP_055646.2|     ...........-.....--....-...............................-...--..-
gi|294459965|ref|NP_001170899.1|  ...........D.....MR....R...............................Q...DS..R
gi|209863032|ref|NP_001129430.1|  ...........-.....--....-...............................-...--..-
gi|148664230|ref|NP_055929.1|     ...........-.....--....-...............................-...--..-
gi|114842396|ref|NP_694960.2|     ...........D.....LN....T...............................P...NS..E
gi|294459977|ref|NP_001170904.1|  ...........D.....MR....R...............................Q...DS..R
gi|22748713|ref|NP_689539.1|      ...........-.....--....-...............................-...--..-
gi|224465235|ref|NP_001138999.1|  ...........-.....--....-...............................-...--..-
gi|98985804|ref|NP_478104.2|      ...........-.....--....-...............................-...--..-
gi|17981696|ref|NP_511042.1|      ...........-.....--....-...............................-...--..-
gi|260763963|ref|NP_001120979.2|  ...........-.....--....-...............................-...--..-
gi|27477049|ref|NP_543144.1|      ...........-.....--....-...............................-...--..-
gi|260763966|ref|NP_001077376.2|  ...........-.....--....-...............................-...--..-
gi|260763960|ref|NP_060405.4|     ...........-.....--....-...............................-...--..-
gi|75750531|ref|NP_060314.2|      ...........-.....--....-...............................-...--..-


                                    40                                                            15
                                     |                                                              
d1s70b_                             GD..TP..................................LDIA..EEE...............
gi|21361135|ref|NP_002494.2|      GH..TA..................................LHLA..CRV...............
gi|70780355|ref|NP_065210.2|      GL..TP..................................LHVA..VHH...............
gi|215598574|ref|NP_001135918.1|  GL..TP..................................LHVA..VHH...............
gi|70780353|ref|NP_065208.2|      GL..TP..................................LHVA..VHH...............
gi|70780359|ref|NP_065209.2|      GL..TP..................................LHVA..VHH...............
gi|70780357|ref|NP_000028.3|      GL..TP..................................LHVA..VHH...............
gi|325053666|ref|NP_001191332.1|  GY..TP..................................LHIA..AKK...............
gi|325053668|ref|NP_001191333.1|  GY..TP..................................LHIA..AKK...............
gi|32967601|ref|NP_066267.2|      GY..TP..................................LHIA..AKK...............
gi|188595682|ref|NP_001120965.1|  GY..TP..................................LHIA..AKK...............
gi|52426737|ref|NP_066187.2|      GY..TP..................................LHIA..AKK...............
gi|52426735|ref|NP_001139.3|      GY..TP..................................LHIA..AKK...............
gi|268607595|ref|NP_001161354.1|  GR..NA..................................LRVA..ALE...............
gi|62988328|ref|NP_065070.1|      GR..NA..................................LRVA..ALE...............
gi|48928017|ref|NP_001001716.1|   GH..TA..................................LHLA..CRV...............
gi|70780353|ref|NP_065208.2|      GI..TP..................................LHIA..SRR...............
gi|70780355|ref|NP_065210.2|      GI..TP..................................LHIA..SRR...............
gi|70780359|ref|NP_065209.2|      GI..TP..................................LHIA..SRR...............
gi|70780357|ref|NP_000028.3|      GI..TP..................................LHIA..SRR...............
gi|215598574|ref|NP_001135918.1|  GI..TP..................................LHIA..SRR...............
gi|325053668|ref|NP_001191333.1|  GL..TP..................................LHCG..ARS...............
gi|32967601|ref|NP_066267.2|      GL..TP..................................LHCG..ARS...............
gi|304434687|ref|NP_710181.2|     GY..TP..................................LHAA..ASN...............
gi|30425444|ref|NP_848605.1|      GK..TP..................................LHVA..AYF...............
gi|304361757|ref|NP_001182027.1|  GK..TP..................................LHMT..ALH...............
gi|304361760|ref|NP_001182028.1|  GK..TP..................................LHMT..ALH...............
gi|46519151|ref|NP_060448.1|      MH..TA..................................LMEA..CMD...............
gi|46519154|ref|NP_078944.2|      MH..TA..................................LMEA..CMD...............
gi|157743284|ref|NP_775866.2|     GN..TA..................................LHIA..CYL...............
gi|55741641|ref|NP_065789.1|      GT..TP..................................LVWA..ARK...............
gi|10863929|ref|NP_066956.1|      GA..TA..................................LMDA..AEK...............
gi|308044526|ref|NP_001183959.1|  KE..SA..................................LTLA..CYK...............
gi|41327754|ref|NP_065690.2|      AW..LP..................................LHYA..AWQ...............
gi|38683816|ref|NP_942592.1|      GI..SP..................................LMLA..AMN...............
gi|38683807|ref|NP_115593.3|      GI..SP..................................LMLA..AMN...............
gi|304434690|ref|NP_001182073.1|  GR..TA..................................LHHA..ALN...............
gi|46519147|ref|NP_060217.1|      CS..TP..................................LMEA..SQE...............
gi|37620163|ref|NP_065741.3|      CS..TP..................................LMEA..SQE...............
gi|304361757|ref|NP_001182027.1|  GR..TA..................................LHRG..AVT...............
gi|304361760|ref|NP_001182028.1|  GR..TA..................................LHRG..AVT...............
gi|37620163|ref|NP_065741.3|      RN..TA..................................LTLA..CFQ...............
gi|46519147|ref|NP_060217.1|      RN..TA..................................LTLA..CFQ...............
gi|68131557|ref|NP_056014.2|      GR..TA..................................LHHA..AFS...............
gi|96975023|ref|NP_874362.3|      GL..TA..................................LHSA..AGG...............
gi|10092619|ref|NP_065390.1|      --..--..................................----..---...............
gi|38683816|ref|NP_942592.1|      KE..SA..................................LTLA..CYK...............
gi|38683807|ref|NP_115593.3|      KE..SA..................................LTLA..CYK...............
gi|157739945|ref|NP_079461.2|     GA..VP..................................LFST..VRQ...............
gi|18252778|ref|NP_057234.2|      GW..TA..................................LHES..VSR...............
gi|89363047|ref|NP_004929.2|      GE..TP..................................LLTA..SAR...............
gi|321117514|ref|NP_001189358.1|  GW..TA..................................LHES..VSR...............
gi|223634006|ref|NP_001138682.1|  GW..TA..................................AHWA..AAG...............
gi|341914599|ref|XP_001714535.3|  GN..TA..................................LHLA..AKH...............
gi|341915319|ref|XP_001128459.4|  GN..TA..................................LHLA..AKH...............
gi|34304379|ref|NP_899068.1|      KH..TP..................................LFRA..CEM...............
gi|225543463|ref|NP_001139381.1|  GV..PP..................................LFCA..ARQ...............
gi|34304381|ref|NP_055240.2|      KH..TP..................................LFRA..CEM...............
gi|225543461|ref|NP_203752.2|     GV..PP..................................LFCA..ARQ...............
gi|325053666|ref|NP_001191332.1|  GL..SP..................................LHMA..TQG...............
gi|68131557|ref|NP_056014.2|      GY..TA..................................LHWA..CYN...............
gi|52426735|ref|NP_001139.3|      GL..SP..................................LHMA..AQG...............
gi|4506217|ref|NP_002805.1|       GC..TP..................................LHYA..ASK...............
gi|188595682|ref|NP_001120965.1|  GL..SP..................................LHMA..AQG...............
gi|52426737|ref|NP_066187.2|      GL..SP..................................LHMA..AQG...............
gi|224465233|ref|NP_079033.4|     GW..TP..................................MIWA..TEY...............
gi|164664508|ref|NP_005169.2|     GL..TA..................................LHVA..VNT...............
gi|7705748|ref|NP_057062.1|       DH..VP..................................LHFC..SRF...............
gi|313569861|ref|NP_001186256.1|  DH..VP..................................LHFC..SRF...............
gi|163914396|ref|NP_001106279.1|  DH..VP..................................LHFC..SRF...............
gi|87239981|ref|NP_003738.2|      GF..TAaqmgneavqqilsestpirtsdvdyr........LLEA..SKA...............
gi|13376842|ref|NP_079511.1|      GF..TAlqmgnenvqqllqegislgnseadrq........LLEA..AKA...............
gi|7705831|ref|NP_057199.1|       GW..NS..................................LHQA..SFQ...............
gi|255982572|ref|NP_001157637.1|  GW..NS..................................LHQA..SFQ...............
gi|338797777|ref|NP_001229742.1|  GN..TA..................................LHLA..CQN...............
gi|338797775|ref|NP_055757.3|     GN..TA..................................LHLA..CQN...............
gi|338797766|ref|NP_001229738.1|  GN..TA..................................LHLA..CQN...............
gi|338797770|ref|NP_001229740.1|  GN..TA..................................LHLA..CQN...............
gi|206597522|ref|NP_001128663.1|  --..--..................................----..---...............
gi|4502249|ref|NP_003878.1|       --..--..................................----..---...............
gi|304434690|ref|NP_001182073.1|  GY..TP..................................LHWA..CYN...............
gi|157743284|ref|NP_775866.2|     GY..SP..................................MHWA..SYT...............
gi|46094081|ref|NP_060952.2|      --..--..................................----..---...............
gi|13376842|ref|NP_079511.1|      GR..TAldladpsakavltgeykkde..............LLES..ARS...............
gi|87239981|ref|NP_003738.2|      GK..SAldladpsakavltgeykkde..............LLEA..ARS...............
gi|156142197|ref|NP_006700.3|     GW..TP..................................IIWA..AEH...............
gi|156142199|ref|NP_079532.5|     GW..TP..................................IIWA..AEH...............
gi|92087060|ref|NP_563616.3|      GA..SV..................................LFEA..AGG...............
gi|70995267|ref|NP_775776.2|      GA..TA..................................LFLA..AQG...............
gi|219842212|ref|NP_001137357.1|  GD..TP..................................LDIA..EEE...............
gi|4505317|ref|NP_002471.1|       GD..TP..................................LDIA..EEE...............
gi|116534990|ref|NP_015628.2|     GC..FP..................................IHQA..AFS...............
gi|282394038|ref|NP_001164160.1|  SD..TP..................................LHSA..ISA...............
gi|282394032|ref|NP_001164157.1|  SD..TP..................................LHSA..ISA...............
gi|282394030|ref|NP_543151.2|     SD..TP..................................LHSA..ISA...............
gi|282394036|ref|NP_001164159.1|  SD..TP..................................LHSA..ISA...............
gi|282394034|ref|NP_001164158.1|  SD..TP..................................LHSA..ISA...............
gi|58331111|ref|NP_061919.1|      GW..NSfhiasregdplilqylltvcpgawkteskirrtpLHTA..AMH...............
gi|58331113|ref|NP_001009941.1|   GW..NSfhiasregdplilqylltvcpgawkteskirrtpLHTA..AMH...............
gi|268607595|ref|NP_001161354.1|  GW..TA..................................LRSA..AWG...............
gi|62988328|ref|NP_065070.1|      GW..TA..................................LRSA..AWG...............
gi|221307473|ref|NP_001137250.1|  --..--..................................----..---...............
gi|19923540|ref|NP_060177.2|      --..--..................................----..---...............
gi|140161500|ref|NP_056060.2|     FE..TP..................................LDLA..ALY...............
gi|224809478|ref|NP_001138997.1|  GK..TA..................................LHYA..AAQ...............
gi|224809468|ref|NP_056392.2|     GK..TA..................................LHYA..AAQ...............
gi|224809470|ref|NP_001138992.1|  GK..TA..................................LHYA..AAQ...............
gi|224809472|ref|NP_001138993.1|  GK..TA..................................LHYA..AAQ...............
gi|224809474|ref|NP_001138994.1|  GK..TA..................................LHYA..AAQ...............
gi|18079216|ref|NP_065815.1|      GK..TP..................................LDLA..CEF...............
gi|224809476|ref|NP_001138995.1|  GK..TA..................................LHYA..AAQ...............
gi|217416347|ref|NP_065804.2|     KK..TP..................................LDLA..CEF...............
gi|341915690|ref|XP_003403588.1|  GN..TA..................................LHYA..IYN...............
gi|239745058|ref|XP_002343353.1|  GN..TA..................................LHYA..IYN...............
gi|341915688|ref|XP_003403587.1|  GN..TA..................................LHYA..IYN...............
gi|310118968|ref|XP_003118905.1|  GR..TA..................................LHYA..VYN...............
gi|30348954|ref|NP_065825.1|      GD..TP..................................LHDA..ISK...............
gi|310118966|ref|XP_001717815.3|  GR..TA..................................LHYA..VYN...............