SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Ankyrin repeat alignments in Dipodomys ordii 76_1

These alignments are sequences aligned to the 0049331 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1s70b_               mkmada........................................................................
ENSDORP00000001438  gy............................................................................
ENSDORP00000003161  ltplhvasfmghlpivknllqrgaspnvsnvkvet...........................................
ENSDORP00000013687  alcvpaskghasvvsllidrgaevdhcdkdgmt.............................................
ENSDORP00000003291  lt............................................................................
ENSDORP00000015829  rfaagtey......................................................................
ENSDORP00000006395  gnt...........................................................................
ENSDORP00000006395  xeeq..........................................................................
ENSDORP00000007897  qdvdlaldggasl.................................................................
ENSDORP00000012171  xanvnakdtlwlt.................................................................
ENSDORP00000015191  t.............................................................................
ENSDORP00000005511  v.............................................................................
ENSDORP00000001089  snhdt.........................................................................
ENSDORP00000001089  ..............................................................................
ENSDORP00000012094  f.............................................................................
ENSDORP00000003161  xn............................................................................
ENSDORP00000008111  e.............................................................................
ENSDORP00000010887  ..............................................................................
ENSDORP00000015756  ..............................................................................
ENSDORP00000003012  ..............................................................................
ENSDORP00000003803  ..............................................................................
ENSDORP00000012171  s.............................................................................
ENSDORP00000010887  ..............................................................................
ENSDORP00000010328  ..............................................................................
ENSDORP00000010714  q.............................................................................
ENSDORP00000005245  h.............................................................................
ENSDORP00000012790  ..............................................................................
ENSDORP00000001687  nrrdq.........................................................................
ENSDORP00000000524  ..............................................................................
ENSDORP00000002516  ..............................................................................
ENSDORP00000007933  i.............................................................................
ENSDORP00000001938  vf............................................................................
ENSDORP00000002146  v.............................................................................
ENSDORP00000006986  ..............................................................................
ENSDORP00000013687  qevlqllvkagahvnsederascivrqale................................................
ENSDORP00000011695  ddystwd.......................................................................
ENSDORP00000003709  ltye..........................................................................
ENSDORP00000012607  ..............................................................................
ENSDORP00000012790  s.............................................................................
ENSDORP00000001046  a.............................................................................
ENSDORP00000012574  vasrdgdvatlerlleagalgpgitdalgaglv.............................................
ENSDORP00000012710  lhv...........................................................................
ENSDORP00000008802  nknd..........................................................................
ENSDORP00000012790  x.............................................................................
ENSDORP00000000031  cdiv..........................................................................
ENSDORP00000013942  xxx...........................................................................
ENSDORP00000000883  sdtcst........................................................................
ENSDORP00000012440  aedvdltmv.....................................................................
ENSDORP00000010065  slmlkglcpsq...................................................................
ENSDORP00000015111  k.............................................................................
ENSDORP00000014007  ..............................................................................
ENSDORP00000008737  qgsw..........................................................................
ENSDORP00000010826  m.............................................................................
ENSDORP00000003161  ts............................................................................
ENSDORP00000002055  xsad..........................................................................
ENSDORP00000011259  ..............................................................................
ENSDORP00000014237  pl............................................................................
ENSDORP00000007536  lftsplmgd.....................................................................
ENSDORP00000004979  ..............................................................................
ENSDORP00000010830  v.............................................................................
ENSDORP00000008769  ..............................................................................
ENSDORP00000009839  q.............................................................................
ENSDORP00000015161  emflk.........................................................................
ENSDORP00000001718  ..............................................................................
ENSDORP00000002537  fqhkhsk.......................................................................
ENSDORP00000001580  h.............................................................................
ENSDORP00000009438  vgeeealshlt...................................................................
ENSDORP00000002055  t.............................................................................
ENSDORP00000015480  kk............................................................................
ENSDORP00000012408  v.............................................................................
ENSDORP00000002055  iid...........................................................................
ENSDORP00000013812  le............................................................................
ENSDORP00000013528  m.............................................................................
ENSDORP00000000083  aairsfph......................................................................
ENSDORP00000003321  apel..........................................................................
ENSDORP00000011353  pnr...........................................................................
ENSDORP00000007355  r.............................................................................
ENSDORP00000007546  ecixxxx.......................................................................
ENSDORP00000009016  na............................................................................
ENSDORP00000011081  k.............................................................................
ENSDORP00000011018  x.............................................................................
ENSDORP00000003291  r.............................................................................
ENSDORP00000008149  x.............................................................................
ENSDORP00000014950  vl............................................................................
ENSDORP00000012171  ih............................................................................
ENSDORP00000014237  x.............................................................................
ENSDORP00000007749  xl............................................................................
ENSDORP00000015309  ..............................................................................
ENSDORP00000007119  nv............................................................................
ENSDORP00000011018  de............................................................................
ENSDORP00000002435  tdli..........................................................................
ENSDORP00000014274  ..............................................................................
ENSDORP00000004702  x.............................................................................
ENSDORP00000013942  ..............................................................................
ENSDORP00000011332  ytlmp.........................................................................
ENSDORP00000014237  kq............................................................................
ENSDORP00000014578  m.............................................................................
ENSDORP00000005457  kr............................................................................
ENSDORP00000015160  dgsccshsgavpgvqqtleemdferg....................................................
ENSDORP00000011906  ddr...........................................................................
ENSDORP00000012571  dpsk..........................................................................
ENSDORP00000012644  vmm...........................................................................
ENSDORP00000007538  ad............................................................................
ENSDORP00000009863  qgemlylatrieqenv..............................................................
ENSDORP00000010305  ytp...........................................................................
ENSDORP00000011587  ..............................................................................
ENSDORP00000000485  q.............................................................................
ENSDORP00000014531  vgk...........................................................................
ENSDORP00000012009  cdke..........................................................................
ENSDORP00000009257  ..............................................................................
ENSDORP00000008161  qnllqq........................................................................
ENSDORP00000009839  sninfitk......................................................................
ENSDORP00000001630  vs............................................................................
ENSDORP00000012903  l.............................................................................
ENSDORP00000010147  nkw...........................................................................
ENSDORP00000008900  lrds..........................................................................
ENSDORP00000004243  ..............................................................................
ENSDORP00000008700  wr............................................................................
ENSDORP00000008105  tgeqdwdqnldnlym...............................................................
ENSDORP00000002464  lp............................................................................
ENSDORP00000008204  ..............................................................................
ENSDORP00000001653  ..............................................................................
ENSDORP00000013463  lvltellek.....................................................................
ENSDORP00000013412  dnaaklhslceavktrdifgllqayadgvdltekiplanghxxxxxxxxxxxxxxxxxxxxxxxxxxxxxgn......
ENSDORP00000007180  k.............................................................................
ENSDORP00000000309  rglsavfhtfgrkts...............................................................
ENSDORP00000008007  kksf..........................................................................
ENSDORP00000010007  x.............................................................................
ENSDORP00000013572  knifd.........................................................................
ENSDORP00000002756  esid..........................................................................
ENSDORP00000008159  tr............................................................................
ENSDORP00000013968  q.............................................................................
ENSDORP00000010487  x.............................................................................
ENSDORP00000001351  hqla..........................................................................
ENSDORP00000009580  lvve..........................................................................
ENSDORP00000006712  x.............................................................................
ENSDORP00000014166  ga............................................................................
ENSDORP00000013444  kegqisllphlaadnld.............................................................
ENSDORP00000004275  nfrk..........................................................................
ENSDORP00000001355  xl............................................................................
ENSDORP00000013087  lldsslege.....................................................................
ENSDORP00000003943  h.............................................................................
ENSDORP00000009340  xx............................................................................
ENSDORP00000008149  tpn...........................................................................
ENSDORP00000015559  tfl...........................................................................
ENSDORP00000006156  c.............................................................................
ENSDORP00000002459  ..............................................................................
ENSDORP00000011514  nv............................................................................
ENSDORP00000007506  l.............................................................................
ENSDORP00000014195  n.............................................................................
ENSDORP00000010305  ssl...........................................................................
ENSDORP00000011086  hirqgdlaqvgr..................................................................
ENSDORP00000003906  ..............................................................................
ENSDORP00000007061  s.............................................................................
ENSDORP00000008791  ll............................................................................
ENSDORP00000011286  ptaklnelleaiksrdllalvqvyaegvelmepllepgq.......................................
ENSDORP00000010487  s.............................................................................
ENSDORP00000001046  ..............................................................................
ENSDORP00000013206  na............................................................................
ENSDORP00000000302  tmada.........................................................................
ENSDORP00000004396  hisivkhlrhsawpptllqmvhtlasngansiwehslldpaqvqsgrrkanpqdkvhpiksefirakyqmlafvhklp
ENSDORP00000009263  as............................................................................
ENSDORP00000005406  dcirsidtdalidaidtga...........................................................
ENSDORP00000011018  ede...........................................................................
ENSDORP00000007862  l.............................................................................
ENSDORP00000005974  aitk..........................................................................
ENSDORP00000015386  g.............................................................................
ENSDORP00000004934  iwnhdgwaelflaaaegdpsklsslgvsedssfrtahaqalrgeqwtq..............................
ENSDORP00000007749  q.............................................................................
ENSDORP00000011209  k.............................................................................
ENSDORP00000014950  rr............................................................................
ENSDORP00000004508  edetf.........................................................................
ENSDORP00000010830  gnfkrcinlwkyaldmqqsnldplspmtassllsfaelfsfmlq..................................
ENSDORP00000008316  akdlskq.......................................................................
ENSDORP00000011647  q.............................................................................
ENSDORP00000001838  n.............................................................................
ENSDORP00000007356  tdeyy.........................................................................
ENSDORP00000007453  n.............................................................................
ENSDORP00000009265  qndtisllldiaqqtgsldefvnasytd..................................................
ENSDORP00000006222  v.............................................................................
ENSDORP00000010465  ..............................................................................
ENSDORP00000005903  diyy..........................................................................
ENSDORP00000006810  ..............................................................................
ENSDORP00000000618  knpnskd.......................................................................
ENSDORP00000005027  llr...........................................................................
ENSDORP00000014908  ld............................................................................
ENSDORP00000013576  ..............................................................................
ENSDORP00000015191  qv............................................................................
ENSDORP00000001718  tdclf.........................................................................
ENSDORP00000004586  haw...........................................................................
ENSDORP00000010461  s.............................................................................
ENSDORP00000011519  lfgr..........................................................................
ENSDORP00000010487  xan...........................................................................
ENSDORP00000015746  x.............................................................................
ENSDORP00000008684  n.............................................................................
ENSDORP00000001089  xanvnrata.....................................................................
ENSDORP00000007061  ve............................................................................
ENSDORP00000011837  l.............................................................................
ENSDORP00000000883  nwq...........................................................................
ENSDORP00000008319  a.............................................................................
ENSDORP00000011516  ..............................................................................
ENSDORP00000005420  gldvdagqp.....................................................................
ENSDORP00000014434  flk...........................................................................
ENSDORP00000012876  faa...........................................................................
ENSDORP00000002492  al............................................................................
ENSDORP00000009438  y.............................................................................
ENSDORP00000006616  sa............................................................................
ENSDORP00000014346  k.............................................................................
ENSDORP00000005715  adse..........................................................................
ENSDORP00000007659  ll............................................................................
ENSDORP00000000137  qpelwd........................................................................
ENSDORP00000011634  i.............................................................................
ENSDORP00000007355  ek............................................................................
ENSDORP00000001096  e.............................................................................
ENSDORP00000007335  n.............................................................................
ENSDORP00000001630  tk............................................................................
ENSDORP00000010887  x.............................................................................
ENSDORP00000013121  kkileenssg....................................................................
ENSDORP00000007683  glrp..........................................................................
ENSDORP00000002834  x.............................................................................
ENSDORP00000014071  x.............................................................................
ENSDORP00000000198  f.............................................................................
ENSDORP00000006712  qkrn..........................................................................
ENSDORP00000009930  sslevslpr.....................................................................
ENSDORP00000010221  n.............................................................................


                              10        20                                                       30 
                               |         |                                                        | 
d1s70b_               ------KQKRNEQLKRWIGSETDLEPPV...............................................VKR
ENSDORP00000001438  ----------------------------...............................................---
ENSDORP00000003161  PLHMAARAGHTEVAKYLLQNKAKVNAKAkddqtplhcaaihtnmvkllleyplattaghtplhtaareghdtlllEKD
ENSDORP00000013687  PLLVAAYEGHVDVVDLLLEGGADVDHTDhngrtpllaaasmghasvvntllf.......................WGA
ENSDORP00000003291  PIHVAAFMGHVNIVSQLMHHGASPNT--...............................................---
ENSDORP00000015829  ----------------------------...............................................---
ENSDORP00000006395  ALHIASLAGQAEVVKVLVKEGANINA--...............................................---
ENSDORP00000006395  ----------------------------...............................................---
ENSDORP00000007897  -LHLAVEAGQEECVKWLLLNNANPNL--...............................................---
ENSDORP00000012171  PLHRAAASRNEKVLGLLLAHSADVNARDklwqtplhvaaanratkcaealap.......................LLS
ENSDORP00000015191  ALHWSAYYNNPEHVKLLIKHDSNIGIPDvegkiplhwaanhkdpsavhtvrcildaap.................TES
ENSDORP00000005511  --IQAVREEDVDGLRRLLEGGADANE--...............................................---
ENSDORP00000001089  ALTLACAGGHEELVSVLIARDAKIEH--...............................................---
ENSDORP00000001089  -LAEACSDGDVNAVRKLLDEGRSVNE--...............................................---
ENSDORP00000012094  ----------------------------...............................................---
ENSDORP00000003161  ----------------------------...............................................---
ENSDORP00000008111  ----------------------------...............................................---
ENSDORP00000010887  -LLEACRNGDVSRVKRLVDAANVNAKD-...............................................---
ENSDORP00000015756  AIIHAINDDNVPGLQHLLGSLSNYDVNQpnkxxxxxxxxxxxxxxxxxxxxxxx.....................XXX
ENSDORP00000003012  AIIHAINDDNVPGLQHLLGSLSNYDVNQpnkxxxxxxxxxxxxxxxxxxxxxxx.....................XXX
ENSDORP00000003803  -LILAVKNGDVTCVQKLVAKVKAAKTKLlgst...........................................KRL
ENSDORP00000012171  --------GHTDSLHLLIDSGERADI--...............................................---
ENSDORP00000010887  -LLQAAREADLAKVKKTLALEIINFK--...............................................---
ENSDORP00000010328  ----------------------------...............................................---
ENSDORP00000010714  -LYLSVKQGELQKVILMLLDNLDPNFQ-...............................................---
ENSDORP00000005245  ----------------------------...............................................---
ENSDORP00000012790  ----------------------------...............................................---
ENSDORP00000001687  ----------------------------...............................................---
ENSDORP00000000524  ----------------------------...............................................---
ENSDORP00000002516  PLIIAARNGHAKVVRLLLEHYRVQTQQT...............................................GTV
ENSDORP00000007933  --QAAVAAGDVHTVRKMLEQGYSPNG--...............................................---
ENSDORP00000001938  ----------------------------...............................................---
ENSDORP00000002146  ----------------------------...............................................---
ENSDORP00000006986  ----------------------------...............................................---
ENSDORP00000013687  ----------------------------...............................................---
ENSDORP00000011695  ----------------------------...............................................---
ENSDORP00000003709  ----------------------------...............................................---
ENSDORP00000012607  ----------------------------...............................................---
ENSDORP00000012790  ----------------------------...............................................---
ENSDORP00000001046  -LQLAIRNQLPLVVDAICTRGADMSV--...............................................---
ENSDORP00000012574  --HHATRAGHLDCVKFLVERAKLPSNQ-...............................................---
ENSDORP00000012710  ----------------------------...............................................---
ENSDORP00000008802  ----------------------------...............................................---
ENSDORP00000012790  ----------------------------...............................................---
ENSDORP00000000031  ----------------------------...............................................---
ENSDORP00000013942  ----------------------------...............................................---
ENSDORP00000000883  ----------------------------...............................................---
ENSDORP00000012440  --YQAASNGDVNALTAVIREDPSILEC-...............................................---
ENSDORP00000010065  ----------------------------...............................................---
ENSDORP00000015111  ----------------------------...............................................---
ENSDORP00000014007  ----------------------------...............................................---
ENSDORP00000008737  ----------------------------...............................................---
ENSDORP00000010826  ----------------------------...............................................---
ENSDORP00000003161  -FLRAARSGNLDKALDHLRNGVDINT--...............................................---
ENSDORP00000002055  ----------------------------...............................................---
ENSDORP00000011259  ----------------------------...............................................---
ENSDORP00000014237  ----------------------------...............................................---
ENSDORP00000007536  ----------------------------...............................................---
ENSDORP00000004979  ----------------------------...............................................---
ENSDORP00000010830  --FNAARDGNLRMLTNMLTSKSKEEV--...............................................--S
ENSDORP00000008769  ----------------------------...............................................---
ENSDORP00000009839  ----CVRNKDKKQIEKLTKLGYPELI--...............................................---
ENSDORP00000015161  ----------------------------...............................................---
ENSDORP00000001718  ----------------------------...............................................---
ENSDORP00000002537  ----------------------------...............................................---
ENSDORP00000001580  ----------------------------...............................................---
ENSDORP00000009438  ---------------------------T...............................................CHS
ENSDORP00000002055  ----------------------------...............................................---
ENSDORP00000015480  ----------------------------...............................................---
ENSDORP00000012408  --HNALFSGDLQQVQALFQDEEAANMIVetvnnqlawsae...................................QGF
ENSDORP00000002055  ----------------------------...............................................---
ENSDORP00000013812  ----ALKSNDFGKLKAILIQRLIDVDTVfevedenmvlasykqg...............................YWL
ENSDORP00000013528  ----------------------------...............................................---
ENSDORP00000000083  ----------------------------...............................................---
ENSDORP00000003321  ----------------------------...............................................---
ENSDORP00000011353  ----------------------------...............................................---
ENSDORP00000007355  ----------------------------...............................................---
ENSDORP00000007546  ----------------------------...............................................---
ENSDORP00000009016  ----------------------------...............................................---
ENSDORP00000011081  ----------------------------...............................................---
ENSDORP00000011018  ----------------------------...............................................---
ENSDORP00000003291  ----------------------------...............................................---
ENSDORP00000008149  ----------------------------...............................................---
ENSDORP00000014950  ---KAIKEGNEEALKVMIKDGKNLAE--...............................................---
ENSDORP00000012171  ----------------------------...............................................---
ENSDORP00000014237  ----------------------------...............................................---
ENSDORP00000007749  ----------------------------...............................................---
ENSDORP00000015309  -LYEAIIKEDCPTIMALLRHHPVNQPLTilsnst.........................................SYR
ENSDORP00000007119  ----------------------------...............................................---
ENSDORP00000011018  ----------------------------...............................................---
ENSDORP00000002435  ----------------------------...............................................---
ENSDORP00000014274  ----------------------------...............................................---
ENSDORP00000004702  ----------------------------...............................................---
ENSDORP00000013942  ----------------------------...............................................---
ENSDORP00000011332  ----MVMADQHRSVSELLSNS-------...............................................---
ENSDORP00000014237  ----------------------------...............................................---
ENSDORP00000014578  ----------------------------...............................................---
ENSDORP00000005457  ----------------------------...............................................---
ENSDORP00000015160  ----------------------------...............................................---
ENSDORP00000011906  ----------------------------...............................................---
ENSDORP00000012571  ----------------------------...............................................---
ENSDORP00000012644  ----------------------------...............................................---
ENSDORP00000007538  ----------------------------...............................................---
ENSDORP00000009863  ----------------------------...............................................---
ENSDORP00000010305  ----------------------------...............................................---
ENSDORP00000011587  ----------------------------...............................................---
ENSDORP00000000485  ----------------------------...............................................---
ENSDORP00000014531  ----------------------------...............................................---
ENSDORP00000012009  ----------------------------...............................................---
ENSDORP00000009257  -LVKAAANGDVAKVEDLLKRPDVDVN--...............................................---
ENSDORP00000008161  ----------------------------...............................................---
ENSDORP00000009839  ----------------------------...............................................---
ENSDORP00000001630  ----------------------------...............................................---
ENSDORP00000012903  ----------------------------...............................................---
ENSDORP00000010147  ----------------------------...............................................---
ENSDORP00000008900  ----------------------------...............................................---
ENSDORP00000004243  ----------------------------...............................................---
ENSDORP00000008700  ----------------------------...............................................---
ENSDORP00000008105  ----------------------------...............................................---
ENSDORP00000002464  ----------------------------...............................................---
ENSDORP00000008204  ----------------------------...............................................---
ENSDORP00000001653  PICQAAYQNDLGQVWQWVKTDNNYIN--...............................................---
ENSDORP00000013463  --------------------KAHSPF--...............................................---
ENSDORP00000013412  ----------------------------...............................................---
ENSDORP00000007180  ----------------------------...............................................---
ENSDORP00000000309  ----------------------------...............................................---
ENSDORP00000008007  ----------------------------...............................................---
ENSDORP00000010007  ----------------------------...............................................---
ENSDORP00000013572  ----------------------------...............................................---
ENSDORP00000002756  ----------------------------...............................................---
ENSDORP00000008159  ----------------------------...............................................---
ENSDORP00000013968  ----------------------------...............................................---
ENSDORP00000010487  ----------------------------...............................................---
ENSDORP00000001351  ----------------------------...............................................---
ENSDORP00000009580  -----AALGNVARALDLLRRHPEQVD--...............................................---
ENSDORP00000006712  ----------------------------...............................................---
ENSDORP00000014166  ----------------------------...............................................---
ENSDORP00000013444  ----------------------------...............................................---
ENSDORP00000004275  ----------------------------...............................................---
ENSDORP00000001355  ----------------------------...............................................---
ENSDORP00000013087  ----------------------------...............................................---
ENSDORP00000003943  ----------------------------...............................................---
ENSDORP00000009340  ----------------------------...............................................---
ENSDORP00000008149  ----------------------------...............................................---
ENSDORP00000015559  ----------------------------...............................................---
ENSDORP00000006156  ----------------------------...............................................---
ENSDORP00000002459  ----------------------------...............................................---
ENSDORP00000011514  ----------------------------...............................................---
ENSDORP00000007506  ----------------------------...............................................---
ENSDORP00000014195  ----------------------------...............................................---
ENSDORP00000010305  ----------------------------...............................................---
ENSDORP00000011086  ----------------------------...............................................---
ENSDORP00000003906  PLLQPALTGDVEGLQKIFEDPENPHHEN...............................................AMQ
ENSDORP00000007061  ----------------------------...............................................---
ENSDORP00000008791  ----------------------------...............................................---
ENSDORP00000011286  ----------------------------...............................................---
ENSDORP00000010487  ----------------------------...............................................---
ENSDORP00000001046  ----------------------------...............................................---
ENSDORP00000013206  ----------------------------...............................................---
ENSDORP00000000302  ----------------------------...............................................---
ENSDORP00000004396  ----------------------------...............................................---
ENSDORP00000009263  ----------------------------...............................................---
ENSDORP00000005406  ----------------------------...............................................---
ENSDORP00000011018  ----------------------------...............................................---
ENSDORP00000007862  ----------------------------...............................................---
ENSDORP00000005974  ----------------------------...............................................---
ENSDORP00000015386  ----------------------------...............................................---
ENSDORP00000004934  ----------------------------...............................................---
ENSDORP00000007749  ----------------------------...............................................---
ENSDORP00000011209  ----------------------------...............................................---
ENSDORP00000014950  ----------------------------...............................................---
ENSDORP00000004508  ----------------------------...............................................---
ENSDORP00000010830  ----------------------------...............................................---
ENSDORP00000008316  ----------------------------...............................................---
ENSDORP00000011647  ----------------------------...............................................---
ENSDORP00000001838  ----------------------------...............................................---
ENSDORP00000007356  ----------------------------...............................................---
ENSDORP00000007453  ----------------------------...............................................---
ENSDORP00000009265  ----------------------------...............................................---
ENSDORP00000006222  ----------------------------...............................................---
ENSDORP00000010465  ----------------------------...............................................---
ENSDORP00000005903  ----------------------------...............................................---
ENSDORP00000006810  ----------------------------...............................................---
ENSDORP00000000618  ----------------------------...............................................---
ENSDORP00000005027  ----------------------------...............................................---
ENSDORP00000014908  ----------------------------...............................................---
ENSDORP00000013576  ----------------------------...............................................---
ENSDORP00000015191  ----------------------------...............................................---
ENSDORP00000001718  ----------------------------...............................................---
ENSDORP00000004586  ----------------------------...............................................---
ENSDORP00000010461  ----------------------------...............................................---
ENSDORP00000011519  ----------------------------...............................................---
ENSDORP00000010487  ----------------------------...............................................---
ENSDORP00000015746  ----------------------------...............................................---
ENSDORP00000008684  ----AVEKGDYASVKKSLEEAEIYFK--...............................................---
ENSDORP00000001089  ----------------------------...............................................---
ENSDORP00000007061  ----------------------------...............................................---
ENSDORP00000011837  ----------------------------...............................................---
ENSDORP00000000883  ----------------------------...............................................---
ENSDORP00000008319  ----------------------------...............................................---
ENSDORP00000011516  ----------------------------...............................................---
ENSDORP00000005420  ----------------------------...............................................---
ENSDORP00000014434  ----------------------------...............................................---
ENSDORP00000012876  ----------------------------...............................................---
ENSDORP00000002492  ----------------------------...............................................---
ENSDORP00000009438  ----------------------------...............................................---
ENSDORP00000006616  ----------------------------...............................................---
ENSDORP00000014346  ----------------------------...............................................---
ENSDORP00000005715  ----------------------------...............................................---
ENSDORP00000007659  ----------------------------...............................................---
ENSDORP00000000137  ----------------------------...............................................---
ENSDORP00000011634  ----------------------------...............................................---
ENSDORP00000007355  ----------------------------...............................................---
ENSDORP00000001096  ----------------------------...............................................---
ENSDORP00000007335  ----------------------------...............................................---
ENSDORP00000001630  ----------------------------...............................................---
ENSDORP00000010887  ----------------------------...............................................---
ENSDORP00000013121  ----------------------------...............................................---
ENSDORP00000007683  ----------------------------...............................................---
ENSDORP00000002834  ----------------------------...............................................---
ENSDORP00000014071  ----------------------------...............................................---
ENSDORP00000000198  ----------------------------...............................................---
ENSDORP00000006712  -----------EQLKRWIGSETDLEPPV...............................................VKR
ENSDORP00000009930  ----------------------------...............................................---
ENSDORP00000010221  ----------------------------...............................................---


                             40        50                                                      60   
                              |         |                                                       |   
d1s70b_               KKTKVKFDDGAVFLAACSS...GDTEEVLRL...........................................LER.
ENSDORP00000001438  -------------------...---------...........................................---.
ENSDORP00000003161  ASQCMTKKGFTPLHVAAKY...GKVRVAELL...........................................LER.
ENSDORP00000013687  AVDSIDSEGRTVLSIASAQ...GNVEVVRTL...........................................LDR.
ENSDORP00000003291  ----TNVRGETALHMAARS...GQAEVVRYL...........................................VQD.
ENSDORP00000015829  -------------------...---------...........................................---.
ENSDORP00000006395  ----QSQNGFTPLYMAAQE...NHIDVVKYL...........................................LEN.
ENSDORP00000006395  ----------TPLHIASRL...GKTEIVQLL...........................................LQH.
ENSDORP00000007897  ----TNRKGSTPLHVAVER...RARGVAELL...........................................LSR.
ENSDORP00000012171  SLNVADRSGRSALHHAVHS...GHLETVNLL...........................................LNK.
ENSDORP00000015191  LLNWQDYEGRTPLHFAVAD...GNVTVVDVL...........................................TSYe
ENSDORP00000005511  ----SDEWGWTPLHNAAEC...GRQDLVELL...........................................LRY.
ENSDORP00000001089  ----RDKKGFTPLILAATA...GHVGVVEIL...........................................LDK.
ENSDORP00000001089  ----HTEEGESLLCLACSA...GYYELAQVL...........................................LAM.
ENSDORP00000012094  -------------------...---------...........................................---.
ENSDORP00000003161  --------GITPLHIASRR...GNVIMVRLL...........................................LDR.
ENSDORP00000008111  -------DGDTPLHIAVAQ...ENLPAVHRL...........................................IRLf
ENSDORP00000010887  ----MAGRKSSPLHFAAGF...GRKDVVEHL...........................................LQM.
ENSDORP00000015756  XXXXXXXGGSNAIYWASRH...GHVDTLKFL...........................................NEN.
ENSDORP00000003012  XXXXXXXGGSNAIYWASRH...GHVDTLKFL...........................................NEN.
ENSDORP00000003803  NVNYQDADGFSALHHAALG...GSLELIALL...........................................LEA.
ENSDORP00000012171  -TDVMDAYGQTPLMLAIMN...GHVDCVHLL...........................................LEK.
ENSDORP00000010887  ----QPQSHETALHCAVASlhpKRKQVTELL...........................................LRK.
ENSDORP00000010328  -------DGDTLLHLAVIH...EAPTVLLCC...........................................LALl
ENSDORP00000010714  ---SDQQSKRTALHAAAQK...GSLEICHVL...........................................LQA.
ENSDORP00000005245  ------------FHRAVNV...NDEDLLLRI...........................................LEGg
ENSDORP00000012790  -------------------...--------L...........................................IHK.
ENSDORP00000001687  -----------KLLEAVQR...GDVGRVAAL...........................................ASRk
ENSDORP00000000524  --------GDTLLHCASRH...GRLDILAYL...........................................AETc
ENSDORP00000002516  RFDGYVIDGATALWCAAGA...GHFEVVKLL...........................................VSH.
ENSDORP00000007933  ----RDANGWTLLHFSAAR...GKERCVRVF...........................................LEH.
ENSDORP00000001938  -------------LAACSS...GDTDEVKKL...........................................LAR.
ENSDORP00000002146  ------------LLEAAAR...SDLEEVLQL...........................................LKS.
ENSDORP00000006986  -------NGDSVLHLAIIH...LHVQLVRDL...........................................LAV.
ENSDORP00000013687  -------------------...-REDSIRTL...........................................LDN.
ENSDORP00000011695  ------------IVKATQY...GIYERCREL...........................................VEA.
ENSDORP00000003709  ------EELTTPLHVAASR...GYTEVLRLL...........................................LRR.
ENSDORP00000012607  -------NGDTPLHLAIIH...GQTNVFEQI...........................................VHVi
ENSDORP00000012790  ------KDGKSPLHMTAVH...GRFTRSQTL...........................................IQN.
ENSDORP00000001046  ----PDEKGNPPLWLALTS...NLEDIASTL...........................................VRH.
ENSDORP00000012574  ----QAHNGATPVHDAAAT...GNLAELRWL...........................................VRDg
ENSDORP00000012710  -----YENKVTPLHFLVAQ...GSVEQVKLL...........................................LAH.
ENSDORP00000008802  ----------DRLLQAVEN...GDVEKVASL...........................................LGKk
ENSDORP00000012790  ----------TPLMLAVAY...GHIDAVSLL...........................................LEK.
ENSDORP00000000031  --------------KATQY...GIFERCKEL...........................................VEA.
ENSDORP00000013942  -------NSMTALIVAVKG...GYTQSVKEI...........................................LKR.
ENSDORP00000000883  ------------VGLAARE...GNVKVLKKL...........................................LKK.
ENSDORP00000012440  ----CDSEGCTPLMHAVSG...RQVDTVKLL...........................................LKM.
ENSDORP00000010065  ----LTRNGFTALHLAVYK...DSAELITSL...........................................LHS.
ENSDORP00000015111  -----DNSGATVLHLAARF...GHPEVVNWL...........................................LRHg
ENSDORP00000014007  ------------LLIAAYK...GQAENVVQL...........................................INK.
ENSDORP00000008737  -------ADRSPLHEAASQ...GRLLALRTL...........................................LSQ.
ENSDORP00000010826  -------------------...---------...........................................---.
ENSDORP00000003161  ----CNQNGLNGLHLASKE...GHVKMVVEL...........................................LHK.
ENSDORP00000002055  -VNARDKNWQTPLHIAAAN...KAVKCAEAL...........................................VPL.
ENSDORP00000011259  -------------------...---------...........................................---.
ENSDORP00000014237  --------------HAAGF...GRKDVVEYL...........................................LQN.
ENSDORP00000007536  -----VVSDWSPMHDAAIH...GRLLSLRNL...........................................LSQ.
ENSDORP00000004979  -------------------...--------L...........................................LKE.
ENSDORP00000010830  SLMAEKTHGASPLVVAARY...GHKDMVEFL...........................................LEQc
ENSDORP00000008769  -------DGDTFLHIAVAQ...GRRALSYVL...........................................ARKm
ENSDORP00000009839  -NFTEPIDGLSALHLAAVA...NDIDMVTFL...........................................LGL.
ENSDORP00000015161  -------------------...---------...........................................---.
ENSDORP00000001718  ---------------AVAD...GDLEMVRYL...........................................LEWt
ENSDORP00000002537  -----------KLHKAASV...GDLEKLKEY...........................................LKYk
ENSDORP00000001580  -------------------...-------LL...........................................LDH.
ENSDORP00000009438  AFDEADGIGWIPLHKAAVQ...LNKNILEMT...........................................LRAs
ENSDORP00000002055  ------------------N...GHSECLRLL...........................................IGNa
ENSDORP00000015480  -------------------...---------...........................................---.
ENSDORP00000012408  WVLTPKTKQTVPLTIAAAR...GYKDCARHL...........................................IMQ.
ENSDORP00000002055  ---CEDKNGNTPLHIAARY...GHELLINTL...........................................ITS.
ENSDORP00000013812  PSYKLKSSWATGLHISVLF...GHVECLLVL...........................................LDH.
ENSDORP00000013528  -------------------...---------...........................................---.
ENSDORP00000000083  -------------------...---------...........................................---.
ENSDORP00000003321  -------------------...---------...........................................---.
ENSDORP00000011353  -------------------...---------...........................................---.
ENSDORP00000007355  -------------------...---------...........................................---.
ENSDORP00000007546  -------------------...---------...........................................---.
ENSDORP00000009016  ------------AFWAARR...GNLALLKLL...........................................LNSg
ENSDORP00000011081  -------------------...GSYDMVSAL...........................................IKY.
ENSDORP00000011018  -------------------...---------...........................................LSK.
ENSDORP00000003291  ---------------AARA...GHLEKALDY...........................................IKN.
ENSDORP00000008149  -------------------...---------...........................................---.
ENSDORP00000014950  ----PNKEGWLPLHEAAYY...GQLGCLKVL...........................................QQAy
ENSDORP00000012171  --------DMFPLHLAVLF...GFSDCCRKLlssgqlysivsslsnehv.........................LSA.
ENSDORP00000014237  -------------------...---------...........................................--H.
ENSDORP00000007749  --------GRTAFHRAAEH...GQLDALDFL...........................................VGS.
ENSDORP00000015309  LLLSQQTQSIIPIHLATEY...HKPQSLLCL...........................................LKH.
ENSDORP00000007119  -------------------...---------...........................................---.
ENSDORP00000011018  -----DNEGCTPLHYACRQ...GVPVSVNNL...........................................LGF.
ENSDORP00000002435  ----RNHPSWSAAHLAVEL...GIRECFHHS...........................................RII.
ENSDORP00000014274  -------------------...---------...........................................---.
ENSDORP00000004702  -------------------...---------...........................................---.
ENSDORP00000013942  -------------------...---------...........................................---.
ENSDORP00000011332  -------------------...---------...........................................---.
ENSDORP00000014237  -------------------...----ICELL...........................................LRK.
ENSDORP00000014578  -------------------...---------...........................................---.
ENSDORP00000005457  -------------------...---------...........................................---.
ENSDORP00000015160  ------------IWSAALN...GDLGRVKYF...........................................IQK.
ENSDORP00000011906  ------------LMKAAER...GDVEKVSSI...........................................LAKk
ENSDORP00000012571  -------------------...---------...........................................---.
ENSDORP00000012644  -------------------...---------...........................................---.
ENSDORP00000007538  -------------------...---------...........................................---.
ENSDORP00000009863  -------------------...---------...........................................---.
ENSDORP00000010305  -------------------...-NVKVSRLL...........................................ILG.
ENSDORP00000011587  -------------------...---------...........................................---.
ENSDORP00000000485  ----------------CRE...GNAVAVRLW...........................................LDNt
ENSDORP00000014531  -------------------...---------...........................................---.
ENSDORP00000012009  -------------------...---------...........................................---.
ENSDORP00000009257  ----GQCAGHTAMQAASQN...GHVDILKLL...........................................XXX.
ENSDORP00000008161  -----KRIWESPLLLAAKE...NDVQTLSKL...........................................LKYq
ENSDORP00000009839  ------------------A...GDMASLKKA...........................................FES.
ENSDORP00000001630  -------------------...---------...........................................---.
ENSDORP00000012903  -------------------...---------...........................................---.
ENSDORP00000010147  -------------------...---------...........................................---.
ENSDORP00000008900  -------------------...---------...........................................---.
ENSDORP00000004243  -------------------...---------...........................................---.
ENSDORP00000008700  -------------------...---------...........................................---.
ENSDORP00000008105  --LQQKRIWEAPLLRAAKE...HDLCTLKRL...........................................LLDp
ENSDORP00000002464  ---------CTPLRIAATA...GHGNCVDFL...........................................IRK.
ENSDORP00000008204  -------------------...---------...........................................---.
ENSDORP00000001653  -------------------...---------...........................................---.
ENSDORP00000013463  ----YQEGVSNALLKMAEL...GLMRAADVL...........................................LRN.
ENSDORP00000013412  -------------------...---------...........................................---.
ENSDORP00000007180  -------------------...---------...........................................---.
ENSDORP00000000309  -------------------...---------...........................................---.
ENSDORP00000008007  -------------------...---------...........................................---.
ENSDORP00000010007  -------------------...---------...........................................---.
ENSDORP00000013572  -------------------...---------...........................................---.
ENSDORP00000002756  -------------------...---------...........................................---.
ENSDORP00000008159  -------------------...---------...........................................---.
ENSDORP00000013968  -------------------...---------...........................................---.
ENSDORP00000010487  -------------------...---------...........................................---.
ENSDORP00000001351  -----------------AQ...GELSQLKEH...........................................LRK.
ENSDORP00000009580  ----TKNQGRTALQVAAYL...GQVELVRLL...........................................LQA.
ENSDORP00000006712  -------------------...---------...........................................---.
ENSDORP00000014166  ------------LYWACVH...NHPAQLQAI...........................................LDA.
ENSDORP00000013444  --KIHDDSGNNLLHIAASQ...GHAECLQHL...........................................TSLm
ENSDORP00000004275  ----TNLKGETALHRACIN...NQVEKLILL...........................................LSLp
ENSDORP00000001355  -------------------...---------...........................................---.
ENSDORP00000013087  -------------------...--FDLVQRI...........................................IYE.
ENSDORP00000003943  -----------ALLRAVGQ...GKLRLARLL...........................................LEG.
ENSDORP00000009340  -------------------...---------...........................................---.
ENSDORP00000008149  -------------------...--IKVSRLL...........................................ILG.
ENSDORP00000015559  --------------KAAVE...GKMKLIEKF...........................................LAD.
ENSDORP00000006156  -------------------...GRTDLISQA...........................................IEAl
ENSDORP00000002459  -------------------...---------...........................................---.
ENSDORP00000011514  -----------PLLQACID...GDFNYSKRL...........................................LES.
ENSDORP00000007506  ------------LLDAALT...GELDVVQQA...........................................VKE.
ENSDORP00000014195  ------------------C...GRTDLVKQA...........................................VSLl
ENSDORP00000010305  -------------------...---------...........................................---.
ENSDORP00000011086  -------------------...--------F...........................................IRA.
ENSDORP00000003906  FLLEEDIVGRNLLYAACMA...GQSDVIRAL...........................................AKY.
ENSDORP00000007061  -------------------...---------...........................................---.
ENSDORP00000008791  --------------EAART...GHLPAVEKLlsgkrlsssfggsgggggggsaggggggggsglgssshplsslLSMw
ENSDORP00000011286  ------E------------...---------...........................................---.
ENSDORP00000010487  ------------LAEACSE...GDVNAVRKL...........................................LIE.
ENSDORP00000001046  -------------------...---------...........................................---.
ENSDORP00000013206  --------GETLLQRAARL...GYEXXXXXX...........................................XXXx
ENSDORP00000000302  -------------------...---------...........................................---.
ENSDORP00000004396  -------------------...---------...........................................---.
ENSDORP00000009263  -------------------...---------...........................................---.
ENSDORP00000005406  -------------------...---------...........................................---.
ENSDORP00000011018  -------------------...---------...........................................---.
ENSDORP00000007862  -------------------...---------...........................................---.
ENSDORP00000005974  -------------------...---------...........................................---.
ENSDORP00000015386  -------------------...---------...........................................---.
ENSDORP00000004934  -------------------...---------...........................................---.
ENSDORP00000007749  -------------------...---------...........................................---.
ENSDORP00000011209  ------------IHKAASQ...GDVGKVQRK...........................................LLGg
ENSDORP00000014950  -------------------...---------...........................................---.
ENSDORP00000004508  --TTVNVIPNNLLRDAVKN...GDYITVKVA...........................................LNSd
ENSDORP00000010830  -------------------...---------...........................................---.
ENSDORP00000008316  -------------------...---------...........................................---.
ENSDORP00000011647  -------------------...---------...........................................---.
ENSDORP00000001838  -------------------...---------...........................................---.
ENSDORP00000007356  -------------------...---------...........................................---.
ENSDORP00000007453  -------------------...---------...........................................---.
ENSDORP00000009265  -------------------...---------...........................................---.
ENSDORP00000006222  -------------------...---------...........................................---.
ENSDORP00000010465  -------------------...---------...........................................---.
ENSDORP00000005903  -------------------...---------...........................................---.
ENSDORP00000006810  -------------------...---------...........................................---.
ENSDORP00000000618  -------------------...---------...........................................---.
ENSDORP00000005027  -------------------...---------...........................................---.
ENSDORP00000014908  ---------------AAEY...GNIPVVRKM...........................................LEEs
ENSDORP00000013576  -------------------...---------...........................................---.
ENSDORP00000015191  -------------HAAAVN...GDKGTLQRL...........................................IVG.
ENSDORP00000001718  -------------------...---------...........................................---.
ENSDORP00000004586  -------------------...---------...........................................---.
ENSDORP00000010461  ----------------AEY...GNIPVVRKM...........................................LEEs
ENSDORP00000011519  -------------------...---------...........................................---.
ENSDORP00000010487  -------------------...---------...........................................---.
ENSDORP00000015746  -------------------...---------...........................................---.
ENSDORP00000008684  -------------------...---------...........................................---.
ENSDORP00000001089  -------------------...---------...........................................---.
ENSDORP00000007061  -------------------...---------...........................................---.
ENSDORP00000011837  ------------LSIAAAH...GDVETVRYL...........................................LSE.
ENSDORP00000000883  ----------LPIHAAAQM...GHSKILDLL...........................................IPL.
ENSDORP00000008319  -------------------...---------...........................................---.
ENSDORP00000011516  -------------------...---------...........................................---.
ENSDORP00000005420  -------------------...---------...........................................---.
ENSDORP00000014434  ---------------AALE...NKVPVVEKF...........................................LSD.
ENSDORP00000012876  -------------------...-------QL...........................................IDL.
ENSDORP00000002492  ------------LLDASLE...GEFDLVQRI...........................................IYE.
ENSDORP00000009438  -------------------...---------...........................................---.
ENSDORP00000006616  -------------------...---------...........................................---.
ENSDORP00000014346  -------------------...---------...........................................---.
ENSDORP00000005715  -------------------...---------...........................................---.
ENSDORP00000007659  -------------------...---------...........................................---.
ENSDORP00000000137  -----------VLLAACRA...GDIGVLKVQ...........................................LAA.
ENSDORP00000011634  -------------------...---------...........................................---.
ENSDORP00000007355  -------------------...---------...........................................---.
ENSDORP00000001096  -------------------...---------...........................................---.
ENSDORP00000007335  -------------------...---------...........................................---.
ENSDORP00000001630  -------------------...---------...........................................---.
ENSDORP00000010887  -------------------...---------...........................................---.
ENSDORP00000013121  -------------------...---------...........................................---.
ENSDORP00000007683  -------------------...---------...........................................---.
ENSDORP00000002834  -------------------...---------...........................................---.
ENSDORP00000014071  -------------------...---------...........................................---.
ENSDORP00000000198  -------------------...---------...........................................---.
ENSDORP00000006712  QKTKVKFDDGAVFLAACSS...GDTDEVLKL...........................................LHR.
ENSDORP00000009930  -------------------...---------...........................................---.
ENSDORP00000010221  -------------------...---------...........................................---.


                                                                                 70                 
                                                                                  |                 
d1s70b_               ...GAD......INY............................................ANVD....GL.TA......
ENSDORP00000001438  ...---......---............................................VTED....GD.TA......
ENSDORP00000003161  ...DAH......PNA............................................AGKN....GL.TP......
ENSDORP00000013687  ...GLD......ENH............................................RDDA....GW.TP......
ENSDORP00000003291  ...GAQ......VEA............................................KAKD....DQ.TP......
ENSDORP00000015829  ...---......---............................................----....--.--......
ENSDORP00000006395  ...GAN......QST............................................ATED....GF.TP......
ENSDORP00000006395  ...MAH......PDA............................................ATTN....GY.TP......
ENSDORP00000007897  ...KIS......VNA............................................KDED....QW.TA......
ENSDORP00000012171  ...GAS......LNV............................................CDKK....ER.QP......
ENSDORP00000015191  ...SCN......ITS............................................YDNL....FR.TP......
ENSDORP00000005511  ...GAE......PAR............................................RKRN....GA.TP......
ENSDORP00000001089  ...GGD......IEA............................................QSERt...KD.TP......
ENSDORP00000001089  ...HAN......VED............................................RGNK....GDiTP......
ENSDORP00000012094  ...---......---............................................----....--.--......
ENSDORP00000003161  ...GAQ......IET............................................RTKD....EL.TP......
ENSDORP00000008111  qhgGRE......LDV............................................YNHL....RQ.TP......
ENSDORP00000010887  ...GAN......VHA............................................RDDG....GL.IP......
ENSDORP00000015756  ...KCP......LDV............................................KDKS....GE.TA......
ENSDORP00000003012  ...KCP......LDV............................................KDKS....GE.TA......
ENSDORP00000003803  ...QAT......VDI............................................KDSN....GM.RP......
ENSDORP00000012171  ...GST......ADA............................................ADLR....GR.TA......
ENSDORP00000010887  ...GAN......VNE............................................KNKD....FM.TP......
ENSDORP00000010328  ..pQEV......LDI............................................QNNL....YQ.TA......
ENSDORP00000010714  ...GAN......INA............................................VDKQ....QR.TP......
ENSDORP00000005245  ...HVK......IDV............................................PNKF....GF.TA......
ENSDORP00000012790  ...TED......VNA............................................LDSE....KR.TP......
ENSDORP00000001687  ...SAR......PTK............................................LDSS....GQ.SP......
ENSDORP00000000524  ...GMD......IEA............................................ANRD....YK.RP......
ENSDORP00000002516  ...GAN......VNH............................................TTVT....NS.TP......
ENSDORP00000007933  ...GAD......PTV............................................KDLIg...GF.TA......
ENSDORP00000001938  ...GAD......INT............................................VNVD....GL.TA......
ENSDORP00000002146  ...GVS......PDL............................................ANED....GL.TA......
ENSDORP00000006986  ...TSGlisddiINM............................................RNDL....YQ.TP......
ENSDORP00000013687  ...GAS......VNQ............................................CDSS....GR.TL......
ENSDORP00000011695  ...GYD......VRQ............................................PDKE....NV.TL......
ENSDORP00000003709  ...RAR......PDS............................................A-PG....GR.TA......
ENSDORP00000012607  ..yHAQhlgm..VNI............................................TNHL....HQ.TP......
ENSDORP00000012790  ...GGE......IDC............................................VDKD....GN.TP......
ENSDORP00000001046  ...GCD......ATFwgpgpsgclqtlhridenescflixxgcdvnsprqpgangegeeEARD....GQ.TP......
ENSDORP00000012574  ...GCG......LQD............................................QDAS....GV.SP......
ENSDORP00000012710  ...EVD......VDC............................................QTAS....GY.TP......
ENSDORP00000008802  ...GAS......ATK............................................QDSE....GK.TA......
ENSDORP00000012790  ...EAN......VDA............................................VDIM....GC.TA......
ENSDORP00000000031  ...GYD......VRQ............................................PDKE....NV.SL......
ENSDORP00000013942  ...NPN......VNL............................................TDKD....GN.TA......
ENSDORP00000000883  ...GRC......VDV............................................ADNR....GW.MP......
ENSDORP00000012440  ...GAN......INT............................................QDAY....GR.TS......
ENSDORP00000010065  ...GAD......IQQ............................................V-GG....GL.KA......
ENSDORP00000015111  ...GGD......PAM............................................TTDT....GA.LP......
ENSDORP00000014007  ...GAK......VAV............................................T-KH....GR.TP......
ENSDORP00000008737  ...GYN......VNA............................................VTID....HI.TP......
ENSDORP00000010826  ...--D......VNV............................................RGPD....GF.TP......
ENSDORP00000003161  ...EII......LET............................................TTKK....GN.TA......
ENSDORP00000002055  ...LSN......VNV............................................SDRA....GR.TA......
ENSDORP00000011259  ...---......---............................................----....--.--......
ENSDORP00000014237  ...GAN......VQA............................................RDDG....GL.IP......
ENSDORP00000007536  ...GWP......VNL............................................ITAD....QV.SP......
ENSDORP00000004979  ...GAD......PHA............................................VGFS....GG.SL......
ENSDORP00000010830  ...SAS......IEVggsvnfdg....................................ETIE....GA.PP......
ENSDORP00000008769  ...NALcm....LDI............................................KEHN....GQ.SA......
ENSDORP00000009839  ...GAH......PDV............................................QDQM....GC.TP......
ENSDORP00000015161  ...---......---............................................----....--.--......
ENSDORP00000001718  ...EED......LDE............................................ADDAvgvaGV.EF......
ENSDORP00000002537  ...KHD......VDK............................................RDKG....HX.XXxxxxxx
ENSDORP00000001580  ...GAD......VNA............................................QNRL....GA.SV......
ENSDORP00000009438  ..kPSM......WEQ............................................TTHN....GE.TP......
ENSDORP00000002055  .epQ-Na.....VDI............................................QDGN....GQ.TP......
ENSDORP00000015480  ...---......---............................................----....--.--......
ENSDORP00000012408  ...GAQ......LDS............................................R-VG....GR.TA......
ENSDORP00000002055  ...GAD......TAK............................................RGIH....GM.FP......
ENSDORP00000013812  ...NAT......INC............................................R-PN....GK.TP......
ENSDORP00000013528  ...--D......VNV............................................RGPD....GF.TP......
ENSDORP00000000083  ...---......---............................................----....--.--......
ENSDORP00000003321  ...---......---............................................----....--.--......
ENSDORP00000011353  ...---......---............................................----....--.--......
ENSDORP00000007355  ...---......---............................................----....GR.KP......
ENSDORP00000007546  ...---......---............................................----....--.--......
ENSDORP00000009016  ...RVD......VDC............................................RDSH....GT.TL......
ENSDORP00000011081  ...NTS......LDQ............................................PCVK....RW.SA......
ENSDORP00000011018  ...GAK......LCK............................................SNKW....GD.YP......
ENSDORP00000003291  ...GVD......INI............................................CNQN....GL.NA......
ENSDORP00000008149  ...---......---............................................----....--.--......
ENSDORP00000014950  ...PGA......IDQ............................................RTLQ....EE.TA......
ENSDORP00000012171  ...GFD......INT............................................PDNL....GR.TC......
ENSDORP00000014237  ...GAD......PTK............................................KNRD....GN.TP......
ENSDORP00000007749  ...GCD......HTV............................................KDNX....XX.XX......
ENSDORP00000015309  ...GAD......PEI............................................R-AA....GL.TT......
ENSDORP00000007119  ...---......---............................................----....--.--......
ENSDORP00000011018  ...NVS......IHS............................................KSKD....KK.SP......
ENSDORP00000002435  ...SCA......NNT............................................ENEE....GC.TP......
ENSDORP00000014274  ...---......---............................................----....--.--......
ENSDORP00000004702  ...---......---............................................----....--.--......
ENSDORP00000013942  ...---......---............................................----....GQ.TP......
ENSDORP00000011332  ...---......---............................................----....--.--......
ENSDORP00000014237  ...GAN......INE............................................KTKE....FL.TP......
ENSDORP00000014578  ...---......---............................................----....--.--......
ENSDORP00000005457  ...---......---............................................----....--.--......
ENSDORP00000015160  ...ATD......PSQ............................................PDSA....GY.TA......
ENSDORP00000011906  ...GIN......PGK............................................VDVE....GR.SA......
ENSDORP00000012571  ...---......---............................................----....--.--......
ENSDORP00000012644  ...---......---............................................----....--.--......
ENSDORP00000007538  ...---......---............................................----....-R.SP......
ENSDORP00000009863  ...---......---............................................----....--.--......
ENSDORP00000010305  ...GAN......VNY............................................RTEV....LN.NA......
ENSDORP00000011587  ...---......VNL............................................ADGN....GN.TA......
ENSDORP00000000485  ...END......LNQ............................................GDDH....GF.SP......
ENSDORP00000014531  ...---......---............................................----....--.--......
ENSDORP00000012009  ...---......---............................................----....--.--......
ENSDORP00000009257  ...XXX......XXX............................................XDKD....GD.RA......
ENSDORP00000008161  ...GCD......VHQ............................................RGAM....GE.TA......
ENSDORP00000009839  ...GIP......VDM............................................KDRY....YK.TP......
ENSDORP00000001630  ...---......---............................................----....--.--......
ENSDORP00000012903  ...---......---............................................----....--.--......
ENSDORP00000010147  ...---......-NQ............................................RNDL....GE.TL......
ENSDORP00000008900  ...---......---............................................----....--.--......
ENSDORP00000004243  ...---......---............................................----....--.--......
ENSDORP00000008700  ...---......---............................................----....--.--......
ENSDORP00000008105  ...KCD......FQQ............................................RGAL....GE.TA......
ENSDORP00000002464  ...GAE......VDL............................................VDVK....GQ.TA......
ENSDORP00000008204  ...---......---............................................----....--.--......
ENSDORP00000001653  ...---......--I............................................QDGF....NG.DT......
ENSDORP00000013463  ...GAN......LNF............................................EDPVt...YY.TA......
ENSDORP00000013412  ...---......---............................................----....--.--......
ENSDORP00000007180  ...---......VNK............................................RNER....GE.TR......
ENSDORP00000000309  ...SSS......INV............................................SDEA....GY.TI......
ENSDORP00000008007  ...---......---............................................----....--.--......
ENSDORP00000010007  ...---......---............................................----....--.--......
ENSDORP00000013572  ...---......---............................................----....--.--......
ENSDORP00000002756  ...---......---............................................----....--.--......
ENSDORP00000008159  ...---......---............................................----....--.--......
ENSDORP00000013968  ...---......---............................................----....--.--......
ENSDORP00000010487  ...---......---............................................----....--.--......
ENSDORP00000001351  ...---......---............................................----....--.--......
ENSDORP00000009580  ...RAG......TDL............................................ADED....GN.TA......
ENSDORP00000006712  ...---......---............................................----....--.--......
ENSDORP00000014166  ...GVSpeq...VAH............................................VDSN....GR.TG......
ENSDORP00000013444  ...GEDc.....LSE............................................RNAD....AL.TP......
ENSDORP00000004275  ...G--......---............................................----....--.--......
ENSDORP00000001355  ...---......---............................................----....--.--......
ENSDORP00000013087  ...---......---............................................----....--.--......
ENSDORP00000003943  ...GAY......VNE............................................GDAQ....GE.TA......
ENSDORP00000009340  ...---......---............................................----....--.--......
ENSDORP00000008149  ...GAN......INY............................................RTEV....LN.NA......
ENSDORP00000015559  ...GGS......ADT............................................CDEF....RR.TA......
ENSDORP00000006156  ...GPDg.....VNT............................................MDDQ....GM.TP......
ENSDORP00000002459  ...---......---............................................----....--.--......
ENSDORP00000011514  ...GFD......PNI............................................RDSR....GR.TG......
ENSDORP00000007506  ...MND......PSQ............................................PNEE....GI.TA......
ENSDORP00000014195  ...GPDg.....INT............................................MSEQ....GM.TP......
ENSDORP00000010305  ...---......---............................................----....--.--......
ENSDORP00000011086  ...---......---............................................----....--.--......
ENSDORP00000003906  ...GVN......LNE............................................QTTR....GY.TL......
ENSDORP00000007061  ...---......---............................................----....--.--......
ENSDORP00000008791  ..rGPN......VNC............................................VDST....GY.TP......
ENSDORP00000011286  ...---......---............................................----....--.--......
ENSDORP00000010487  ...GRS......VNE............................................HTEE....GE.SL......
ENSDORP00000001046  ...---......---............................................----....--.--......
ENSDORP00000013206  .xtDCD......VNH............................................RDNA....GY.-C......
ENSDORP00000000302  ...---......---............................................----....--.--......
ENSDORP00000004396  ...---......---............................................----....--.--......
ENSDORP00000009263  ...---......---............................................--DT....GK.TC......
ENSDORP00000005406  ...---......---............................................----....--.--......
ENSDORP00000011018  ...---......---............................................----....--.--......
ENSDORP00000007862  ...---......---............................................----....--.--......
ENSDORP00000005974  ...---......---............................................----....--.--......
ENSDORP00000015386  ...---......---............................................----....--.--......
ENSDORP00000004934  ...---......---............................................----....--.--......
ENSDORP00000007749  ...---......---............................................----....--.--......
ENSDORP00000011209  ...KND......VNA............................................RDKK....NR.TA......
ENSDORP00000014950  ...---......---............................................---S....GV.SP......
ENSDORP00000004508  ..eDYD......LDQ............................................EDSS....GM.TL......
ENSDORP00000010830  ...---......---............................................----....--.--......
ENSDORP00000008316  ...---......---............................................----....--.--......
ENSDORP00000011647  ...---......---............................................----....--.--......
ENSDORP00000001838  ...---......---............................................----....--.--......
ENSDORP00000007356  ...---......---............................................----....--.--......
ENSDORP00000007453  ...---......---............................................----....--.--......
ENSDORP00000009265  ...---......---............................................S---....--.--......
ENSDORP00000006222  ...---......---............................................----....--.--......
ENSDORP00000010465  ...---......---............................................----....--.--......
ENSDORP00000005903  ...---......---............................................---R....GQ.TA......
ENSDORP00000006810  ...---......---............................................----....--.--......
ENSDORP00000000618  ...---......---............................................----....--.--......
ENSDORP00000005027  ...---......---............................................----....--.--......
ENSDORP00000014908  ..rTLN......VNC............................................VDYM....GQ.NA......
ENSDORP00000013576  ...---......---............................................----....--.--......
ENSDORP00000015191  ...NASf.....KDK............................................EDQF....GR.TP......
ENSDORP00000001718  ...---......---............................................----....--.--......
ENSDORP00000004586  ...---......---............................................----....--.--......
ENSDORP00000010461  ..kTLN......FNC............................................VDYM....GQ.NA......
ENSDORP00000011519  ...---......---............................................----....--.--......
ENSDORP00000010487  ...---......---............................................----....--.--......
ENSDORP00000015746  ...---......---............................................----....--.--......
ENSDORP00000008684  ...-IN......INC............................................IDPL....GR.TA......
ENSDORP00000001089  ...---......---............................................--NN....DH.TV......
ENSDORP00000007061  ...---......---............................................----....--.--......
ENSDORP00000011837  ...KHV......EMP............................................TEPT....DD.NP......
ENSDORP00000000883  ...TNR......ICD............................................TGPD....KV.SP......
ENSDORP00000008319  ...---......---............................................----....--.--......
ENSDORP00000011516  ...---......---............................................----....--.--......
ENSDORP00000005420  ...---......---............................................----....--.--......
ENSDORP00000014434  ...KNN......PDV............................................CDEY....KR.TA......
ENSDORP00000012876  ...GAD......VSL............................................RSRWt...NM.NA......
ENSDORP00000002492  ...VED......PSK............................................PNDE....GI.TP......
ENSDORP00000009438  ...---......---............................................----....--.--......
ENSDORP00000006616  ...---......---............................................----....--.--......
ENSDORP00000014346  ...---......---............................................----....--.--......
ENSDORP00000005715  ...---......---............................................----....--.--......
ENSDORP00000007659  ...---......---............................................----....--.--......
ENSDORP00000000137  ...GPE......DTG............................................----....--.--......
ENSDORP00000011634  ...---......---............................................----....--.--......
ENSDORP00000007355  ...---......---............................................----....--.--......
ENSDORP00000001096  ...---......---............................................----....--.--......
ENSDORP00000007335  ...---......---............................................----....--.--......
ENSDORP00000001630  ...---......---............................................----....--.--......
ENSDORP00000010887  ...---......---............................................----....--.--......
ENSDORP00000013121  ...DLN......INC............................................VDVL....GR.NA......
ENSDORP00000007683  ...---......---............................................----....--.--......
ENSDORP00000002834  ...---......---............................................----....--.--......
ENSDORP00000014071  ...---......---............................................----....--.--......
ENSDORP00000000198  ...---......---............................................----....--.--......
ENSDORP00000006712  ...GAD......INY............................................ANVD....GL.TA......
ENSDORP00000009930  ...---......---............................................----....--.--......
ENSDORP00000010221  ...---......---............................................----....--.--......


                                      80                                                            
                                       |                                                            
d1s70b_               ..............LHQACID......D.NV...............................................
ENSDORP00000001438  ..............LHLAVIH......Q.HE...............................................
ENSDORP00000003161  ..............LHVAVHH......N.NL...............................................
ENSDORP00000013687  ..............LHMAAFE......G.HR...............................................
ENSDORP00000003291  ..............LHISARL......G.KA...............................................
ENSDORP00000015829  ..............-------......-.--...............................................
ENSDORP00000006395  ..............LAVALQQ......G.HN...............................................
ENSDORP00000006395  ..............LHISARE......G.QL...............................................
ENSDORP00000007897  ..............LHFAAQN......G.DE...............................................
ENSDORP00000012171  ..............LHWAAFL......G.HL...............................................
ENSDORP00000015191  ..............LHWAALL......G.HA...............................................
ENSDORP00000005511  ..............FIVAGIG......G.HV...............................................
ENSDORP00000001089  ..............LSLACSG......G.RQ...............................................
ENSDORP00000001089  ..............LMAASSG......G.YL...............................................
ENSDORP00000012094  ..............LHLAIIH......E.EK...............................................
ENSDORP00000003161  ..............LHCAARN......G.HV...............................................
ENSDORP00000008111  ..............LHLAVIT......T.LP...............................................
ENSDORP00000010887  ..............LHNACSF......G.HA...............................................
ENSDORP00000015756  ..............LHVAARY......G.HA...............................................
ENSDORP00000003012  ..............LHVAARY......G.HA...............................................
ENSDORP00000003803  ..............LHYAAWQ......G.RL...............................................
ENSDORP00000012171  ..............LHRGAVT......G.CE...............................................
ENSDORP00000010887  ..............LHVAAER......A.HN...............................................
ENSDORP00000010328  ..............LHLAVHL......D.QP...............................................
ENSDORP00000010714  ..............LMEAVVN......N.HL...............................................
ENSDORP00000005245  ..............LMVAAQK......G.YT...............................................
ENSDORP00000012790  ..............LHVAAFL......G.DA...............................................
ENSDORP00000001687  ..............FHLAASK......G.LT...............................................
ENSDORP00000000524  ..............LHEAASM......G.HR...............................................
ENSDORP00000002516  ..............LRAACFD......G.RL...............................................
ENSDORP00000007933  ..............LHYAAMH......G.RA...............................................
ENSDORP00000001938  ..............LHQACID......E.NL...............................................
ENSDORP00000002146  ..............LHQCCID......D.FQ...............................................
ENSDORP00000006986  ..............LHLAVIT......K.QE...............................................
ENSDORP00000013687  ..............LANAAYS......G.NL...............................................
ENSDORP00000011695  ..............LHWAAIN......N.RI...............................................
ENSDORP00000003709  ..............LHEACAA......G.HP...............................................
ENSDORP00000012607  ..............LHLAVIT......G.QT...............................................
ENSDORP00000012790  ..............LHVAARY......G.HE...............................................
ENSDORP00000001046  ..............LHLAASW......G.LE...............................................
ENSDORP00000012574  ..............LHLAARF......G.HP...............................................
ENSDORP00000012710  ..............LLIAAQD......Q.QP...............................................
ENSDORP00000008802  ..............FHLAAAK......G.HV...............................................
ENSDORP00000012790  ..............LHRGIMT......G.HE...............................................
ENSDORP00000000031  ..............LHWAAIN......N.RL...............................................
ENSDORP00000013942  ..............LMIASKE......G.HT...............................................
ENSDORP00000000883  ..............IHEAAYH......N.SI...............................................
ENSDORP00000012440  ..............LCLATYL......G.WL...............................................
ENSDORP00000010065  ..............LHIAVIA......G.HL...............................................
ENSDORP00000015111  ..............IHYAAAK......G.DF...............................................
ENSDORP00000014007  ..............LHLAANK......G.HL...............................................
ENSDORP00000008737  ..............LHEACLG......D.HV...............................................
ENSDORP00000010826  ..............LMIASCS......G.GGletgnseeeedap..................................
ENSDORP00000003161  ..............LHIAALA......G.QD...............................................
ENSDORP00000002055  ..............LHHAAFS......G.HA...............................................
ENSDORP00000011259  ..............LHTAASI......G.QY...............................................
ENSDORP00000014237  ..............LHNACSF......G.HA...............................................
ENSDORP00000007536  ..............LHEACLG......G.HS...............................................
ENSDORP00000004979  ..............LHLCARY......D.NA...............................................
ENSDORP00000010830  ..............LWAASAA......G.HL...............................................
ENSDORP00000008769  ..............LQVAVAA......N.QH...............................................
ENSDORP00000009839  ..............TMRAAEL......G.HE...............................................
ENSDORP00000015161  ..............---AAAE......N.QE...............................................
ENSDORP00000001718  ..............CHPLCQC......PkCA...............................................
ENSDORP00000002537  xxxxxxxxxxxxxxXXXXXXN......G.YE...............................................
ENSDORP00000001580  ..............LTVAARG......G.HL...............................................
ENSDORP00000009438  ..............LFLAVSN......C.LL...............................................
ENSDORP00000002055  ..............LMLSVLN......G.HT...............................................
ENSDORP00000015480  ..............-------......-.--...............................................
ENSDORP00000012408  ..............LHEACAQ......A.QL...............................................
ENSDORP00000002055  ..............LHLAALS......G.FS...............................................
ENSDORP00000013812  ..............LHVACEM......A.NL...............................................
ENSDORP00000013528  ..............LMLASFC......G.GAleqipaeeeevddssa...............................
ENSDORP00000000083  ..............-------......-.--...............................................
ENSDORP00000003321  ..............-------......-.--...............................................
ENSDORP00000011353  ..............-------......-.--...............................................
ENSDORP00000007355  ..............FLLAAER......G.HV...............................................
ENSDORP00000007546  ..............--XACID......E.NL...............................................
ENSDORP00000009016  ..............LMVASYA......G.HI...............................................
ENSDORP00000011081  ..............MHEAAKQ......G.RK...............................................
ENSDORP00000011018  ..............VHQAAFS......G.AK...............................................
ENSDORP00000003291  ..............LHLASKE......G.HV...............................................
ENSDORP00000008149  ..............-------......-.--...............................................
ENSDORP00000014950  ..............LYLATCR......E.HL...............................................
ENSDORP00000012171  ..............LHAAASG......G.NV...............................................
ENSDORP00000014237  ..............LDLV---......-.--...............................................
ENSDORP00000007749  ..............XXXXAGR......G.HA...............................................
ENSDORP00000015309  ..............LHLMLLH......W.PVtsitwakpclrvhriltdiqnnav.......................
ENSDORP00000007119  ..............-------......-.--...............................................
ENSDORP00000011018  ..............LHFAASY......G.RI...............................................
ENSDORP00000002435  ..............LHLACRK......G.NG...............................................
ENSDORP00000014274  ..............-------......-.--...............................................
ENSDORP00000004702  ..............-------......-.--...............................................
ENSDORP00000013942  ..............LMIAAEQ......G.NL...............................................
ENSDORP00000011332  ..............-------......-.--...............................................
ENSDORP00000014237  ..............LHVASEK......A.HN...............................................
ENSDORP00000014578  ..............-------......-.--...............................................
ENSDORP00000005457  ..............-------......-.--...............................................
ENSDORP00000015160  ..............LHYASRN......G.HY...............................................
ENSDORP00000011906  ..............FHVVASK......G.NL...............................................
ENSDORP00000012571  ..............-------......-.--...............................................
ENSDORP00000012644  ..............-------......-.--...............................................
ENSDORP00000007538  ..............LHEAAAQ......G.RL...............................................
ENSDORP00000009863  ..............-------......-.--...............................................
ENSDORP00000010305  ..............PILCVQShl....G.HE...............................................
ENSDORP00000011587  ..............LHYSVSH......G.NL...............................................
ENSDORP00000000485  ..............LHWACRE......G.RS...............................................
ENSDORP00000014531  ..............-------......-.--...............................................
ENSDORP00000012009  ..............-------......-.--...............................................
ENSDORP00000009257  ..............VHHAAFG......D.EG...............................................
ENSDORP00000008161  ..............LHIAALY......D.NL...............................................
ENSDORP00000009839  ..............LMTACAN......G.NI...............................................
ENSDORP00000001630  ..............-------......-.--...............................................
ENSDORP00000012903  ..............-------......-.--...............................................
ENSDORP00000010147  ..............LHRACIE......G.HL...............................................
ENSDORP00000008900  ..............-------......-.--...............................................
ENSDORP00000004243  ..............-------......-.--...............................................
ENSDORP00000008700  ..............-------......-.--...............................................
ENSDORP00000008105  ..............LHIAALY......D.NL...............................................
ENSDORP00000002464  ..............LYVAVVN......G.HL...............................................
ENSDORP00000008204  ..............-------......-.--...............................................
ENSDORP00000001653  ..............PLICCRR......G.HV...............................................
ENSDORP00000013463  ..............LHIAVLR......N.QP...............................................
ENSDORP00000013412  ..............-------......-.--...............................................
ENSDORP00000007180  ..............LHRAAIR......G.DA...............................................
ENSDORP00000000309  ..............FHHAALH......N.RV...............................................
ENSDORP00000008007  ..............-------......-.--...............................................
ENSDORP00000010007  ..............-------......-.--...............................................
ENSDORP00000013572  ..............-------......-.--...............................................
ENSDORP00000002756  ..............-------......-.--...............................................
ENSDORP00000008159  ..............-------......-.--...............................................
ENSDORP00000013968  ..............-------......-.--...............................................
ENSDORP00000010487  ..............-------......-.--...............................................
ENSDORP00000001351  ..............-------......-.--...............................................
ENSDORP00000009580  ..............LHYAALG......N.QP...............................................
ENSDORP00000006712  ..............-------......-.--...............................................
ENSDORP00000014166  ..............LMVACYH......G.FA...............................................
ENSDORP00000013444  ..............AGLAIKN......G.QL...............................................
ENSDORP00000004275  ..............-------......-.--...............................................
ENSDORP00000001355  ..............-------......-.--...............................................
ENSDORP00000013087  ..............-------......-.--...............................................
ENSDORP00000003943  ..............LMAACRAryddpqN.KA...............................................
ENSDORP00000009340  ..............-------......-.--...............................................
ENSDORP00000008149  ..............PILCVQShl....G.YT...............................................
ENSDORP00000015559  ..............LHRASLE......G.HM...............................................
ENSDORP00000006156  ..............LMYACAA......G.DE...............................................
ENSDORP00000002459  ..............-------......-.--...............................................
ENSDORP00000011514  ..............LHLAAAR......G.NV...............................................
ENSDORP00000007506  ..............LHNAICG......A.NY...............................................
ENSDORP00000014195  ..............LMYACVR......G.DE...............................................
ENSDORP00000010305  ..............-------......-.--...............................................
ENSDORP00000011086  ..............-------......-.--...............................................
ENSDORP00000003906  ..............LHCAAAW......G.RL...............................................
ENSDORP00000007061  ..............-------......-.--...............................................
ENSDORP00000008791  ..............LHHAALN......G.HK...............................................
ENSDORP00000011286  ..............-------......-.--...............................................
ENSDORP00000010487  ..............LCLACSA......G.YY...............................................
ENSDORP00000001046  ..............-------......-.--...............................................
ENSDORP00000013206  ..............AHEACAR......G.WL...............................................
ENSDORP00000000302  ..............-------......-.--...............................................
ENSDORP00000004396  ..............-------......-.--...............................................
ENSDORP00000009263  ..............LMKALLNinp...N.TK...............................................
ENSDORP00000005406  ..............-------......-.--...............................................
ENSDORP00000011018  ..............-------......-.--...............................................
ENSDORP00000007862  ..............-------......-.--...............................................
ENSDORP00000005974  ..............-------......-.--...............................................
ENSDORP00000015386  ..............-------......-.--...............................................
ENSDORP00000004934  ..............-------......-.--...............................................
ENSDORP00000007749  ..............LHQAARQ......N.HI...............................................
ENSDORP00000011209  ..............LHYACAY......G.HLaialhreceidicdshstalxxxxxxxxxxxxxxxxxxxxxxxxxxx
ENSDORP00000014950  ..............LHLAAER......N.HD...............................................
ENSDORP00000004508  ..............VMLAAAG......G.QD...............................................
ENSDORP00000010830  ..............-------......-.--...............................................
ENSDORP00000008316  ..............-------......-.--...............................................
ENSDORP00000011647  ..............-------......-.--...............................................
ENSDORP00000001838  ..............-------......-.--...............................................
ENSDORP00000007356  ..............-------......-.--...............................................
ENSDORP00000007453  ..............-------......-.--...............................................
ENSDORP00000009265  ..............-------......-.--...............................................
ENSDORP00000006222  ..............-------......-.--...............................................
ENSDORP00000010465  ..............-------......-.--...............................................
ENSDORP00000005903  ..............LHIAIER......R.CK...............................................
ENSDORP00000006810  ..............-------......-.--...............................................
ENSDORP00000000618  ..............-------......-.--...............................................
ENSDORP00000005027  ..............-------......-.--...............................................
ENSDORP00000014908  ..............LQLAVGN......E.HL...............................................
ENSDORP00000013576  ..............-------......-.--...............................................
ENSDORP00000015191  ..............LMYCVLA......D.RL...............................................
ENSDORP00000001718  ..............-------......-.--...............................................
ENSDORP00000004586  ..............-------......-.--...............................................
ENSDORP00000010461  ..............LQLAVGN......E.HL...............................................
ENSDORP00000011519  ..............-------......-.--...............................................
ENSDORP00000010487  ..............-------......-.--...............................................
ENSDORP00000015746  ..............-------......-.--...............................................
ENSDORP00000008684  ..............LLIAIEN......E.NL...............................................
ENSDORP00000001089  ..............VSLACAG......G.HL...............................................
ENSDORP00000007061  ..............-------......-.--...............................................
ENSDORP00000011837  ..............AVVATHF......G.HT...............................................
ENSDORP00000000883  ..............VYSAVFG......G.HE...............................................
ENSDORP00000008319  ..............-------......-.--...............................................
ENSDORP00000011516  ..............-------......-.--...............................................
ENSDORP00000005420  ..............-------......-.--...............................................
ENSDORP00000014434  ..............LHRACLE......G.HL...............................................
ENSDORP00000012876  ..............LHYAAYF......D.VP...............................................
ENSDORP00000002492  ..............LHNAVCA......G.HH...............................................
ENSDORP00000009438  ..............--FAVSN......G.DL...............................................
ENSDORP00000006616  ..............-------......-.--...............................................
ENSDORP00000014346  ..............-------......-.--...............................................
ENSDORP00000005715  ..............-------......-.--...............................................
ENSDORP00000007659  ..............-------......-.--...............................................
ENSDORP00000000137  ..............-------......-.--...............................................
ENSDORP00000011634  ..............-------......-.--...............................................
ENSDORP00000007355  ..............-------......-.--...............................................
ENSDORP00000001096  ..............-------......-.--...............................................
ENSDORP00000007335  ..............-------......-.--...............................................
ENSDORP00000001630  ..............-------......-.--...............................................
ENSDORP00000010887  ..............-------......-.--...............................................
ENSDORP00000013121  ..............VTITIEN......E.NL...............................................
ENSDORP00000007683  ..............-------......-.--...............................................
ENSDORP00000002834  ..............-------......-.--...............................................
ENSDORP00000014071  ..............-------......-.--...............................................
ENSDORP00000000198  ..............-------......-.--...............................................
ENSDORP00000006712  ..............LH-----......-.--...............................................
ENSDORP00000009930  ..............-------......-.--...............................................
ENSDORP00000010221  ..............-------......-.--...............................................


                                       90                                                           
                                        |                                                           
d1s70b_               ...............DMVKFLVE...........N....GA.....................................
ENSDORP00000001438  ...............PFLDFLLG...........F....AA.....................................
ENSDORP00000003161  ...............DIVKLLLP...........R....GG.....................................
ENSDORP00000013687  ...............LICEALIE...........Q....GA.....................................
ENSDORP00000003291  ...............DIVQQLLQ...........Q....GA.....................................
ENSDORP00000015829  ...............--------...........-....--.....................................
ENSDORP00000006395  ...............QAVAILLE...........N....DTkgkvrlpalhiaarkddtksaalllqndhnadvqskm
ENSDORP00000006395  ...............DVASVLLE...........A....GA.....................................
ENSDORP00000007897  ...............SSTRQLLE...........K....NA.....................................
ENSDORP00000012171  ...............EVLKLLVA...........R....GA.....................................
ENSDORP00000015191  ...............QIVHLLLE...........R....NKsgtipsdsqgatplhyaaqsnfaxxxxxxilkhpsvk
ENSDORP00000005511  ...............HLLRLFLS...........R....GA.....................................
ENSDORP00000001089  ...............EVVDLLLA...........R....GA.....................................
ENSDORP00000001089  ...............DIVKLLLL...........H....DA.....................................
ENSDORP00000012094  ...............SLTMEVIR...........QvkgdLA.....................................
ENSDORP00000003161  ...............RISEILLD...........H....GA.....................................
ENSDORP00000008111  ...............TVVQLLVT...........A....GA.....................................
ENSDORP00000010887  ...............EVVSLLLC...........Q....GA.....................................
ENSDORP00000015756  ...............DVVQLLCS...........F....GS.....................................
ENSDORP00000003012  ...............DVVQLLCS...........F....GS.....................................
ENSDORP00000003803  ...............EPVRLLLR...........A....SA.....................................
ENSDORP00000012171  ...............DCLAALLD...........H....DA.....................................
ENSDORP00000010887  ...............DVMEVLHK...........H....GA.....................................
ENSDORP00000010328  ...............GAVQALVL...........K....GA.....................................
ENSDORP00000010714  ...............DVARYMVQ...........R....GG.....................................
ENSDORP00000005245  ...............RLVKLLIS...........N....GT.....................................
ENSDORP00000012790  ...............EIIELLIL...........S....GA.....................................
ENSDORP00000001687  ...............ECLTVLLA...........N....GA.....................................
ENSDORP00000000524  ...............NCVGYLLD...........R....GA.....................................
ENSDORP00000002516  ...............DIVKYLVE...........N....NA.....................................
ENSDORP00000007933  ...............RIARLMLE...........S....EY.....................................
ENSDORP00000001938  ...............DMVRFLVE...........N....RA.....................................
ENSDORP00000002146  ...............EMVQQLLE...........A....GA.....................................
ENSDORP00000006986  ...............DVVEDLLR...........A....GA.....................................
ENSDORP00000013687  ...............DVVNLLVS...........R....GA.....................................
ENSDORP00000011695  ...............DLVKYYIS...........K....GA.....................................
ENSDORP00000003709  ...............ACVHVLLV...........A....GA.....................................
ENSDORP00000012607  ...............KVVSFLLQ...........V....GA.....................................
ENSDORP00000012790  ...............LLINTLIT...........S....GA.....................................
ENSDORP00000001046  ...............ETVQCLLE...........F....GA.....................................
ENSDORP00000012574  ...............TVVEWLLR...........E....GH.....................................
ENSDORP00000012710  ...............DLCALLLA...........H....GA.....................................
ENSDORP00000008802  ...............ECLRVMLT...........H....GV.....................................
ENSDORP00000012790  ...............ECVQMLLE...........Q....EV.....................................
ENSDORP00000000031  ...............DLVKFYIS...........K....GA.....................................
ENSDORP00000013942  ...............EIVQDLLD...........A....GT.....................................
ENSDORP00000000883  ...............ECLRMLIH...........A....ES.....................................
ENSDORP00000012440  ...............EGCVSLLR...........N....GA.....................................
ENSDORP00000010065  ...............EAADVLLQ...........H....GA.....................................
ENSDORP00000015111  ...............PSLRLIAQ...........H....HP.....................................
ENSDORP00000014007  ...............SVVQILLK...........A....GC.....................................
ENSDORP00000008737  ...............ACARTLLE...........A....GA.....................................
ENSDORP00000010826  ...............AVISDFIY...........Q....GA.....................................
ENSDORP00000003161  ...............EVVRELVN...........Y....GA.....................................
ENSDORP00000002055  ...............EXXXXXXX...........X....XX.....................................
ENSDORP00000011259  ...............EVVKECVQ...........Rr...EL.....................................
ENSDORP00000014237  ...............EVVNLLLQ...........H....GA.....................................
ENSDORP00000007536  ...............SCVNLLLS...........H....GA.....................................
ENSDORP00000004979  ...............FIAEILIE...........K....GV.....................................
ENSDORP00000010830  ...............KVVQSLLS...........H....GA.....................................
ENSDORP00000008769  ...............LIVQDLVN...........L....GA.....................................
ENSDORP00000009839  ...............LSMEMLAK...........A....NA.....................................
ENSDORP00000015161  ...............ALIDKYLT...........D....GG.....................................
ENSDORP00000001718  ...............PAQKKLAK...........Vpas.GL.....................................
ENSDORP00000002537  ...............SIVSLLIE...........K....QC.....................................
ENSDORP00000001580  ...............GVVKLLLE...........A....GA.....................................
ENSDORP00000009438  ...............ENASFLLL...........N....GC.....................................
ENSDORP00000002055  ...............DCVYSLLN...........K....GA.....................................
ENSDORP00000015480  ...............--------...........-....--.....................................
ENSDORP00000012408  ...............DCVKLLLT...........F....GA.....................................
ENSDORP00000002055  ...............DCCRKLLS...........L....GF.....................................
ENSDORP00000013812  ...............DCVKILCD...........R....GA.....................................
ENSDORP00000013528  ...............SILSDLIC...........Q....GA.....................................
ENSDORP00000000083  ...............DNVEDLIR...........G....GA.....................................
ENSDORP00000003321  ...............--------...........-....--.....................................
ENSDORP00000011353  ...............--------...........-....--.....................................
ENSDORP00000007355  ...............EMIEKLIF...........L....NL.....................................
ENSDORP00000007546  ...............EVVRFLVE...........Q....GA.....................................
ENSDORP00000009016  ...............DCVRELVL...........Q....GA.....................................
ENSDORP00000011081  ...............DIIALLLK...........H....GG.....................................
ENSDORP00000011018  ...............KCMELILK...........F....GE.....................................
ENSDORP00000003291  ...............EVVSELLQ...........R....EA.....................................
ENSDORP00000008149  ...............-IVDLLLT...........H....GA.....................................
ENSDORP00000014950  ...............DCLLSLLQ...........A....GA.....................................
ENSDORP00000012171  ...............ECLNLLLS...........S....GA.....................................
ENSDORP00000014237  ...............--------...........K....DG.....................................
ENSDORP00000007749  ...............AVVQRLVD...........I....GL.....................................
ENSDORP00000015309  ...............KCLRILCE...........H....GA.....................................
ENSDORP00000007119  ...............--------...........-....--.....................................
ENSDORP00000011018  ...............NTCQRLLQ...........D....IS.....................................
ENSDORP00000002435  ...............EILVELVQ...........Yc...HA.....................................
ENSDORP00000014274  ...............--------...........-....--.....................................
ENSDORP00000004702  ...............-CVRLLLN...........V....EA.....................................
ENSDORP00000013942  ...............EIVKELIK...........N....GA.....................................
ENSDORP00000011332  ...............--------...........-....KF.....................................
ENSDORP00000014237  ...............DVVEVVVK...........H....EA.....................................
ENSDORP00000014578  ...............--------...........-....--.....................................
ENSDORP00000005457  ...............--------...........-....--.....................................
ENSDORP00000015160  ...............AVCQFLLE...........S....GA.....................................
ENSDORP00000011906  ...............ECLNAILI...........H....GV.....................................
ENSDORP00000012571  ...............--------...........-....--.....................................
ENSDORP00000012644  ...............--------...........-....--.....................................
ENSDORP00000007538  ...............LALKTLIS...........Q....XXxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx....
ENSDORP00000009863  ...............--------...........-....--.....................................
ENSDORP00000010305  ...............EVVTLLLE...........F....GA.....................................
ENSDORP00000011587  ...............AISSLLLD...........T....GV.....................................
ENSDORP00000000485  ...............AVVEMLIM...........R....GA.....................................
ENSDORP00000014531  ...............--------...........-....--.....................................
ENSDORP00000012009  ...............--------...........-....--.....................................
ENSDORP00000009257  ...............AVIEVLHR...........G....SA.....................................
ENSDORP00000008161  ...............AAMLLMEA...........A....PE.....................................
ENSDORP00000009839  ...............DVVKFLLE...........K....GA.....................................
ENSDORP00000001630  ...............--------...........-....--.....................................
ENSDORP00000012903  ...............--------...........-....--.....................................
ENSDORP00000010147  ...............RRVQDLVR...........R....GH.....................................
ENSDORP00000008900  ...............--------...........-....--.....................................
ENSDORP00000004243  ...............--------...........-....--.....................................
ENSDORP00000008700  ...............--------...........-....--.....................................
ENSDORP00000008105  ...............EAAMALME...........A....AP.....................................
ENSDORP00000002464  ...............ESAQILLE...........A....GA.....................................
ENSDORP00000008204  ...............--------...........-....--.....................................
ENSDORP00000001653  ...............RIVSFLLK...........R....NA.....................................
ENSDORP00000013463  ...............DMVELLVR...........H....GA.....................................
ENSDORP00000013412  ...............--------...........-....--.....................................
ENSDORP00000007180  ...............RRIKELIS...........E....GA.....................................
ENSDORP00000000309  ...............SVICQLCN...........A....NF.....................................
ENSDORP00000008007  ...............--------...........-....--.....................................
ENSDORP00000010007  ...............--------...........-....--.....................................
ENSDORP00000013572  ...............--------...........-....--.....................................
ENSDORP00000002756  ...............--------...........-....--.....................................
ENSDORP00000008159  ...............--------...........-....--.....................................
ENSDORP00000013968  ...............--------...........-....--.....................................
ENSDORP00000010487  ...............--------...........-....--.....................................
ENSDORP00000001351  ...............--------...........G....DN.....................................
ENSDORP00000009580  ...............EAARMLLS...........A....GC.....................................
ENSDORP00000006712  ...............--------...........-....--.....................................
ENSDORP00000014166  ...............SIVTLLSR...........Cp...YL.....................................
ENSDORP00000013444  ...............ECVRWMVS...........E....TE.....................................
ENSDORP00000004275  ...............--------...........-....--.....................................
ENSDORP00000001355  ...............--------...........-....--.....................................
ENSDORP00000013087  ...............--------...........-....--.....................................
ENSDORP00000003943  ...............RMVRYLLE...........Q....GA.....................................
ENSDORP00000009340  ...............--------...........-....--.....................................
ENSDORP00000008149  ...............EMVALLLE...........F....GA.....................................
ENSDORP00000015559  ...............EILEKLLE...........S....GA.....................................
ENSDORP00000006156  ...............AMVQMLID...........A....GA.....................................
ENSDORP00000002459  ...............--------...........-....--.....................................
ENSDORP00000011514  ...............DICQLLHK...........F....GA.....................................
ENSDORP00000007506  ...............PIVDFLIA...........A....GA.....................................
ENSDORP00000014195  ...............AMVQMLLD...........A....GA.....................................
ENSDORP00000010305  ...............--------...........-....--.....................................
ENSDORP00000011086  ...............--------...........-....--.....................................
ENSDORP00000003906  ...............ETLKALVD...........L....DV.....................................
ENSDORP00000007061  ...............--------...........-....--.....................................
ENSDORP00000008791  ...............DVVEVLLR...........N....DA.....................................
ENSDORP00000011286  ...............--------...........-....--.....................................
ENSDORP00000010487  ...............ELAQVLLA...........M....HA.....................................
ENSDORP00000001046  ...............----FLIK...........N....GA.....................................
ENSDORP00000013206  ...............NIVRHLLE...........Y....GA.....................................
ENSDORP00000000302  ...............--------...........-....--.....................................
ENSDORP00000004396  ...............--------...........-....--.....................................
ENSDORP00000009263  ...............EIVRILLAfaeendildrfI....NA.....................................
ENSDORP00000005406  ...............--------...........-....--.....................................
ENSDORP00000011018  ...............--------...........-....--.....................................
ENSDORP00000007862  ...............--------...........-....--.....................................
ENSDORP00000005974  ...............--------...........-....--.....................................
ENSDORP00000015386  ...............--------...........-....--.....................................
ENSDORP00000004934  ...............--------...........-....--.....................................
ENSDORP00000007749  ...............ERMKELME...........K....RV.....................................
ENSDORP00000011209  xxxxxxxxxxytnnvPIAAKLLA...........-....--.....................................
ENSDORP00000014950  ...............AVLEALLG...........A....RF.....................................
ENSDORP00000004508  ...............DLLRLLIT...........K....GA.....................................
ENSDORP00000010830  ...............--------...........-....--.....................................
ENSDORP00000008316  ...............--------...........-....--.....................................
ENSDORP00000011647  ...............--------...........-....--.....................................
ENSDORP00000001838  ...............--------...........-....--.....................................
ENSDORP00000007356  ...............--------...........-....--.....................................
ENSDORP00000007453  ...............----EILR...........R....GC.....................................
ENSDORP00000009265  ...............--------...........-....--.....................................
ENSDORP00000006222  ...............--------...........-....--.....................................
ENSDORP00000010465  ...............--------...........-....--.....................................
ENSDORP00000005903  ...............HYVELLVA...........Q....GA.....................................
ENSDORP00000006810  ...............--------...........-....--.....................................
ENSDORP00000000618  ...............--------...........-....--.....................................
ENSDORP00000005027  ...............--------...........-....--.....................................
ENSDORP00000014908  ...............EVTELLLK...........K....EN.....................................
ENSDORP00000013576  ...............--------...........-....--.....................................
ENSDORP00000015191  ...............DCADALLK...........A....GA.....................................
ENSDORP00000001718  ...............--------...........-....--.....................................
ENSDORP00000004586  ...............--------...........-....--.....................................
ENSDORP00000010461  ...............EVTELLLK...........K....EN.....................................
ENSDORP00000011519  ...............--------...........-....--.....................................
ENSDORP00000010487  ...............--------...........-....--.....................................
ENSDORP00000015746  ...............--------...........-....--.....................................
ENSDORP00000008684  ...............ELIELLLS...........F....NV.....................................
ENSDORP00000001089  ...............AVVELLLA...........H....GA.....................................
ENSDORP00000007061  ...............--------...........-....--.....................................
ENSDORP00000011837  ...............EVVQELLG...........G....QPvaisavtvlsppp........................
ENSDORP00000000883  ...............RCLEILLQ...........N....GY.....................................
ENSDORP00000008319  ...............--------...........-....--.....................................
ENSDORP00000011516  ...............--------...........-....--.....................................
ENSDORP00000005420  ...............--------...........-....--.....................................
ENSDORP00000014434  ...............AIVEKLIQ...........A....GA.....................................
ENSDORP00000012876  ...............ELISLILK...........TskpkDV.....................................
ENSDORP00000002492  ...............HIVKFLLD...........F....GV.....................................
ENSDORP00000009438  ...............SSVKLLLS...........A....GA.....................................
ENSDORP00000006616  ...............--------...........-....--.....................................
ENSDORP00000014346  ...............--------...........-....--.....................................
ENSDORP00000005715  ...............--------...........-....--.....................................
ENSDORP00000007659  ...............--------...........-....--.....................................
ENSDORP00000000137  ...............-VMSLLSA...........-....--.....................................
ENSDORP00000011634  ...............---QLLLC...........R....GA.....................................
ENSDORP00000007355  ...............--------...........-....--.....................................
ENSDORP00000001096  ...............--------...........-....--.....................................
ENSDORP00000007335  ...............--------...........-....--.....................................
ENSDORP00000001630  ...............--------...........-....--.....................................
ENSDORP00000010887  ...............--------...........-....--.....................................
ENSDORP00000013121  ...............DILQLLLD...........Y....GCqxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxkl
ENSDORP00000007683  ...............-----LLE...........S....GA.....................................
ENSDORP00000002834  ...............--------...........-....--.....................................
ENSDORP00000014071  ...............--------...........-....--.....................................
ENSDORP00000000198  ...............--------...........-....--.....................................
ENSDORP00000006712  ...............--------...........-....--.....................................
ENSDORP00000009930  ...............--------...........-....--.....................................
ENSDORP00000010221  ...............--------...........-....--.....................................


                                                               100                                  
                                                                 |                                  
d1s70b_               .................................N........INQ.................................
ENSDORP00000001438  .................................Gtey.....LDL.................................
ENSDORP00000003161  .................................S........PHS.................................
ENSDORP00000013687  .................................R........TNE.................................
ENSDORP00000003291  .................................S........PNA.................................
ENSDORP00000015829  .................................-........LDL.................................
ENSDORP00000006395  .................................M........VNR.................................
ENSDORP00000006395  .................................A........HSL.................................
ENSDORP00000007897  .................................S........INE.................................
ENSDORP00000012171  .................................D........LGC.................................
ENSDORP00000015191  ddsdlegrtsfmwaagkgsddvlrtmlslksdiD........INM.................................
ENSDORP00000005511  .................................D........VNE.................................
ENSDORP00000001089  .................................N........KEH.................................
ENSDORP00000001089  .................................D........VNS.................................
ENSDORP00000012094  .................................F........LNF.................................
ENSDORP00000003161  .................................P........IQA.................................
ENSDORP00000008111  .................................S........PMA.................................
ENSDORP00000010887  .................................D........PNA.................................
ENSDORP00000015756  .................................N........PNF.................................
ENSDORP00000003012  .................................N........PNF.................................
ENSDORP00000003803  .................................A........VNA.................................
ENSDORP00000012171  .................................F........VLC.................................
ENSDORP00000010887  .................................K........MNA.................................
ENSDORP00000010328  .................................S........RVL.................................
ENSDORP00000010714  .................................C........VYS.................................
ENSDORP00000005245  .................................D........VNL.................................
ENSDORP00000012790  .................................R........VNA.................................
ENSDORP00000001687  .................................D........INS.................................
ENSDORP00000000524  .................................A........VDC.................................
ENSDORP00000002516  .................................N........ISI.................................
ENSDORP00000007933  .................................Rsdi.....INA.................................
ENSDORP00000001938  .................................N........VNQ.................................
ENSDORP00000002146  .................................D........VNA.................................
ENSDORP00000006986  .................................D........LSL.................................
ENSDORP00000013687  .................................D........LEI.................................
ENSDORP00000011695  .................................I........VDQ.................................
ENSDORP00000003709  .................................D........PNA.................................
ENSDORP00000012607  .................................D........PAL.................................
ENSDORP00000012790  .................................D........TAK.................................
ENSDORP00000001046  .................................N........VNA.................................
ENSDORP00000012574  .................................A........ATL.................................
ENSDORP00000012710  .................................D........ANL.................................
ENSDORP00000008802  .................................D........VTA.................................
ENSDORP00000012790  .................................S........ILC.................................
ENSDORP00000000031  .................................V........VDQ.................................
ENSDORP00000013942  .................................Y........VNI.................................
ENSDORP00000000883  .................................Sety.....IQT.................................
ENSDORP00000012440  .................................K........HNI.................................
ENSDORP00000010065  .................................N........VNV.................................
ENSDORP00000015111  .................................Dg.......VNA.................................
ENSDORP00000014007  .................................D........LDV.................................
ENSDORP00000008737  .................................N........VNA.................................
ENSDORP00000010826  .................................Sl.......HNQ.................................
ENSDORP00000003161  .................................N........VNAqsqxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ENSDORP00000002055  .................................X........XXX.................................
ENSDORP00000011259  .................................D........LNT.................................
ENSDORP00000014237  .................................D........PNA.................................
ENSDORP00000007536  .................................R........VNC.................................
ENSDORP00000004979  .................................N........VNH.................................
ENSDORP00000010830  .................................A........VNN.................................
ENSDORP00000008769  .................................Q........VNT.................................
ENSDORP00000009839  .................................D........MTI.................................
ENSDORP00000015161  .................................D........PNA.................................
ENSDORP00000001718  .................................G........VNV.................................
ENSDORP00000002537  .................................K........INV.................................
ENSDORP00000001580  .................................I........VDHhspsgeqpgmggs....................
ENSDORP00000009438  .................................N........PNA.................................
ENSDORP00000002055  .................................N........VDA.................................
ENSDORP00000015480  .................................-........---.................................
ENSDORP00000012408  .................................K........ANV.................................
ENSDORP00000002055  .................................D........IDT.................................
ENSDORP00000013812  .................................K........LNC.................................
ENSDORP00000013528  .................................Q........LGA.................................
ENSDORP00000000083  .................................D........VNC.................................
ENSDORP00000003321  .................................-........---.................................
ENSDORP00000011353  .................................-........---.................................
ENSDORP00000007355  .................................Q........TSE.................................
ENSDORP00000007546  .................................T........VNQ.................................
ENSDORP00000009016  .................................D........INL.................................
ENSDORP00000011081  .................................N........V-L.................................
ENSDORP00000011018  .................................EsgytreshINF.................................
ENSDORP00000003291  .................................N........VDA.................................
ENSDORP00000008149  .................................D........VNM.................................
ENSDORP00000014950  .................................E........PDI.................................
ENSDORP00000012171  .................................D........LRR.................................
ENSDORP00000014237  .................................D........TDI.................................
ENSDORP00000007749  .................................D........LEE.................................
ENSDORP00000015309  .................................Q........VNA.................................
ENSDORP00000007119  .................................-........-DS.................................
ENSDORP00000011018  .................................Dtrl.....LNE.................................
ENSDORP00000002435  .................................Q........MDV.................................
ENSDORP00000014274  .................................-........INM.................................
ENSDORP00000004702  .................................Q........VDA.................................
ENSDORP00000013942  .................................N........CNL.................................
ENSDORP00000011332  .................................D........VNY.................................
ENSDORP00000014237  .................................K........VNA.................................
ENSDORP00000014578  .................................-........---.................................
ENSDORP00000005457  .................................-........---.................................
ENSDORP00000015160  .................................K........CDA.................................
ENSDORP00000011906  .................................D........LTA.................................
ENSDORP00000012571  .................................-........---.................................
ENSDORP00000012644  .................................-........---.................................
ENSDORP00000007538  .................................X........VNG.................................
ENSDORP00000009863  .................................-........---.................................
ENSDORP00000010305  .................................C........VDG.................................
ENSDORP00000011587  .................................Ce.......VNQ.................................
ENSDORP00000000485  .................................R........INV.................................
ENSDORP00000014531  .................................-........---.................................
ENSDORP00000012009  .................................-........---.................................
ENSDORP00000009257  .................................D........LNA.................................
ENSDORP00000008161  .................................L........VFE.................................
ENSDORP00000009839  .................................N........VNA.................................
ENSDORP00000001630  .................................-........---.................................
ENSDORP00000012903  .................................-........---.................................
ENSDORP00000010147  .................................P........LNP.................................
ENSDORP00000008900  .................................-........---.................................
ENSDORP00000004243  .................................-........---.................................
ENSDORP00000008700  .................................-........---.................................
ENSDORP00000008105  .................................Dlvtep...IVC.................................
ENSDORP00000002464  .................................D........PNG.................................
ENSDORP00000008204  .................................-........---.................................
ENSDORP00000001653  .................................N........VNL.................................
ENSDORP00000013463  .................................D........INR.................................
ENSDORP00000013412  .................................-........---.................................
ENSDORP00000007180  .................................D........VNV.................................
ENSDORP00000000309  .................................N........VNQ.................................
ENSDORP00000008007  .................................-........---.................................
ENSDORP00000010007  .................................-........---.................................
ENSDORP00000013572  .................................-........---.................................
ENSDORP00000002756  .................................-........---.................................
ENSDORP00000008159  .................................-........---.................................
ENSDORP00000013968  .................................-........---.................................
ENSDORP00000010487  .................................-........---.................................
ENSDORP00000001351  .................................L........VNK.................................
ENSDORP00000009580  .................................G........ADV.................................
ENSDORP00000006712  .................................-........---.................................
ENSDORP00000014166  .................................D........VNH.................................
ENSDORP00000013444  .................................A........IAE.................................
ENSDORP00000004275  .................................-........---.................................
ENSDORP00000001355  .................................-........---.................................
ENSDORP00000013087  .................................-........---.................................
ENSDORP00000003943  .................................D........PNI.................................
ENSDORP00000009340  .................................-........---.................................
ENSDORP00000008149  .................................N........VDA.................................
ENSDORP00000015559  .................................T........VDF.................................
ENSDORP00000006156  .................................N........LDIqvpsnsprhpsih....................
ENSDORP00000002459  .................................-........---.................................
ENSDORP00000011514  .................................D........LLA.................................
ENSDORP00000007506  .................................N........VNS.................................
ENSDORP00000014195  .................................D........LNVevvstphkypsvh....................
ENSDORP00000010305  .................................-........---.................................
ENSDORP00000011086  .................................-........---.................................
ENSDORP00000003906  .................................D........IEA.................................
ENSDORP00000007061  .................................-........---.................................
ENSDORP00000008791  .................................L........TNV.................................
ENSDORP00000011286  .................................-........---.................................
ENSDORP00000010487  .................................N........VED.................................
ENSDORP00000001046  .................................L........VNA.................................
ENSDORP00000013206  .................................D........VNC.................................
ENSDORP00000000302  .................................-........---.................................
ENSDORP00000004396  .................................-........---.................................
ENSDORP00000009263  .................................E........YTE.................................
ENSDORP00000005406  .................................-........---.................................
ENSDORP00000011018  .................................-........---.................................
ENSDORP00000007862  .................................-........---.................................
ENSDORP00000005974  .................................-........---.................................
ENSDORP00000015386  .................................-........---.................................
ENSDORP00000004934  .................................-........---.................................
ENSDORP00000007749  .................................N........VRA.................................
ENSDORP00000011209  .................................-........---.................................
ENSDORP00000014950  .................................D........VNAplaperarl........................
ENSDORP00000004508  .................................K........VNG.................................
ENSDORP00000010830  .................................-........---.................................
ENSDORP00000008316  .................................-........---.................................
ENSDORP00000011647  .................................-........---.................................
ENSDORP00000001838  .................................-........---.................................
ENSDORP00000007356  .................................-........---.................................
ENSDORP00000007453  .................................H........VND.................................
ENSDORP00000009265  .................................-........---.................................
ENSDORP00000006222  .................................-........---.................................
ENSDORP00000010465  .................................-........---.................................
ENSDORP00000005903  .................................D........VHAqargrffqpkdegg...................
ENSDORP00000006810  .................................-........---.................................
ENSDORP00000000618  .................................-........---.................................
ENSDORP00000005027  .................................-........---.................................
ENSDORP00000014908  .................................L........ARI.................................
ENSDORP00000013576  .................................D........IEQ.................................
ENSDORP00000015191  .................................D........VNK.................................
ENSDORP00000001718  .................................-........---.................................
ENSDORP00000004586  .................................-........---.................................
ENSDORP00000010461  .................................L........ARV.................................
ENSDORP00000011519  .................................-........---.................................
ENSDORP00000010487  .................................-........VNR.................................
ENSDORP00000015746  .................................-........---.................................
ENSDORP00000008684  .................................Y........VGD.................................
ENSDORP00000001089  .................................D........PTH.................................
ENSDORP00000007061  .................................-........---.................................
ENSDORP00000011837  .................................G........PCS.................................
ENSDORP00000000883  .................................S........PDA.................................
ENSDORP00000008319  .................................-........---.................................
ENSDORP00000011516  .................................-........---.................................
ENSDORP00000005420  .................................-........---.................................
ENSDORP00000014434  .................................Q........IEF.................................
ENSDORP00000012876  .................................D........ATC.................................
ENSDORP00000002492  .................................N........VNA.................................
ENSDORP00000009438  .................................L........PNQ.................................
ENSDORP00000006616  .................................-........---.................................
ENSDORP00000014346  .................................-........---.................................
ENSDORP00000005715  .................................-........---.................................
ENSDORP00000007659  .................................-........---.................................
ENSDORP00000000137  .................................-........--P.................................
ENSDORP00000011634  .................................D........PNL.................................
ENSDORP00000007355  .................................-........---.................................
ENSDORP00000001096  .................................-........---.................................
ENSDORP00000007335  .................................-........---.................................
ENSDORP00000001630  .................................-........---.................................
ENSDORP00000010887  .................................-........---.................................
ENSDORP00000013121  ............................meriqN........PEY.................................
ENSDORP00000007683  .................................S........VNA.................................
ENSDORP00000002834  .................................-........---.................................
ENSDORP00000014071  .................................-........---.................................
ENSDORP00000000198  .................................-........---.................................
ENSDORP00000006712  .................................-........---.................................
ENSDORP00000009930  .................................-........---.................................
ENSDORP00000010221  .................................-........---.................................


                                  110                      120                                      
                                    |                        |                                      
d1s70b_               P..DNE....GWIPLHAAASC..G..Y...........LDIAEYL.................................
ENSDORP00000001438  Q..NDL....GQTALHLAAIL..G..E...........ASTVEKL.................................
ENSDORP00000003161  P..AWN....GYTPLHIAAKQ..N..Q...........MEVARSL.................................
ENSDORP00000013687  T..DND....GRIPFILASQE..G..H...........YDCVQIL.................................
ENSDORP00000003291  A..TTS....GYTPLHLSARE..G..H...........EDVASFL.................................
ENSDORP00000015829  Q..NDL....GQTALHLAAIL..G..E...........ASTVEKL.................................
ENSDORP00000006395  T..TES....GFTPLHIAAHY..G..N...........VNVATLL.................................
ENSDORP00000006395  A..TKK....GFTPLHVAAKY..G..S...........LDVAKLL.................................
ENSDORP00000007897  V..DFE....GRTPMHVACQH..G..Q...........ENIVRLL.................................
ENSDORP00000012171  K..DRK....GYGLLHTAAAS..G..Q...........IEVVKYL.................................
ENSDORP00000015191  A..DKY....GGTALHAAALS..G..H...........VSTVKLL.................................
ENSDORP00000005511  R..DSN....GFTAFMEAAWH..G..R...........VEALRFL.................................
ENSDORP00000001089  R..NVS....DYTPLSLAASG..G..Y...........VNIIKIL.................................
ENSDORP00000001089  Q..SAT....GNTALTYACAG..G..F...........VDIVKVLlneanidhnenghtsmasahvevrvlldhgaxx
ENSDORP00000012094  Q..NNL....QQTPLHLAVIT..N..Q...........PEIAEAL.................................
ENSDORP00000003161  K..TKN....GLSPIHMAAQG..D..H...........LDCVRLL.................................
ENSDORP00000008111  L..DRH....GQTAAHLACEH..R..S...........PTCLRAL.................................
ENSDORP00000010887  R..DNW....NYTPLHEAAIK..G..K...........IDVCIVL.................................
ENSDORP00000015756  Q..DKE....EETPLHCAAWH..G..Y...........YSVAKSL.................................
ENSDORP00000003012  Q..DKE....EETPLHCAAWH..G..Y...........YSVAKSL.................................
ENSDORP00000003803  A..SLD....GQIPLHLAAQY..G..H...........YEVSEML.................................
ENSDORP00000012171  R..DFK....GRTPIHLASAC..G..H...........TAVLRTL.................................
ENSDORP00000010887  L..DTL....GQTALHRAALA..G..H...........LQTCRLL.................................
ENSDORP00000010328  Q..DRH....GDTALHVACRR..Q..H...........LACARCL.................................
ENSDORP00000010714  K..EED....GSTCLHHAAKI..G..N...........LEMVSLL.................................
ENSDORP00000005245  K..NGS....GKDSLMLACYE..G..H...........LDVVKYL.................................
ENSDORP00000012790  K..DNM....WLTPLHRAVAS..R..S...........EEAVQVL.................................
ENSDORP00000001687  R..NED....GSTALHLATIS..C..Q...........PQCVKVL.................................
ENSDORP00000000524  L..KKG....DWTPLMMACTR..K..N...........LEVIQAL.................................
ENSDORP00000002516  A..NKY....DNTCLMIAAYK..G..H...........TDVVRYL.................................
ENSDORP00000007933  K..SND....GWTPLHVAAHY..G..R...........DSFVRLL.................................
ENSDORP00000001938  Q..DNE....GWTPLHAAASC..G..Y...........LNIAEYF.................................
ENSDORP00000002146  R..DSE....CWTPLHAAATC..G..H...........LHLVELL.................................
ENSDORP00000006986  L..DRL....GNSVLHLAAKE..G..H...........DQILNIL.................................
ENSDORP00000013687  E..DAH....GHTPLTLAARQ..G..H...........TKVVNCM.................................
ENSDORP00000011695  L..GGD....NS-TLHWATRQ..G..H...........LSMVVQL.................................
ENSDORP00000003709  P..DQE....GKRPLHLCRGA..G..T...........LECVELL.................................
ENSDORP00000012607  L..DRH....GDSAVHLALRA..GagA...........PDLLRAL.................................
ENSDORP00000012790  C..GIH....SMFPLHLAALN..A..H...........SDCCRKLlssgqkysivslfsnehv...............
ENSDORP00000001046  Q..DAE....GRTPVHVAISN..Q..H...........SVIIQLL.................................
ENSDORP00000012574  E..TQE....GALPLHHAAVS..G..D...........LTCLKLL.................................
ENSDORP00000012710  A..DED....GWAPLHFAAQN..G..D...........DRTARLL.................................
ENSDORP00000008802  Q..DTT....GHSALHLAAKN..G..H...........PECIKKL.................................
ENSDORP00000012790  K..DSR....GRTPLHYAAAR..G..H...........ATWLSEL.................................
ENSDORP00000000031  L..GGDl...NSTPLHWAIRQ..G..H...........LPMVILL.................................
ENSDORP00000013942  P..DRS....GDTVLIGAVRG..G..H...........VEIVRAL.................................
ENSDORP00000000883  K..TFE....GFCALHLAASQ..G..H...........WKIVQIL.................................
ENSDORP00000012440  P..DKN....GRLPLHAATAE..P..D...........VRLLTVL.................................
ENSDORP00000010065  Q..DAV....FFTPLHITAYH..G..H...........EQITRLL.................................
ENSDORP00000015111  Q..TKN....GATPLYLACQE..G..H...........LEVTQYL.................................
ENSDORP00000014007  Q..DDG....DQTALHRATVV..G..N...........TEIIAAL.................................
ENSDORP00000008737  V..TID....GVTPLFNACSQ..G..S...........ASCTELL.................................
ENSDORP00000010826  T..DRT....GETALHLAARY..S..R...........SDAAKRL.................................
ENSDORP00000003161  X..XXD....GFTPLAVALQQ..G..H...........ENVVAHL.................................
ENSDORP00000002055  X..XXX....XXXXXHWAAYM..G..H...........IEVVKLL.................................
ENSDORP00000011259  K..NGG....GWTPLMYASYI..G..H...........DTIVHLL.................................
ENSDORP00000014237  R..DNW....NYTPLHEAAIK..G..K...........IDVCIVL.................................
ENSDORP00000007536  T..TVD....WHTPLYNACVN..G..S...........RECADLL.................................
ENSDORP00000004979  Q..DED....FWTPMHIACAC..D..N...........PDIVLLL.................................
ENSDORP00000010830  T..TLT....NSTPLRAACFD..G..H...........LEIVKYL.................................
ENSDORP00000008769  T..DCW....GRTPLHVCAEK..G..H...........SQVLQAI.................................
ENSDORP00000009839  V..DNE....GKGVLFYCILPtkR..H...........YRCALIA.................................
ENSDORP00000015161  H..DKL....HRTALHWACLK..G..H...........IQLVNKL.................................
ENSDORP00000001718  T..NQD....GASPLHVAALH..G..R...........ADLVLLL.................................
ENSDORP00000002537  L..DGE....KRSPLIKAIQY..Q..K...........EKCVTIL.................................
ENSDORP00000001580  R..DELl...DITALMAATQH..G..H...........EAVARLL.................................
ENSDORP00000009438  K..NVE....GNSPLLTAVLR..D..S...........YDMAALL.................................
ENSDORP00000002055  K..DKW....GRTALHRGAVT..G..H...........EECIDAL.................................
ENSDORP00000015480  -..---....----LLEAARA..G..Q...........DDEVRIL.................................
ENSDORP00000012408  L..SEE....GMTPLHLCTTP..E..S...........LQCAKLL.................................
ENSDORP00000002055  P..DDF....GRTCLHAAAAG..G..N...........LECLNLL.................................
ENSDORP00000013812  Y..SLS....GHTALHFCTTP..S..S...........ILCAKQL.................................
ENSDORP00000013528  Rt.DRT....GETALHLAARY..A..R...........ADAAKRL.................................
ENSDORP00000000083  T..-HG....TLKPLHCACMV..S..D...........ADCVELL.................................
ENSDORP00000003321  -..---....-----------..-..-...........-------.................................
ENSDORP00000011353  -..---....-----------..-..-...........-------.................................
ENSDORP00000007355  K..DKE....GNTALHLAAMH..G..H...........SPAVQVL.................................
ENSDORP00000007546  A..DNE....GWTPLHVAASC..G..Y...........LDIARYL.................................
ENSDORP00000009016  Q..RES....GTTALFFAAQQ..G..H...........NEVVRFL.................................
ENSDORP00000011081  R..DGF....GVTPLGVAAEY..G..H...........CDVLEHL.................................
ENSDORP00000011018  V..NNK....KVSPLHLAVQS..G..D...........LEMIKMC.................................
ENSDORP00000003291  A..TKK....GNTALHIASLA..G..Q...........AEVVKVL.................................
ENSDORP00000008149  A..DKQ....GRTPLMMAASE..G..H...........LGTVDFL.................................
ENSDORP00000014950  S..NKS....RETPLYKACER..K..N...........AAAVRIL.................................
ENSDORP00000012171  R..DKF....GRTPLHYAAAN..G..S...........YQCAVTL.................................
ENSDORP00000014237  Q..DLLr...GDAALLDAAKK..G..C...........LARVKKL.................................
ENSDORP00000007749  Q..TVE....GLTALHSAAEG..I..H...........PDCVQVL.................................
ENSDORP00000015309  RvdNDN....KDSPLHLAITY..G..T...........YPILSIL.................................
ENSDORP00000007119  S..FQY....GWTPLMYAASV..A..N...........VELVRFL.................................
ENSDORP00000011018  G..DLH....GMTPLHLAAKN..G..H...........DKVVQLL.................................
ENSDORP00000002435  T..DNK....GETAFHYAVQG..D..N...........SQVLQXX.................................
ENSDORP00000014274  A..DGN....GNTALHYSVSH..S..N...........FEIVKLL.................................
ENSDORP00000004702  A..DKN....GFTPLCAAAAQ..G..H...........FECVELL.................................
ENSDORP00000013942  E..DLD....NWTALISASKE..G..H...........IHVVEEL.................................
ENSDORP00000011332  Af.GRV....KRSLLHIAANC..G..S...........VECLVLL.................................
ENSDORP00000014237  L..DNL....GQTSLHRAAHC..G..H...........LQTCRLL.................................
ENSDORP00000014578  -..---....-----------..-..-...........-------.................................
ENSDORP00000005457  -..---....----LLEAARK..G..Q...........DDEVRTL.................................
ENSDORP00000015160  Q..THG....GATALHRASYC..G..H...........TEIARLL.................................
ENSDORP00000011906  S..DPA....GRNALHLAAKY..G..H...........ALCLQKL.................................
ENSDORP00000012571  -..---....---LLLWAAEN..N..R...........ITTVQRL.................................
ENSDORP00000012644  -..---....-----------..-..-...........-------.................................
ENSDORP00000007538  V..TIH....GATPLFNACCS..G..S...........AACVSML.................................
ENSDORP00000009863  -..---....-----------..-..-...........-------.................................
ENSDORP00000010305  V..SEN....GMTALCYAAAA..G..H...........MKLVCLL.................................
ENSDORP00000011587  Q..NRA....GYSALMLAA--..-..-...........-------.................................
ENSDORP00000000485  M..NRG....DDTPLHLAASH..G..H...........RDIVQKL.................................
ENSDORP00000014531  -..---....-----------..-..-...........-------.................................
ENSDORP00000012009  -..---....-----------..-..-...........-------.................................
ENSDORP00000009257  R..NKR....RQTPLHIAVNK..G..H...........LQVVKTL.................................
ENSDORP00000008161  P..MQE....GQTALHIAVMN..Q..N...........VNLVRAL.................................
ENSDORP00000009839  T..DNL....LWTPLHFACHA..G..Q...........QDIVELL.................................
ENSDORP00000001630  -..---....-----------..-..-...........----EML.................................
ENSDORP00000012903  -..---....-----------..-..-...........-------.................................
ENSDORP00000010147  R..DYC....GWTPLHEACNY..G..H...........LEIVRFL.................................
ENSDORP00000008900  -..---....-----------..-..-...........-------.................................
ENSDORP00000004243  -..---....-----------..-..-...........-------.................................
ENSDORP00000008700  -..---....-----------..-..-...........-------.................................
ENSDORP00000008105  E..PFV....GQTALHIAVMN..Q..N...........VNLVRAL.................................
ENSDORP00000002464  S..RHH....RSTPVYHASRV..G..R...........ADLLKAL.................................
ENSDORP00000008204  -..---....-----------..-..-...........-------.................................
ENSDORP00000001653  K..NQK....ERTCLHYAVKK..R..F...........TFFDYLL.................................
ENSDORP00000013463  R..DRIh...ESSPLDLASEE..Pe.R...........LPCLRRL.................................
ENSDORP00000013412  -..---....-----------..-..-...........-------.................................
ENSDORP00000007180  K..DFA....GWTALHEACNR..-..-...........-------.................................
ENSDORP00000000309  R..RFImfsqGPTPLHLAAQA..C..S...........LEATICL.................................
ENSDORP00000008007  -..---....-----------..-..-...........-------.................................
ENSDORP00000010007  -..---....-----------..-..-...........-------.................................
ENSDORP00000013572  -..---....-----------..-..-...........-------.................................
ENSDORP00000002756  -..---....-----------..-..-...........-------.................................
ENSDORP00000008159  -..---....-----------..-..-...........-------.................................
ENSDORP00000013968  -..---....----LYFSARQ..G..E...........LQKVLLM.................................
ENSDORP00000010487  -..---....-----------..-..-...........--VVELL.................................
ENSDORP00000001351  P..DER....GFTPLIWASAF..G..E...........IETVRFL.................................
ENSDORP00000009580  L..SGS....RSTALHVAVQR..G..F...........LEVVKTL.................................
ENSDORP00000006712  -..---....-----------..-..-...........-----FL.................................
ENSDORP00000014166  Q..DKE....GNTALMLAAQA..G..H...........TPLVSFL.................................
ENSDORP00000013444  -..---....-----------..-..-...........-------.................................
ENSDORP00000004275  -..---....-----------..-..-...........-------.................................
ENSDORP00000001355  -..---....-----------..-..-...........-------.................................
ENSDORP00000013087  -..---....-----------..-..-...........-------.................................
ENSDORP00000003943  A..DRL....GRTALMHACAG..G..Gg..........AAVAALL.................................
ENSDORP00000009340  -..---....-----------..-..-...........-------.................................
ENSDORP00000008149  S..SES....GLTPLGYAAAA..G..F...........LSIVMLL.................................
ENSDORP00000015559  Q..DRL....DCTAMHWACRG..G..H...........LEVVKLL.................................
ENSDORP00000006156  P..DSR....HWTSLTFAVLH..G..H...........ISVVQLL.................................
ENSDORP00000002459  -..---....-----------..-..-...........-------.................................
ENSDORP00000011514  T..DYQ....GNTALHLC---..G..H...........VDTIQFL.................................
ENSDORP00000007506  P..DSH....GWTPLHCAASC..N..D...........TAICTAL.................................
ENSDORP00000014195  P..ETR....HWTALTFAVLH..G..H...........IPVVQLL.................................
ENSDORP00000010305  -..---....-----------..-..-...........-------.................................
ENSDORP00000011086  -..---....-----------..-..-...........-------.................................
ENSDORP00000003906  L..NFR....EEKARDVAARY..N..Q...........TECVEFL.................................
ENSDORP00000007061  -..---....-----------..-..-...........-------.................................
ENSDORP00000008791  A..DSK....GCYPLHLAAWK..G..D...........AQIVRLL.................................
ENSDORP00000011286  -..---....-----------..-..-...........-------.................................
ENSDORP00000010487  R..GIKg...DITPLMAAANG..G..H...........VKIVKLL.................................
ENSDORP00000001046  A..TLGa...QETPLHLVALY..S..PkkhsagvmsemAQIAEAL.................................
ENSDORP00000013206  S..AQD....GTRPLHDAVEN..D..H...........LEIVRLL.................................
ENSDORP00000000302  -..---....-----------..-..-...........-------.................................
ENSDORP00000004396  -..---....-----------..-..-...........-------.................................
ENSDORP00000009263  E..AYE....GQTALNIAIER..R..Q...........RDIAAEL.................................
ENSDORP00000005406  -..---....-----------..-..-...........-------.................................
ENSDORP00000011018  -..---....-----------..-..-...........-------.................................
ENSDORP00000007862  -..---....-----------..-..-...........-------.................................
ENSDORP00000005974  -..---....-----------..-..-...........-------.................................
ENSDORP00000015386  -..---....-----------..-..-...........-------.................................
ENSDORP00000004934  -..---....-----------..-..-...........-------.................................
ENSDORP00000007749  R..NHV....GRVALHWAAA-..-..-...........-------.................................
ENSDORP00000011209  -..---....-----------..-..-...........-------.................................
ENSDORP00000014950  Y..EDR....RSSALYFAVVN..N..N...........VRATELL.................................
ENSDORP00000004508  Q..QKN....GTTALIHAAEK..N..F...........LTTVAIL.................................
ENSDORP00000010830  -..---....-----------..-..-...........-------.................................
ENSDORP00000008316  -..---....-----------..-..-...........-------.................................
ENSDORP00000011647  -..---....-----------..-..-...........-------.................................
ENSDORP00000001838  -..---....-----------..-..-...........-------.................................
ENSDORP00000007356  -..--R....GHSALHIAIEK..R..S...........LQCVKLL.................................
ENSDORP00000007453  R..DGLt...DMTLLHYACKA..G..Ahgvgdpaaa..VRLSQQL.................................
ENSDORP00000009265  -..YYK....GQTALHIAIER..R..N...........MALVTLL.................................
ENSDORP00000006222  -..---....-----------..-..-...........-------.................................
ENSDORP00000010465  -..---....-----------..-..-...........-------.................................
ENSDORP00000005903  Y..FYF....GELPLSLAACT..N..Q...........PHIVNYL.................................
ENSDORP00000006810  -..---....-----------..-..-...........-------.................................
ENSDORP00000000618  -..---....-----------..-..-...........-------.................................
ENSDORP00000005027  -..---....-----------..-..-...........-------.................................
ENSDORP00000014908  G..D--....---ALLLAISK..G..Y...........VRIVEAI.................................
ENSDORP00000013576  L..DPR....GRTPLHLATTL..G..H...........LECARVL.................................
ENSDORP00000015191  T..DHS....QRTALHLAAQ-..-..-...........-------.................................
ENSDORP00000001718  -..---....-----------..-..-...........-------.................................
ENSDORP00000004586  -..---....-----ILAAAE..G..R...........FEVLREL.................................
ENSDORP00000010461  G..D--....---ALLLAISK..G..Y...........VRIVEAI.................................
ENSDORP00000011519  -..---....-----------..-..-...........-------.................................
ENSDORP00000010487  Tt.ANN....DHTVLSLACAG..G..H...........LAVVELL.................................
ENSDORP00000015746  -..---....-----------..-..-...........-ELVMLL.................................
ENSDORP00000008684  -..---....---ALLHAIRK..E..V...........VGAVELL.................................
ENSDORP00000001089  R..LKD....GSTMLIEAAKG..G..H...........TNVVSYL.................................
ENSDORP00000007061  -..---....-----------..-..-...........-------.................................
ENSDORP00000011837  P..QRL....LNWMLALACQR..G..H...........LGIVKLL.................................
ENSDORP00000000883  Q..MCLvfg.FGSPMCMAFQK..D..Cef.........FGIVNIL.................................
ENSDORP00000008319  -..---....-----------..-..-...........-------.................................
ENSDORP00000011516  -..---....-----------..-..-...........-------.................................
ENSDORP00000005420  -..---....--PPLHRACAR..H..D...........APALCLL.................................
ENSDORP00000014434  R..D--....-----------..-..-...........-------.................................
ENSDORP00000012876  S..DFS....FGTALHIASYN..L..C...........AGAVKCL.................................
ENSDORP00000002492  A..DSD....G----------..-..-...........-------.................................
ENSDORP00000009438  -..--D....PVNCLQIALRM..G..N...........YELINLL.................................
ENSDORP00000006616  -..---....-----------..-..-...........-------.................................
ENSDORP00000014346  -..---....-----------..-..-...........-------.................................
ENSDORP00000005715  -..---....-----------..-..-...........-------.................................
ENSDORP00000007659  -..---....-----------..-..-...........-------.................................
ENSDORP00000000137  L..GSG....GFTLLHAAAAA..G..R...........GSVVRLL.................................
ENSDORP00000011634  C..-QV....PMQALFLAVKA..G..D...........VEGVKLL.................................
ENSDORP00000007355  -..---....-----------..-..-...........-------.................................
ENSDORP00000001096  -..---....-----------..-..-...........-------.................................
ENSDORP00000007335  -..-FQ....GNEAMFEAVEQ..Q..D...........MDAVQLL.................................
ENSDORP00000001630  -..---....-----------..-..-...........-------.................................
ENSDORP00000010887  -..---....-----------..-..-...........-------.................................
ENSDORP00000013121  S..TTM....DVAPVILAAHR..N..N...........YEILTML.................................
ENSDORP00000007683  Pp.DPY....EQSPVHLAAGG..G..L...........AGFLLRQ.................................
ENSDORP00000002834  -..---....-----------..-..-...........-------.................................
ENSDORP00000014071  -..---....-----------..-..-...........-------.................................
ENSDORP00000000198  -..---....-----------..-..-...........-------.................................
ENSDORP00000006712  -..---....-----------..-..-...........-------.................................
ENSDORP00000009930  -..---....-----------..-..-...........-------.................................
ENSDORP00000010221  -..---....-----------..-..-...........-------.................................


                                                               130                                  
                                                                 |                                  
d1s70b_               ...........................I......SQ....G..A..................................
ENSDORP00000001438  ...........................Y......TA....G..A..................................
ENSDORP00000003161  ...........................L......QY....G..G..................................
ENSDORP00000013687  ...........................L......ES....K..S..................................
ENSDORP00000003291  ...........................L......DH....G..A..................................
ENSDORP00000015829  ...........................Y......TA....G..A..................................
ENSDORP00000006395  ...........................L......NR....G..A..................................
ENSDORP00000006395  ...........................L......QR....R..Aaadsagkxxxxxxxxxxxxxxxxxxxxxxxxxx.
ENSDORP00000007897  ...........................L......RR....G..V..................................
ENSDORP00000012171  ...........................L......RM....G..A..................................
ENSDORP00000015191  ...........................L......EN....D..A..................................
ENSDORP00000005511  ...........................F......AQ....G..A..................................
ENSDORP00000001089  ...........................L......NA....G..A..................................
ENSDORP00000001089  xxxxxxxxxxxxxxxxxxxhldmvrflL......EA....G..A..................................
ENSDORP00000012094  ...........................L......GA....G..C..................................
ENSDORP00000003161  ...........................L......QY....N..A..................................
ENSDORP00000008111  ...........................L......DSaapgT..V..................................
ENSDORP00000010887  ...........................L......QH....G..A..................................
ENSDORP00000015756  ...........................C......EA....G..C..................................
ENSDORP00000003012  ...........................C......EA....G..C..................................
ENSDORP00000003803  ...........................L......QH....Q..S..................................
ENSDORP00000012171  ...........................L......QA....A..L..................................
ENSDORP00000010887  ...........................L......SY....G..S..................................
ENSDORP00000010328  ...........................L......QG....Q..Pepgrepphsl........................
ENSDORP00000010714  ...........................L......ST....Gq.V..................................
ENSDORP00000005245  ...........................R......RH....G..A..................................
ENSDORP00000012790  ...........................I......KH....S..A..................................
ENSDORP00000001687  ...........................L......QH....G..A..................................
ENSDORP00000000524  ...........................V......EH....G..A..................................
ENSDORP00000002516  ...........................L......EQ....R..A..................................
ENSDORP00000007933  ...........................L......EF....K..A..................................
ENSDORP00000001938  ...........................I......NH....G..A..................................
ENSDORP00000002146  ...........................I......SS....G..A..................................
ENSDORP00000006986  ...........................L......KH....Kk.A..................................
ENSDORP00000013687  ...........................-......GR....G..A..................................
ENSDORP00000011695  ...........................M......KY....G..A..................................
ENSDORP00000003709  ...........................L......KF....G..A..................................
ENSDORP00000012607  ...........................L......CS....G..A..................................
ENSDORP00000012790  ...........................L......SA....G..F..................................
ENSDORP00000001046  ...........................I......SHp...N..I..................................
ENSDORP00000012574  ...........................Tv.....AH....S..S..................................
ENSDORP00000012710  ...........................L......DH....G..A..................................
ENSDORP00000008802  ...........................L......QS....K..C..................................
ENSDORP00000012790  ...........................L......QMals.E..E..................................
ENSDORP00000000031  ...........................L......QY....G..A..................................
ENSDORP00000013942  ...........................L......QK....Y..A..................................
ENSDORP00000000883  ...........................L......EA....G..A..................................
ENSDORP00000012440  ...........................L......QQ....SnlS..................................
ENSDORP00000010065  ...........................L......KL....G..A..................................
ENSDORP00000015111  ...........................Vq.....EC....G..A..................................
ENSDORP00000014007  ...........................V......QE....G..C..................................
ENSDORP00000008737  ...........................L......EY....G..A..................................
ENSDORP00000010826  ...........................L......EA....S..A..................................
ENSDORP00000003161  ...........................I......NY....G..T..................................
ENSDORP00000002055  ...........................V......AH....G..A..................................
ENSDORP00000011259  ...........................L......EA....G..V..................................
ENSDORP00000014237  ...........................L......QH....G..A..................................
ENSDORP00000007536  ...........................L......RH....G..A..................................
ENSDORP00000004979  ...........................L......LS....G..A..................................
ENSDORP00000010830  ...........................V......EH....K..A..................................
ENSDORP00000008769  ...........................QkgavrsNQ....F..V..................................
ENSDORP00000009839  ...........................L......EH....G..A..................................
ENSDORP00000015161  ...........................L......AA....G..A..................................
ENSDORP00000001718  ...........................L......KH....G..A..................................
ENSDORP00000002537  ...........................L......DH....G..A..................................
ENSDORP00000001580  ...........................M......EW....G..A..................................
ENSDORP00000009438  ...........................I......SR....G..A..................................
ENSDORP00000002055  ...........................L......QH....G..A..................................
ENSDORP00000015480  ...........................M......AN....G..A..................................
ENSDORP00000012408  ...........................L......EA....G..V..................................
ENSDORP00000002055  ...........................L......NT....G..A..................................
ENSDORP00000013812  ...........................V......WK....G..A..................................
ENSDORP00000013528  ...........................L......DA....G..A..................................
ENSDORP00000000083  ...........................L......EK....G..A..................................
ENSDORP00000003321  ...........................-......--....-..-..................................
ENSDORP00000011353  ...........................-......--....-..-..................................
ENSDORP00000007355  ...........................L......TQ....W..Q..................................
ENSDORP00000007546  ...........................L......SH....G..A..................................
ENSDORP00000009016  ...........................F......GF....G..A..................................
ENSDORP00000011081  ...........................I......HK....G..G..................................
ENSDORP00000011018  ...........................L......DN....G..A..................................
ENSDORP00000003291  ...........................V......TN....G..A..................................
ENSDORP00000008149  ...........................L......AQ....G..A..................................
ENSDORP00000014950  ...........................V......QH....N..A..................................
ENSDORP00000012171  ...........................V......TA....G..A..................................
ENSDORP00000014237  ...........................S......SP....-..D..................................
ENSDORP00000007749  ...........................L......RA....G..S..................................
ENSDORP00000015309  ...........................A......QS....G..A..................................
ENSDORP00000007119  ...........................L......DR....G..A..................................
ENSDORP00000011018  ...........................L......KK....G..A..................................
ENSDORP00000002435  ...........................X......XX....X..Xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ENSDORP00000014274  ...........................L......DA....Dv.C..................................
ENSDORP00000004702  ...........................I......AY....D..A..................................
ENSDORP00000013942  ...........................L......KC....G..V..................................
ENSDORP00000011332  ...........................L......KK....G..A..................................
ENSDORP00000014237  ...........................L......SY....G..C..................................
ENSDORP00000014578  ...........................-......--....-..-..................................
ENSDORP00000005457  ...........................M......AN....G..A..................................
ENSDORP00000015160  ...........................L......SH....G..S..................................
ENSDORP00000011906  ...........................L......QY....N..C..................................
ENSDORP00000012571  ...........................Ls.....EK....A..A..................................
ENSDORP00000012644  ...........................-......--....-..-..................................
ENSDORP00000007538  ...........................L......EH....G..A..................................
ENSDORP00000009863  ...........................-......--....-..-..................................
ENSDORP00000010305  ...........................T......KK....G..A..................................
ENSDORP00000011587  ...........................-......--....-..-..................................
ENSDORP00000000485  ...........................L......QY....K..A..................................
ENSDORP00000014531  ...........................-......--....-..-..................................
ENSDORP00000012009  ...........................-......--....-..-..................................
ENSDORP00000009257  ...........................L......DF....G..Chpslqxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ENSDORP00000008161  ...........................L......AR....G..A..................................
ENSDORP00000009839  ...........................V......KN....G..A..................................
ENSDORP00000001630  ...........................I......QH....Q..S..................................
ENSDORP00000012903  ...........................I......IN....G..A..................................
ENSDORP00000010147  ...........................L......DH....G..A..................................
ENSDORP00000008900  ...........................-......--....-..-..................................
ENSDORP00000004243  ...........................-......--....-..-..................................
ENSDORP00000008700  ...........................-......--....G..P..................................
ENSDORP00000008105  ...........................L......AR....G..A..................................
ENSDORP00000002464  ...........................I......RY....G..A..................................
ENSDORP00000008204  ...........................-......--....-..-..................................
ENSDORP00000001653  ...........................I......VL....-..-..................................
ENSDORP00000013463  ...........................L......EL....G..A..................................
ENSDORP00000013412  ...........................-......--....-..-..................................
ENSDORP00000007180  ...........................-......--....-..-..................................
ENSDORP00000000309  ...........................L......CF....K..A..................................
ENSDORP00000008007  ...........................-......--....-..A..................................
ENSDORP00000010007  ...........................-......--....G..A..................................
ENSDORP00000013572  ...........................-......--....-..-..................................
ENSDORP00000002756  ...........................-......--....-..-..................................
ENSDORP00000008159  ...........................-......--....-..-..................................
ENSDORP00000013968  ...........................L......VD....G..I..................................
ENSDORP00000010487  ...........................L......AR....G..A..................................
ENSDORP00000001351  ...........................L......EW....G..-..................................
ENSDORP00000009580  ...........................C......ER....G..C..................................
ENSDORP00000006712  ...........................I......GQ....G..A..................................
ENSDORP00000014166  ...........................L......NY....-..-..................................
ENSDORP00000013444  ...........................-......--....-..-..................................
ENSDORP00000004275  ...........................-......--....-..-..................................
ENSDORP00000001355  ...........................-......--....-..-..................................
ENSDORP00000013087  ...........................-......--....-..-..................................
ENSDORP00000003943  ...........................L......AH....G..A..................................
ENSDORP00000009340  ...........................-......--....-..-..................................
ENSDORP00000008149  ...........................C......KK....R..A..................................
ENSDORP00000015559  ...........................Q......SR....G..A..................................
ENSDORP00000006156  ...........................L......DA....G..A..................................
ENSDORP00000002459  ...........................-......--....-..-..................................
ENSDORP00000011514  ...........................V......SN....G..L..................................
ENSDORP00000007506  ...........................V......QH....G..A..................................
ENSDORP00000014195  ...........................L......DA....G..A..................................
ENSDORP00000010305  ...........................-......--....-..-..................................
ENSDORP00000011086  ...........................-......--....-..-..................................
ENSDORP00000003906  ...........................D......RA....D..A..................................
ENSDORP00000007061  ...........................-......--....-..-..................................
ENSDORP00000008791  ...........................I......HQ....G..Pshtrvneqxxxxxxxxxxxxxxxxxxxxxxxxxx
ENSDORP00000011286  ...........................-......--....-..-..................................
ENSDORP00000010487  ...........................L......AH....K..A..................................
ENSDORP00000001046  ...........................L......QA....G..A..................................
ENSDORP00000013206  ...........................L......SY....G..A..................................
ENSDORP00000000302  ...........................-......--....-..-..................................
ENSDORP00000004396  ...........................-......--....-..-..................................
ENSDORP00000009263  ...........................I......AA....G..A..................................
ENSDORP00000005406  ...........................-......--....-..-..................................
ENSDORP00000011018  ...........................-......--....-..-..................................
ENSDORP00000007862  ...........................-......--....-..-..................................
ENSDORP00000005974  ...........................-......--....-..-..................................
ENSDORP00000015386  ...........................-......--....-..-..................................
ENSDORP00000004934  ...........................-......--....-..-..................................
ENSDORP00000007749  ...........................-......--....-..-..................................
ENSDORP00000011209  ...........................-......--....-..-..................................
ENSDORP00000014950  ...........................L......GA....G..A..................................
ENSDORP00000004508  ...........................L......EA....G..A..................................
ENSDORP00000010830  ...........................-......--....-..-..................................
ENSDORP00000008316  ...........................-......--....-..-..................................
ENSDORP00000011647  ...........................-......--....-..-..................................
ENSDORP00000001838  ...........................-......--....-..-..................................
ENSDORP00000007356  ...........................V......EN....G..A..................................
ENSDORP00000007453  ...........................L......AL....G..A..................................
ENSDORP00000009265  ...........................V......EN....G..A..................................
ENSDORP00000006222  ...........................-......--....-..-..................................
ENSDORP00000010465  ...........................-......--....-..-..................................
ENSDORP00000005903  ...........................T......ENphk.K..A..................................
ENSDORP00000006810  ...........................-......--....-..-..................................
ENSDORP00000000618  ...........................-......--....-..-..................................
ENSDORP00000005027  ...........................-......--....-..-..................................
ENSDORP00000014908  ...........................L......SH....P..Afaasgrltlspceqelqdd...............
ENSDORP00000013576  ...........................L......AH....G..A..................................
ENSDORP00000015191  ...........................-......--....-..-..................................
ENSDORP00000001718  ...........................-......--....-..-..................................
ENSDORP00000004586  ...........................L......EA....E..P..................................
ENSDORP00000010461  ...........................L......GH....P..Afaqgrrlalspleqelrdd...............
ENSDORP00000011519  ...........................-......--....-..-..................................
ENSDORP00000010487  ...........................L......AH....G..A..................................
ENSDORP00000015746  ...........................L......EY....N..A..................................
ENSDORP00000008684  ...........................L......NH....K..K..................................
ENSDORP00000001089  ...........................L......DY....-..-..................................
ENSDORP00000007061  ...........................-......--....-..-..................................
ENSDORP00000011837  ...........................Vl.....SH....G..A..................................
ENSDORP00000000883  ...........................L......KY....G..A..................................
ENSDORP00000008319  ...........................-......--....-..-..................................
ENSDORP00000011516  ...........................-......--....-..-..................................
ENSDORP00000005420  ...........................L......RL....G..A..................................
ENSDORP00000014434  ...........................-......--....-..-..................................
ENSDORP00000012876  ...........................L......EH....G..A..................................
ENSDORP00000002492  ...........................-......--....-..-..................................
ENSDORP00000009438  ...........................L......RH....G..A..................................
ENSDORP00000006616  ...........................-......--....-..-..................................
ENSDORP00000014346  ...........................-......--....-..-..................................
ENSDORP00000005715  ...........................-......--....-..-..................................
ENSDORP00000007659  ...........................-......--....-..-..................................
ENSDORP00000000137  ...........................L......EA....G..A..................................
ENSDORP00000011634  ...........................L......ES....G..A..................................
ENSDORP00000007355  ...........................-......--....-..-..................................
ENSDORP00000001096  ...........................-......--....-..-..................................
ENSDORP00000007335  ...........................L......YQytpeE..L..................................
ENSDORP00000001630  ...........................-......--....-..-..................................
ENSDORP00000010887  ...........................-......--....-..-..................................
ENSDORP00000013121  ...........................L......KQ....D..V..................................
ENSDORP00000007683  ...........................L......QA....G..A..................................
ENSDORP00000002834  ...........................-......--....-..-..................................
ENSDORP00000014071  ...........................-......--....-..-..................................
ENSDORP00000000198  ...........................-......--....-..-..................................
ENSDORP00000006712  ...........................-......--....-..-..................................
ENSDORP00000009930  ...........................-......--....-..-..................................
ENSDORP00000010221  ...........................-......--....-..-..................................


                                                                                                    
                                                                                                    
d1s70b_               ..............................................................................
ENSDORP00000001438  ..............................................................................
ENSDORP00000003161  ..............................................................................
ENSDORP00000013687  ..............................................................................
ENSDORP00000003291  ..............................................................................
ENSDORP00000015829  ..............................................................................
ENSDORP00000006395  ..............................................................................
ENSDORP00000006395  ..............................................................................
ENSDORP00000007897  ..............................................................................
ENSDORP00000012171  ..............................................................................
ENSDORP00000015191  ..............................................................................
ENSDORP00000005511  ..............................................................................
ENSDORP00000001089  ..............................................................................
ENSDORP00000001089  ..............................................................................
ENSDORP00000012094  ..............................................................................
ENSDORP00000003161  ..............................................................................
ENSDORP00000008111  ..............................................................................
ENSDORP00000010887  ..............................................................................
ENSDORP00000015756  ..............................................................................
ENSDORP00000003012  ..............................................................................
ENSDORP00000003803  ..............................................................................
ENSDORP00000012171  ..............................................................................
ENSDORP00000010887  ..............................................................................
ENSDORP00000010328  ..............................................................................
ENSDORP00000010714  ..............................................................................
ENSDORP00000005245  ..............................................................................
ENSDORP00000012790  ..............................................................................
ENSDORP00000001687  ..............................................................................
ENSDORP00000000524  ..............................................................................
ENSDORP00000002516  ..............................................................................
ENSDORP00000007933  ..............................................................................
ENSDORP00000001938  ..............................................................................
ENSDORP00000002146  ..............................................................................
ENSDORP00000006986  ..............................................................................
ENSDORP00000013687  ..............................................................................
ENSDORP00000011695  ..............................................................................
ENSDORP00000003709  ..............................................................................
ENSDORP00000012607  ..............................................................................
ENSDORP00000012790  ..............................................................................
ENSDORP00000001046  ..............................................................................
ENSDORP00000012574  ..............................................................................
ENSDORP00000012710  ..............................................................................
ENSDORP00000008802  ..............................................................................
ENSDORP00000012790  ..............................................................................
ENSDORP00000000031  ..............................................................................
ENSDORP00000013942  ..............................................................................
ENSDORP00000000883  ..............................................................................
ENSDORP00000012440  ..............................................................................
ENSDORP00000010065  ..............................................................................
ENSDORP00000015111  ..............................................................................
ENSDORP00000014007  ..............................................................................
ENSDORP00000008737  ..............................................................................
ENSDORP00000010826  ..............................................................................
ENSDORP00000003161  ..............................................................................
ENSDORP00000002055  ..............................................................................
ENSDORP00000011259  ..............................................................................
ENSDORP00000014237  ..............................................................................
ENSDORP00000007536  ..............................................................................
ENSDORP00000004979  ..............................................................................
ENSDORP00000010830  ..............................................................................
ENSDORP00000008769  ..............................................................................
ENSDORP00000009839  ..............................................................................
ENSDORP00000015161  ..............................................................................
ENSDORP00000001718  ..............................................................................
ENSDORP00000002537  ..............................................................................
ENSDORP00000001580  ..............................................................................
ENSDORP00000009438  ..............................................................................
ENSDORP00000002055  ..............................................................................
ENSDORP00000015480  ..............................................................................
ENSDORP00000012408  ..............................................................................
ENSDORP00000002055  ..............................................................................
ENSDORP00000013812  ..............................................................................
ENSDORP00000013528  ..............................................................................
ENSDORP00000000083  ..............................................................................
ENSDORP00000003321  ..............................................................................
ENSDORP00000011353  ..............................................................................
ENSDORP00000007355  ..............................................................................
ENSDORP00000007546  ..............................................................................
ENSDORP00000009016  ..............................................................................
ENSDORP00000011081  ..............................................................................
ENSDORP00000011018  ..............................................................................
ENSDORP00000003291  ..............................................................................
ENSDORP00000008149  ..............................................................................
ENSDORP00000014950  ..............................................................................
ENSDORP00000012171  ..............................................................................
ENSDORP00000014237  ..............................................................................
ENSDORP00000007749  ..............................................................................
ENSDORP00000015309  ..............................................................................
ENSDORP00000007119  ..............................................................................
ENSDORP00000011018  ..............................................................................
ENSDORP00000002435  xxxxxxxxxxxxxxxxxxxxxxcaemiismds..............................................
ENSDORP00000014274  ..............................................................................
ENSDORP00000004702  ..............................................................................
ENSDORP00000013942  ..............................................................................
ENSDORP00000011332  ..............................................................................
ENSDORP00000014237  ..............................................................................
ENSDORP00000014578  ..............................................................................
ENSDORP00000005457  ..............................................................................
ENSDORP00000015160  ..............................................................................
ENSDORP00000011906  ..............................................................................
ENSDORP00000012571  ..............................................................................
ENSDORP00000012644  ..............................................................................
ENSDORP00000007538  ..............................................................................
ENSDORP00000009863  ..............................................................................
ENSDORP00000010305  ..............................................................................
ENSDORP00000011587  ..............................................................................
ENSDORP00000000485  ..............................................................................
ENSDORP00000014531  ..............................................................................
ENSDORP00000012009  ..............................................................................
ENSDORP00000009257  xxxxxxxxxxxxxxxxxxxxxxamrvllsklprpw...........................................
ENSDORP00000008161  ..............................................................................
ENSDORP00000009839  ..............................................................................
ENSDORP00000001630  ..............................................................................
ENSDORP00000012903  ..............................................................................
ENSDORP00000010147  ..............................................................................
ENSDORP00000008900  ..............................................................................
ENSDORP00000004243  ..............................................................................
ENSDORP00000008700  ..............................................................................
ENSDORP00000008105  ..............................................................................
ENSDORP00000002464  ..............................................................................
ENSDORP00000008204  ..............................................................................
ENSDORP00000001653  ..............................................................................
ENSDORP00000013463  ..............................................................................
ENSDORP00000013412  ..............................................................................
ENSDORP00000007180  ..............................................................................
ENSDORP00000000309  ..............................................................................
ENSDORP00000008007  ..............................................................................
ENSDORP00000010007  ..............................................................................
ENSDORP00000013572  ..............................................................................
ENSDORP00000002756  ..............................................................................
ENSDORP00000008159  ..............................................................................
ENSDORP00000013968  ..............................................................................
ENSDORP00000010487  ..............................................................................
ENSDORP00000001351  ..............................................................................
ENSDORP00000009580  ..............................................................................
ENSDORP00000006712  ..............................................................................
ENSDORP00000014166  ..............................................................................
ENSDORP00000013444  ..............................................................................
ENSDORP00000004275  ..............................................................................
ENSDORP00000001355  ..............................................................................
ENSDORP00000013087  ..............................................................................
ENSDORP00000003943  ..............................................................................
ENSDORP00000009340  ..............................................................................
ENSDORP00000008149  ..............................................................................
ENSDORP00000015559  ..............................................................................
ENSDORP00000006156  ..............................................................................
ENSDORP00000002459  ..............................................................................
ENSDORP00000011514  ..............................................................................
ENSDORP00000007506  ..............................................................................
ENSDORP00000014195  ..............................................................................
ENSDORP00000010305  ..............................................................................
ENSDORP00000011086  ..............................................................................
ENSDORP00000003906  ..............................................................................
ENSDORP00000007061  ..............................................................................
ENSDORP00000008791  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ENSDORP00000011286  ..............................................................................
ENSDORP00000010487  ..............................................................................
ENSDORP00000001046  ..............................................................................
ENSDORP00000013206  ..............................................................................
ENSDORP00000000302  ..............................................................................
ENSDORP00000004396  ..............................................................................
ENSDORP00000009263  ..............................................................................
ENSDORP00000005406  ..............................................................................
ENSDORP00000011018  ..............................................................................
ENSDORP00000007862  ..............................................................................
ENSDORP00000005974  ..............................................................................
ENSDORP00000015386  ..............................................................................
ENSDORP00000004934  ..............................................................................
ENSDORP00000007749  ..............................................................................
ENSDORP00000011209  ..............................................................................
ENSDORP00000014950  ..............................................................................
ENSDORP00000004508  ..............................................................................
ENSDORP00000010830  ..............................................................................
ENSDORP00000008316  ..............................................................................
ENSDORP00000011647  ..............................................................................
ENSDORP00000001838  ..............................................................................
ENSDORP00000007356  ..............................................................................
ENSDORP00000007453  ..............................................................................
ENSDORP00000009265  ..............................................................................
ENSDORP00000006222  ..............................................................................
ENSDORP00000010465  ..............................................................................
ENSDORP00000005903  ..............................................................................
ENSDORP00000006810  ..............................................................................
ENSDORP00000000618  ..............................................................................
ENSDORP00000005027  ..............................................................................
ENSDORP00000014908  ..............................................................................
ENSDORP00000013576  ..............................................................................
ENSDORP00000015191  ..............................................................................
ENSDORP00000001718  ..............................................................................
ENSDORP00000004586  ..............................................................................
ENSDORP00000010461  ..............................................................................
ENSDORP00000011519  ..............................................................................
ENSDORP00000010487  ..............................................................................
ENSDORP00000015746  ..............................................................................
ENSDORP00000008684  ..............................................................................
ENSDORP00000001089  ..............................................................................
ENSDORP00000007061  ..............................................................................
ENSDORP00000011837  ..............................................................................
ENSDORP00000000883  ..............................................................................
ENSDORP00000008319  ..............................................................................
ENSDORP00000011516  ..............................................................................
ENSDORP00000005420  ..............................................................................
ENSDORP00000014434  ..............................................................................
ENSDORP00000012876  ..............................................................................
ENSDORP00000002492  ..............................................................................
ENSDORP00000009438  ..............................................................................
ENSDORP00000006616  ..............................................................................
ENSDORP00000014346  ..............................................................................
ENSDORP00000005715  ..............................................................................
ENSDORP00000007659  ..............................................................................
ENSDORP00000000137  ..............................................................................
ENSDORP00000011634  ..............................................................................
ENSDORP00000007355  ..............................................................................
ENSDORP00000001096  ..............................................................................
ENSDORP00000007335  ..............................................................................
ENSDORP00000001630  ..............................................................................
ENSDORP00000010887  ..............................................................................
ENSDORP00000013121  ..............................................................................
ENSDORP00000007683  ..............................................................................
ENSDORP00000002834  ..............................................................................
ENSDORP00000014071  ..............................................................................
ENSDORP00000000198  ..............................................................................
ENSDORP00000006712  ..............................................................................
ENSDORP00000009930  ..............................................................................
ENSDORP00000010221  ..............................................................................


                                                                                                 140
                                                                                                   |
d1s70b_               ......................H.....VG....A.................................V...NS.EGD
ENSDORP00000001438  ......................S.....LL....V.................................A...ER.GGH
ENSDORP00000003161  ......................S.....AN....A.................................E...SV.QGV
ENSDORP00000013687  ......................N.....VD....Q.................................R...GY.DGR
ENSDORP00000003291  ......................S.....LS....I.................................T...TK.KGF
ENSDORP00000015829  ......................S.....LL....V.................................A...ER.GGH
ENSDORP00000006395  ......................A.....VD....F.................................T...AR.NGI
ENSDORP00000006395  ......................X.....XX....X.................................X...XX.NGY
ENSDORP00000007897  ......................D.....VG....L.................................Q...GK.DAW
ENSDORP00000012171  ......................E.....ID....E.................................P...NA.FGN
ENSDORP00000015191  ......................Q.....VD....A.................................T...DV.MKH
ENSDORP00000005511  ......................D.....VN....Asretqedrrp.......................L...RG.GGA
ENSDORP00000001089  ......................E.....IN....S.................................Rtg.SK.LGI
ENSDORP00000001089  ......................D.....QE....H.................................K...TD.EMH
ENSDORP00000012094  ......................D.....PE....L.................................R...DF.RGN
ENSDORP00000003161  ......................E.....ID....D.................................I...TL.DHL
ENSDORP00000008111  ......................D.....LE....A.................................R...NY.DGL
ENSDORP00000010887  ......................D.....PN....I.................................R...NT.DGK
ENSDORP00000015756  ......................N.....VN....V.................................K...NR.EGE
ENSDORP00000003012  ......................N.....VN....V.................................K...NR.EGE
ENSDORP00000003803  ......................N.....PC....L.................................V...NK.AKK
ENSDORP00000012171  ......................S.....TDpldaG.................................V...DY.SGY
ENSDORP00000010887  ......................D.....PS....I.................................I...SL.QGF
ENSDORP00000010328  ......................D.....LQ....L.................................Q...NW.QGL
ENSDORP00000010714  ......................D.....VN....A.................................Q...XX.XXX
ENSDORP00000005245  ......................S.....WE....A.................................R...DL.GGC
ENSDORP00000012790  ......................D.....VN....A.................................R...DK.NWQ
ENSDORP00000001687  ......................N.....ED....A.................................V...DM.ENR
ENSDORP00000000524  ......................N.....PL....L.................................K...NK.DGW
ENSDORP00000002516  ......................D.....PN....A.................................K...AH.CGA
ENSDORP00000007933  ......................E.....VD....P.................................L...SD.KGT
ENSDORP00000001938  ......................S.....VG....I.................................V...NS.EGE
ENSDORP00000002146  ......................D.....LL....A.................................V...NT.DGN
ENSDORP00000006986  ......................Apl...ID....H.................................P...NG.EGL
ENSDORP00000013687  ......................N.....IN....H.................................T...DQ.DGW
ENSDORP00000011695  ......................D.....PS....L.................................I...DG.EGC
ENSDORP00000003709  ......................R.....VD....G.................................Q...TEdEKE
ENSDORP00000012607  ......................PtvpkmLH....M.................................P...DF.EGL
ENSDORP00000012790  ......................E.....ID....T.................................P...DK.FGR
ENSDORP00000001046  ......................H.....LN....E.................................R...DR.QGL
ENSDORP00000012574  ......................G.....VN....Q.................................R...TR.SGA
ENSDORP00000012710  ......................L.....VD....A.................................Q...EH.EGW
ENSDORP00000008802  ......................P.....AE....N.................................V...DS.CGK
ENSDORP00000012790  ......................D.....CC....F.................................K...DN.QGY
ENSDORP00000000031  ......................D.....PT....L.................................I...DG.EGF
ENSDORP00000013942  ......................D.....ID....I.................................R...GQ.DNK
ENSDORP00000000883  ......................D.....PN....A.................................T...TL.EET
ENSDORP00000012440  ......................E.....VN....H.................................Q...DS.EGM
ENSDORP00000010065  ......................D.....VN....I.................................S...GE.VGD
ENSDORP00000015111  ......................D.....PH....L.................................C...AY.DGM
ENSDORP00000014007  ......................A.....LD....RqdkxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxX...XX.AGN
ENSDORP00000008737  ......................K.....AQ....-.................................L...ES.SLP
ENSDORP00000010826  ......................D.....AN....I.................................Q...DN.MGR
ENSDORP00000003161  ......................-.....--....-.................................K...GK.VRL
ENSDORP00000002055  ......................E.....VT....C.................................K...DK.KSY
ENSDORP00000011259  ......................S.....VN....V.................................P...TP.EGQ
ENSDORP00000014237  ......................E.....PT....I.................................R...NT.DGR
ENSDORP00000007536  ......................S.....PH....P.................................V...-N.DVA
ENSDORP00000004979  ......................D.....VL....L.................................Q...DV.NGN
ENSDORP00000010830  ......................D.....LE....V.................................S...NR.HGH
ENSDORP00000008769  ......................D.....LE....A.................................T...NY.DGL
ENSDORP00000009839  ......................D.....VN....N.................................V...TY.EGK
ENSDORP00000015161  ......................T.....VD....A.................................R...DL.LDR
ENSDORP00000001718  ......................S.....PS....A.................................R...DK.AQA
ENSDORP00000002537  ......................D.....PN....L.................................V...DF.HYN
ENSDORP00000001580  ......................D.....PN....H.................................Ta..RT.VGW
ENSDORP00000009438  ......................D.....VN....L.................................R...CA.NER
ENSDORP00000002055  ......................K.....CL....L.................................R...DS.RGR
ENSDORP00000015480  ......................P.....FT....-.................................T...DW.LGT
ENSDORP00000012408  ......................M.....VN....L.................................Aa..KE.SDV
ENSDORP00000002055  ......................D.....FN....R.................................K...DK.FGR
ENSDORP00000013812  ......................N.....VN....M.................................Ktn.NQ.DEE
ENSDORP00000013528  ......................D.....TN....A.................................Q...DH.SGR
ENSDORP00000000083  ......................E.....VN....A.................................L...DG.YNR
ENSDORP00000003321  ......................-.....--....-.................................-...--.---
ENSDORP00000011353  ......................-.....--....-.................................-...--.---
ENSDORP00000007355  ......................E.....VN....E.................................T...NE.NGE
ENSDORP00000007546  ......................N.....IA....A.................................V...NS.DGD
ENSDORP00000009016  ......................S.....TE....CrtkxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxX...XX.DGA
ENSDORP00000011081  ......................D.....VF....A.................................L...AD.DGA
ENSDORP00000011018  ......................H.....ID....L.................................Q...EN.GKC
ENSDORP00000003291  ......................N.....VN....AqsqxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxX...XX.DGF
ENSDORP00000008149  ......................S.....IA....L.................................M...DK.EGL
ENSDORP00000014950  ......................D.....AN....H.................................R...CN.RGW
ENSDORP00000012171  ......................G.....VN....E.................................A...DC.KGC
ENSDORP00000014237  ......................N.....VN....C.................................R...DT.QGR
ENSDORP00000007749  ......................S.....VN....Altqxxxxxxxxxxxxxxxxxxxxxx........X...--.---
ENSDORP00000015309  ......................Q.....VN....A.................................T...NE.SSM
ENSDORP00000007119  ......................N.....AS....-.................................F...SK.DKV
ENSDORP00000011018  ......................-.....LF....L.................................S...DH.NGW
ENSDORP00000002435  ......................N.....QI....H.................................S...KD.PRY
ENSDORP00000014274  ......................N.....VD....H.................................Q...NK.AGY
ENSDORP00000004702  ......................N.....ID....H.................................A...AA.GGL
ENSDORP00000013942  ......................N.....LE....H.................................R...DM.GGW
ENSDORP00000011332  ......................D.....PN....Y.................................Q...DI.SGC
ENSDORP00000014237  ......................D.....PN....I.................................I...SL.QGF
ENSDORP00000014578  ......................-.....--....-.................................-...--.---
ENSDORP00000005457  ......................P.....FT....-.................................T...DW.LGT
ENSDORP00000015160  ......................D.....PQ....L.................................V...DD.DGM
ENSDORP00000011906  ......................P.....TE....L.................................V...DL.QGR
ENSDORP00000012571  ......................H.....VN....T.................................R...DD.DEY
ENSDORP00000012644  ......................-.....--....-.................................-...--.---
ENSDORP00000007538  ......................R.....AQ....-.................................L...DM.HLC
ENSDORP00000009863  ......................-.....IN....H.................................T...DE.EGF
ENSDORP00000010305  ......................R.....VD....H.................................L...DK.KGQ
ENSDORP00000011587  ......................-.....--....-.................................-...--.---
ENSDORP00000000485  ......................D.....IN....A.................................V...NE.HGN
ENSDORP00000014531  ......................-.....--....-.................................R...NH.RGE
ENSDORP00000012009  ......................-.....--....-.................................-...--.---
ENSDORP00000009257  ......................I.....VD....E.................................K...KD.DGY
ENSDORP00000008161  ......................S.....VS....A.................................R...AT.GFA
ENSDORP00000009839  ......................A.....ID....A.................................P...SI.NNS
ENSDORP00000001630  ......................N.....PC....M.................................V...DN.SGK
ENSDORP00000012903  ......................N.....LA....A.................................R...DD.RGC
ENSDORP00000010147  ......................A.....VN....-.................................-...--.---
ENSDORP00000008900  ......................-.....--....-.................................-...--.---
ENSDORP00000004243  ......................-.....--....-.................................-...--.-GF
ENSDORP00000008700  ......................N.....VN....C.................................T...DS.SGY
ENSDORP00000008105  ......................S.....VS....A.................................R...AT.GFA
ENSDORP00000002464  ......................D.....VD....I.................................-...--.---
ENSDORP00000008204  ......................-.....--....-.................................-...--.---
ENSDORP00000001653  ......................-.....--....-.................................-...--.---
ENSDORP00000013463  ......................D.....VN....A.................................A...DK.HGK
ENSDORP00000013412  ......................-.....--....-.................................-...--.---
ENSDORP00000007180  ......................-.....--....-.................................-...--.---
ENSDORP00000000309  ......................D.....YT....L.................................S...EK.RGW
ENSDORP00000008007  ......................S.....IN....R.................................R...NI.FGE
ENSDORP00000010007  ......................D.....LL....A.................................V...NS.DGN
ENSDORP00000013572  ......................-.....--....-.................................-...--.---
ENSDORP00000002756  ......................-.....--....-.................................-...--.---
ENSDORP00000008159  ......................-.....--....-.................................-...--.---
ENSDORP00000013968  ......................D.....PN....F.................................Kme.HQ.NKR
ENSDORP00000010487  ......................N.....KE....H.................................R...NV.SDY
ENSDORP00000001351  ......................-.....--....-.................................-...--.---
ENSDORP00000009580  ......................D.....VN....L.................................-...--.---
ENSDORP00000006712  ......................H.....VG....A.................................V...NS.EGD
ENSDORP00000014166  ......................-.....--....-.................................-...--.---
ENSDORP00000013444  ......................-.....-L....S.................................C...SK.DFP
ENSDORP00000004275  ......................-.....--....-.................................-...--.---
ENSDORP00000001355  ......................-.....--....-.................................-...--.---
ENSDORP00000013087  ......................-.....--....-.................................-...--.---
ENSDORP00000003943  ......................D.....PS....V.................................R...DH.AGA
ENSDORP00000009340  ......................-.....--....-.................................-...--.---
ENSDORP00000008149  ......................K.....VD....H.................................L...DK.NGQ
ENSDORP00000015559  ......................D.....TN....V.................................R...DK.---
ENSDORP00000006156  ......................H.....V-....-.................................-...--.---
ENSDORP00000002459  ......................-.....--....-.................................-...--.---
ENSDORP00000011514  ......................K.....ID....-.................................-...--.---
ENSDORP00000007506  ......................A.....IF....A.................................T...TLsDGA
ENSDORP00000014195  ......................K.....VE....G.................................S...--.---
ENSDORP00000010305  ......................-.....--....-.................................-...--.---
ENSDORP00000011086  ......................-.....--....-.................................-...--.---
ENSDORP00000003906  ......................R.....L-....-.................................-...--.---
ENSDORP00000007061  ......................-.....--....-.................................-...--.---
ENSDORP00000008791  xxxxxxxxxxxxxxxxxxxxxiD.....VN....I.................................K...DN.HGR
ENSDORP00000011286  ......................-.....--....-.................................-...--.---
ENSDORP00000010487  ......................D.....VN....A.................................Q...SS.TXX
ENSDORP00000001046  ......................N.....PN....M.................................Q...DS.KGR
ENSDORP00000013206  ......................D.....PT....L.................................A...TY.SGR
ENSDORP00000000302  ......................-.....--....-.................................-...--.---
ENSDORP00000004396  ......................-.....--....-.................................-...--.---
ENSDORP00000009263  ......................D.....VN....Ahakgaffnprhqhd...................G...FY.IRE
ENSDORP00000005406  ......................-.....--....-.................................-...--.---
ENSDORP00000011018  ......................-.....--....-.................................-...--.---
ENSDORP00000007862  ......................-.....--....-.................................-...--.---
ENSDORP00000005974  ......................-.....--....-.................................-...--.---
ENSDORP00000015386  ......................-.....--....-.................................-...--.---
ENSDORP00000004934  ......................-.....--....-.................................-...--.---
ENSDORP00000007749  ......................-.....--....-.................................-...--.---
ENSDORP00000011209  ......................-.....--....-.................................-...--.---
ENSDORP00000014950  ......................D.....PN....-.................................-...-R.DVI
ENSDORP00000004508  ......................F.....VN....V.................................Q...-Q.SGE
ENSDORP00000010830  ......................-.....--....-.................................-...--.---
ENSDORP00000008316  ......................-.....--....-.................................-...--.---
ENSDORP00000011647  ......................-.....--....-.................................-...--.---
ENSDORP00000001838  ......................-.....--....-.................................-...--.---
ENSDORP00000007356  ......................N.....VH....A.................................R...AC.GHF
ENSDORP00000007453  ......................D.....VT....L.................................R...SRwTNM
ENSDORP00000009265  ......................D.....VQ....Aaangdffkktkgrp...................G...--.---
ENSDORP00000006222  ......................-.....--....-.................................-...--.---
ENSDORP00000010465  ......................-.....--....-.................................-...--.---
ENSDORP00000005903  ......................D.....MR....R.................................Q...DS.RGN
ENSDORP00000006810  ......................-.....--....-.................................-...--.---
ENSDORP00000000618  ......................-.....--....-.................................-...--.---
ENSDORP00000005027  ......................-.....--....-.................................-...--.---
ENSDORP00000014908  ......................D.....FY....A.................................Y...DE.DGT
ENSDORP00000013576  ......................D.....VG....R.................................E...NR.SGW
ENSDORP00000015191  ......................-.....--....-.................................-...--.---
ENSDORP00000001718  ......................-.....--....-.................................-...--.---
ENSDORP00000004586  ......................R.....LL....L.................................R...GD.---
ENSDORP00000010461  ......................D.....FY....A.................................Y...DE.DGT
ENSDORP00000011519  ......................-.....--....-.................................-...--.---
ENSDORP00000010487  ......................D.....PT....H.................................R...LK.DGS
ENSDORP00000015746  ......................D.....TT....V.................................V...NG.NGQ
ENSDORP00000008684  ......................P.....S-....-.................................-...--.---
ENSDORP00000001089  ......................-.....--....-.................................-...--.---
ENSDORP00000007061  ......................-.....--....-.................................-...--.---
ENSDORP00000011837  ......................D.....PE....-.................................-...--.---
ENSDORP00000000883  ......................Q.....LN....E.................................L...--.---
ENSDORP00000008319  ......................-.....--....-.................................R...DA.RGQ
ENSDORP00000011516  ......................-.....--....-.................................-...--.---
ENSDORP00000005420  ......................D.....PA....H.................................Q...DR.HGD
ENSDORP00000014434  ......................-.....--....-.................................-...--.---
ENSDORP00000012876  ......................N.....P-....-.................................-...--.---
ENSDORP00000002492  ......................-.....--....-.................................-...--.---
ENSDORP00000009438  ......................N.....VN....Y.................................F...CR.VNP
ENSDORP00000006616  ......................-.....--....-.................................-...--.---
ENSDORP00000014346  ......................-.....--....-.................................-...--.---
ENSDORP00000005715  ......................-.....--....-.................................-...--.---
ENSDORP00000007659  ......................-.....--....-.................................-...--.---
ENSDORP00000000137  ......................D.....PT....V.................................R...DS.QAQ
ENSDORP00000011634  ......................R.....TD....I.................................QyppQL.RSL
ENSDORP00000007355  ......................-.....--....-.................................-...--.---
ENSDORP00000001096  ......................-.....--....-.................................-...--.---
ENSDORP00000007335  ......................D.....LN....T.................................P...NS.EGL
ENSDORP00000001630  ......................-.....--....-.................................-...--.---
ENSDORP00000010887  ......................-.....--....-.................................-...--.---
ENSDORP00000013121  ......................S.....LP....K.................................P...HA.---
ENSDORP00000007683  ......................D.....LN....QqxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxlC...NK.NGQ
ENSDORP00000002834  ......................-.....--....-.................................-...--.---
ENSDORP00000014071  ......................-.....--....-.................................-...--.---
ENSDORP00000000198  ......................-.....--....-.................................-...--.---
ENSDORP00000006712  ......................-.....--....-.................................-...--.---
ENSDORP00000009930  ......................-.....--....-.................................-...--.---
ENSDORP00000010221  ......................-.....--....-.................................-...--.---


                                                                                                    
                                                                                                    
d1s70b_               ......TP.....................................................................L
ENSDORP00000001438  ......TA.....................................................................L
ENSDORP00000003161  ......TP.....................................................................L
ENSDORP00000013687  ......NA.....................................................................L
ENSDORP00000003291  ......TP.....................................................................L
ENSDORP00000015829  ......TA.....................................................................L
ENSDORP00000006395  ......TP.....................................................................L
ENSDORP00000006395  ......TP.....................................................................L
ENSDORP00000007897  ......LP.....................................................................L
ENSDORP00000012171  ......TA.....................................................................L
ENSDORP00000015191  ......TP.....................................................................L
ENSDORP00000005511  ......TA.....................................................................L
ENSDORP00000001089  ......SP.....................................................................L
ENSDORP00000001089  ......TA.....................................................................L
ENSDORP00000012094  ......TP.....................................................................L
ENSDORP00000003161  ......TP.....................................................................L
ENSDORP00000008111  ......TA.....................................................................L
ENSDORP00000010887  ......SAldladpsakavltgeykkde.................................................L
ENSDORP00000015756  ......TP.....................................................................L
ENSDORP00000003012  ......TP.....................................................................L
ENSDORP00000003803  ......TP.....................................................................L
ENSDORP00000012171  ......SP.....................................................................M
ENSDORP00000010887  ......TAaqmgneavqqilsestpirtsdvdyr...........................................L
ENSDORP00000010328  ......AC.....................................................................L
ENSDORP00000010714  ......XX.....................................................................X
ENSDORP00000005245  ......TA.....................................................................L
ENSDORP00000012790  ......TP.....................................................................L
ENSDORP00000001687  ......SP.....................................................................L
ENSDORP00000000524  ......NSfhiasregdplilqylltvcpdawkteskirrtp...................................L
ENSDORP00000002516  ......TA.....................................................................L
ENSDORP00000007933  ......TP.....................................................................L
ENSDORP00000001938  ......VP.....................................................................S
ENSDORP00000002146  ......MP.....................................................................Y
ENSDORP00000006986  ......NA.....................................................................I
ENSDORP00000013687  ......TV.....................................................................L
ENSDORP00000011695  ......SC.....................................................................I
ENSDORP00000003709  ......TA.....................................................................L
ENSDORP00000012607  ......YP.....................................................................I
ENSDORP00000012790  ......TC.....................................................................L
ENSDORP00000001046  ......TP.....................................................................F
ENSDORP00000012574  ......SP.....................................................................L
ENSDORP00000012710  ......TP.....................................................................L
ENSDORP00000008802  ......TA.....................................................................L
ENSDORP00000012790  ......TP.....................................................................L
ENSDORP00000000031  ......SS.....................................................................I
ENSDORP00000013942  ......TA.....................................................................L
ENSDORP00000000883  ......TPlflxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...................................X
ENSDORP00000012440  ......TP.....................................................................L
ENSDORP00000010065  ......RP.....................................................................L
ENSDORP00000015111  ......SP.....................................................................L
ENSDORP00000014007  ......TA.....................................................................L
ENSDORP00000008737  ......SP.....................................................................T
ENSDORP00000010826  ......TP.....................................................................L
ENSDORP00000003161  ......PA.....................................................................L
ENSDORP00000002055  ......TP.....................................................................L
ENSDORP00000011259  ......TP.....................................................................L
ENSDORP00000014237  ......TAldladpsakavltgdykkde.................................................L
ENSDORP00000007536  ......SP.....................................................................M
ENSDORP00000004979  ......IP.....................................................................L
ENSDORP00000010830  ......TC.....................................................................L
ENSDORP00000008769  ......TP.....................................................................L
ENSDORP00000009839  ......PV.....................................................................F
ENSDORP00000015161  ......TP.....................................................................V
ENSDORP00000001718  ......TP.....................................................................L
ENSDORP00000002537  ......TA.....................................................................L
ENSDORP00000001580  ......SP.....................................................................L
ENSDORP00000009438  ......TA.....................................................................L
ENSDORP00000002055  ......TPihlsaacghigvlxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhdtcvellleqevfqkiegnafspL
ENSDORP00000015480  ......SP.....................................................................L
ENSDORP00000012408  ......TP.....................................................................L
ENSDORP00000002055  ......T-.....................................................................L
ENSDORP00000013812  ......TP.....................................................................L
ENSDORP00000013528  ......TP.....................................................................L
ENSDORP00000000083  ......TA.....................................................................L
ENSDORP00000003321  ......--.....................................................................-
ENSDORP00000011353  ......--.....................................................................-
ENSDORP00000007355  ......TP.....................................................................F
ENSDORP00000007546  ......LP.....................................................................L
ENSDORP00000009016  ......TA.....................................................................L
ENSDORP00000011081  ......SV.....................................................................L
ENSDORP00000011018  ......MA.....................................................................L
ENSDORP00000003291  ......TP.....................................................................L
ENSDORP00000008149  ......TA.....................................................................L
ENSDORP00000014950  ......TA.....................................................................L
ENSDORP00000012171  ......SP.....................................................................L
ENSDORP00000014237  ....hsTP.....................................................................L
ENSDORP00000007749  ......--.....................................................................-
ENSDORP00000015309  ......TP.....................................................................L
ENSDORP00000007119  ......TI.....................................................................L
ENSDORP00000011018  ......TA.....................................................................L
ENSDORP00000002435  ......AP.....................................................................L
ENSDORP00000014274  ......TP.....................................................................I
ENSDORP00000004702  ......TP.....................................................................L
ENSDORP00000013942  ......TA.....................................................................L
ENSDORP00000011332  ......TP.....................................................................L
ENSDORP00000014237  ......TA.....................................................................L
ENSDORP00000014578  ......--.....................................................................-
ENSDORP00000005457  ......SP.....................................................................L
ENSDORP00000015160  ......TS.....................................................................L
ENSDORP00000011906  ......TA.....................................................................L
ENSDORP00000012571  ......TP.....................................................................L
ENSDORP00000012644  ......--.....................................................................-
ENSDORP00000007538  ......SP.....................................................................I
ENSDORP00000009863  ......TP.....................................................................L
ENSDORP00000010305  ......CA.....................................................................L
ENSDORP00000011587  ......--.....................................................................L
ENSDORP00000000485  ......V-.....................................................................-
ENSDORP00000014531  ......TL.....................................................................L
ENSDORP00000012009  ......--.....................................................................F
ENSDORP00000009257  ......TA.....................................................................L
ENSDORP00000008161  ......--.....................................................................-
ENSDORP00000009839  ......TP.....................................................................L
ENSDORP00000001630  ......TP.....................................................................L
ENSDORP00000012903  ......TP.....................................................................V
ENSDORP00000010147  ......--.....................................................................-
ENSDORP00000008900  ......--.....................................................................-
ENSDORP00000004243  ......TA.....................................................................I
ENSDORP00000008700  ......TA.....................................................................L
ENSDORP00000008105  ......--.....................................................................-
ENSDORP00000002464  ......--.....................................................................-
ENSDORP00000008204  ......--.....................................................................-
ENSDORP00000001653  ......--.....................................................................L
ENSDORP00000013463  ......TA.....................................................................L
ENSDORP00000013412  ......--.....................................................................-
ENSDORP00000007180  ......--.....................................................................-
ENSDORP00000000309  ......MP.....................................................................I
ENSDORP00000008007  ......NL.....................................................................I
ENSDORP00000010007  ......MP.....................................................................Y
ENSDORP00000013572  ......--.....................................................................-
ENSDORP00000002756  ......NP.....................................................................L
ENSDORP00000008159  ......--.....................................................................Y
ENSDORP00000013968  ......SP.....................................................................L
ENSDORP00000010487  ......TP.....................................................................L
ENSDORP00000001351  ......--.....................................................................-
ENSDORP00000009580  ......--.....................................................................-
ENSDORP00000006712  ......TP.....................................................................L
ENSDORP00000014166  ......--.....................................................................-
ENSDORP00000013444  ......SL.....................................................................I
ENSDORP00000004275  ......--.....................................................................-
ENSDORP00000001355  ......--.....................................................................-
ENSDORP00000013087  ......--.....................................................................-
ENSDORP00000003943  ......SA.....................................................................L
ENSDORP00000009340  ......--.....................................................................-
ENSDORP00000008149  ......CA.....................................................................L
ENSDORP00000015559  ......--.....................................................................-
ENSDORP00000006156  ......--.....................................................................-
ENSDORP00000002459  ......--.....................................................................-
ENSDORP00000011514  ......--.....................................................................I
ENSDORP00000007506  ......TA.....................................................................I
ENSDORP00000014195  ......--.....................................................................-
ENSDORP00000010305  ......--.....................................................................-
ENSDORP00000011086  ......--.....................................................................-
ENSDORP00000003906  ......--.....................................................................-
ENSDORP00000007061  ......--.....................................................................-
ENSDORP00000008791  ......TA.....................................................................L
ENSDORP00000011286  ......--.....................................................................-
ENSDORP00000010487  ......XXxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx..X
ENSDORP00000001046  ......TP.....................................................................L
ENSDORP00000013206  ......TI.....................................................................-
ENSDORP00000000302  ......--.....................................................................-
ENSDORP00000004396  ......--.....................................................................-
ENSDORP00000009263  ......TP.....................................................................L
ENSDORP00000005406  ......--.....................................................................-
ENSDORP00000011018  ......--.....................................................................-
ENSDORP00000007862  ......--.....................................................................-
ENSDORP00000005974  ......--.....................................................................-
ENSDORP00000015386  ......--.....................................................................-
ENSDORP00000004934  ......--.....................................................................-
ENSDORP00000007749  ......--.....................................................................-
ENSDORP00000011209  ......--.....................................................................-
ENSDORP00000014950  ......SP.....................................................................L
ENSDORP00000004508  ......TA.....................................................................L
ENSDORP00000010830  ......--.....................................................................-
ENSDORP00000008316  ......--.....................................................................-
ENSDORP00000011647  ......--.....................................................................-
ENSDORP00000001838  ......--.....................................................................-
ENSDORP00000007356  ......--.....................................................................-
ENSDORP00000007453  ......NA.....................................................................L
ENSDORP00000009265  ......--.....................................................................-
ENSDORP00000006222  ......--.....................................................................-
ENSDORP00000010465  ......--.....................................................................-
ENSDORP00000005903  ......TV.....................................................................L
ENSDORP00000006810  ......--.....................................................................-
ENSDORP00000000618  ......--.....................................................................-
ENSDORP00000005027  ......--.....................................................................-
ENSDORP00000014908  rfspdiT-.....................................................................-
ENSDORP00000013576  ......TV.....................................................................L
ENSDORP00000015191  ......--.....................................................................-
ENSDORP00000001718  ......--.....................................................................-
ENSDORP00000004586  ......--.....................................................................-
ENSDORP00000010461  ......--.....................................................................-
ENSDORP00000011519  ......--.....................................................................-
ENSDORP00000010487  ......TM.....................................................................L
ENSDORP00000015746  ......TA.....................................................................K
ENSDORP00000008684  ......--.....................................................................-
ENSDORP00000001089  ......--.....................................................................-
ENSDORP00000007061  ......--.....................................................................-
ENSDORP00000011837  ......--.....................................................................-
ENSDORP00000000883  ......-H.....................................................................L
ENSDORP00000008319  ......FP.....................................................................L
ENSDORP00000011516  ......--.....................................................................-
ENSDORP00000005420  ......TA.....................................................................L
ENSDORP00000014434  ......--.....................................................................-
ENSDORP00000012876  ......--.....................................................................-
ENSDORP00000002492  ......--.....................................................................-
ENSDORP00000009438  ......LH.....................................................................F
ENSDORP00000006616  ......--.....................................................................-
ENSDORP00000014346  ......--.....................................................................-
ENSDORP00000005715  ......--.....................................................................-
ENSDORP00000007659  ......--.....................................................................-
ENSDORP00000000137  ......PP.....................................................................Y
ENSDORP00000011634  ......TP.....................................................................L
ENSDORP00000007355  ......--.....................................................................-
ENSDORP00000001096  ......--.....................................................................-
ENSDORP00000007335  ......TP.....................................................................L
ENSDORP00000001630  ......--.....................................................................-
ENSDORP00000010887  ......--.....................................................................-
ENSDORP00000013121  ......--.....................................................................-
ENSDORP00000007683  ......TA.....................................................................E
ENSDORP00000002834  ......TL.....................................................................L
ENSDORP00000014071  ......--.....................................................................-
ENSDORP00000000198  ......--.....................................................................-
ENSDORP00000006712  ......--.....................................................................-
ENSDORP00000009930  ......--.....................................................................-
ENSDORP00000010221  ......--.....................................................................-


                            150               160                                          170      
                              |                 |                                            |      
d1s70b_               DIA..EEEA......M..EELLQNEVN.R..................................QGVDIEAARK.EEER
ENSDORP00000001438  HLA..CRVR......A..HACACALLQ.-..................................-------PRP.RDHT
ENSDORP00000003161  HLA..AQEG......H..AEMVALLLS.-..................................KQANGNLGNK.SGLT
ENSDORP00000013687  RVA..ALEG......H..RDIVELLLS.-..................................HGADVDYKDA.DGRP
ENSDORP00000003291  HVA..AKYG......K..LEVANLLLQ.-..................................KSASPDAAGK.SGLT
ENSDORP00000015829  HLA..CRVR......A..HACACALLQ.-..................................-------PRP.RDHT
ENSDORP00000006395  HVA..SKRG......N..TNMVKLLLD.-..................................RGGQINAKTR.DGLT
ENSDORP00000006395  HIA..AKKN......Q..MQIASTLLN.-..................................YGAETNIVTK.QGVT
ENSDORP00000007897  HYA..AWQG......H..LSIVKLLAR.Q..................................PGVSVNAQTL.DGKT
ENSDORP00000012171  HIA..CYLG......Q..DAVAIELVN.-..................................AGANVNQPND.KGFT
ENSDORP00000015191  FRA..CEMG......H..KDVIQTLIK.-..................................GGARVDLVDQ.DGHS
ENSDORP00000005511  MDA..AERG......H..VEVVRILLE.E..................................MGADVNARDN.MGRS
ENSDORP00000001089  MLA..AMNG......H..VPAVKLLLD.-..................................MGSDINAQIEtNRNT
ENSDORP00000001089  MEA..CMDG......H..VEVARLLLD.-..................................SGAQVNMPAD.SFES
ENSDORP00000012094  HLA..CEQG......C..LASVGVLTQ.T..................................CTTQH-----.----
ENSDORP00000003161  HVA..AHCG......H..HRVANVLLD.-..................................KGAKPNSRAL.NGFT
ENSDORP00000008111  HVA..VNTG......C..PETVLLLLE.-..................................----------.----
ENSDORP00000010887  LEA..ARSG......N..EEKLMALLT.P..................................LNVNCHASDG.RKST
ENSDORP00000015756  LTA..SARG......Y..HDIVECLAE.-..................................----------.----
ENSDORP00000003012  LTA..SARG......Y..HDIVECLAE.-..................................----------.----
ENSDORP00000003803  DLA..CEFG......R..LKVAQLLLN.-..................................SHLCVALL--.----
ENSDORP00000012171  HWA..SYTG......H..EDCLELLLE.Hspfsylegnpftplhcavinnqdsttemllgal.GDKIVNSRDA.KGRT
ENSDORP00000010887  LEA..SKAG......D..LETVKQLCS.-..................................----------.----
ENSDORP00000010328  HIA..TLQK......N..QPLMELLLQ.-..................................----------.----
ENSDORP00000010714  IWA..AEHK......H..IDVIRMLLT.-..................................----------.----
ENSDORP00000005245  HWA..ADGG......H..CPVIEWMIK.-..................................----------.----
ENSDORP00000012790  HVA..AANK......A..VKCAEVIIP.-..................................----------.----
ENSDORP00000001687  HWA..ASSG......C..ASSVLLLCD.-..................................----------.----
ENSDORP00000000524  HTA..AMHG......C..LEAVKVLLK.R..................................CQYEPDCRDN.CGVT
ENSDORP00000002516  HFA..AEAG......H..LDIVKELIK.-..................................----------.----
ENSDORP00000007933  QLA..IIRE......R..SSCVKILLD.-..................................----------.----
ENSDORP00000001938  DLA..EEPA......M..KDLLLEQVK.K..................................QGVDLEQSRK.EEEQ
ENSDORP00000002146  DLC..EDEQ......T..LDCLETAMA.N..................................RGITQESIEE.ARAV
ENSDORP00000006986  HIA..VLSN......S..LPCLLLLVA.-..................................----------.----
ENSDORP00000013687  RSA..AWGG......H..TEVVSALLY.-..................................----------.----
ENSDORP00000011695  HLA..AQFG......H..TSIVAYLIA.-..................................----------.----
ENSDORP00000003709  HVA..ARLG......H..VEMAALLLR.-..................................RGACPDARNA.EGWT
ENSDORP00000012607  HLA..VRAR......S..PECLDLLVD.-..................................----------.----
ENSDORP00000012790  HAA..AAGG......N..VECIKLLQS.-..................................----------.----
ENSDORP00000001046  ACA..MTYK......N..NKAAEAILK.R..................................ESGAAEQVDN.KGRN
ENSDORP00000012574  YLA..CQEG......H..LHLAQFLVK.D..................................CGADVRLRAL.DGMS
ENSDORP00000012710  HLA..VQNN......F..ENVARLLVS.-..................................----------.----
ENSDORP00000008802  HYA..XXXX......X..XXXXXXXXX.-..................................----------.----
ENSDORP00000012790  HWA..CYNG......N..ENCLEVLLE.-..................................--QKCFKFMG.NPFT
ENSDORP00000000031  HLA..VLFQ......H..MPIIAYLIS.-..................................----------.----
ENSDORP00000013942  YWA..VEKG......N..ATMVRDILQ.-..................................----------.----
ENSDORP00000000883  XXX..XXXG......N..AEIIKLLLK.-..................................----------.----
ENSDORP00000012440  HWA..AFHN......R..PQHTQMLLK.-..................................KGADPTLVDK.DFKT
ENSDORP00000010065  HLA..SAKG......L..LNIAKLLME.-..................................DG--------.----
ENSDORP00000015111  HAA..AQMG......H..CPVIVWLVS.C..................................----------.----
ENSDORP00000014007  HLA..CQNS......H..SQSTRVLLL.-..................................----------.----
ENSDORP00000008737  HEA..ANKG......H..HECLDILIS.-..................................----------.----
ENSDORP00000010826  HAA..VSAD......A..QGVFQILIR.N..................................RATDLDARMH.DGTT
ENSDORP00000003161  HIA..ARND......D..TRTAAVLLQ.-..................................NDPNPDVLSK.XXXX
ENSDORP00000002055  HAA..ASSG......M..ISVVKYLLD.-..................................----------.----
ENSDORP00000011259  MLA..SSCG......N..ESIAYFLLQ.-..................................----------.----
ENSDORP00000014237  LES..ARSG......N..EKMMALLTP.-..................................----------.----
ENSDORP00000007536  HEA..AKRG......H..LECIESLIT.-..................................----------.----
ENSDORP00000004979  DYA..LEGTe.....S..SSILLTYLD.E..................................NGVDLTSLRQmKLQR
ENSDORP00000010830  MIS..CYKG......H..KEIAQYLLE.-..................................----------.----
ENSDORP00000008769  HCA..VIAH......N..AVVHELQRN.Q..................................QHHSPEVQEL.LLKN
ENSDORP00000009839  LRA..CEEA......HdvKDMCMTFLE.-..................................KGANPNAFNSsTGRT
ENSDORP00000015161  FWA..CRGG......H..LDILKQLLN.-..................................----------.----
ENSDORP00000001718  HLA..CRKG......H..FEVVKCLLD.-..................................----------.----
ENSDORP00000002537  HYA..VCGQ......S..VSIVRKLLE.-..................................----------.----
ENSDORP00000001580  MLA..ALSG......R..LGMAQQLVE.-..................................KGANPDHLSV.LEKT
ENSDORP00000009438  HEA..AKLG......R..QDMVKLMLL.-..................................----------.----
ENSDORP00000002055  HCA..VIND......N..EGAAEMLID.T..................................----------.----
ENSDORP00000015480  HLA..AQYG......H..YSTTEVLLR.-..................................----------.----
ENSDORP00000012408  HVA..AARG......L..EHHVALYLE.-..................................----------.----
ENSDORP00000002055  HYA..AANC......N..YQCLFAVGS.-..................................----------.----
ENSDORP00000013812  HTA..AHFG......L..SELVAFYVE.-..................................----------.----
ENSDORP00000013528  HTA..VTAD......A..QGVFQILIR.N..................................RSTDLDARMA.DGST
ENSDORP00000000083  HYA..AEK-......D..EACVEVLLE.-..................................----------.----
ENSDORP00000003321  ---..----......-..---------.-..................................----------.----
ENSDORP00000011353  ---..----......-..---------.-..................................----------.----
ENSDORP00000007355  FLA..VEGG......H..EECSKMLLA.-..................................----------.----
ENSDORP00000007546  DLA..ESDA......V..EGLLRAEIA.R..................................RGVDVEAAKR.A---
ENSDORP00000009016  FLA..AQGG......Y..LDVIRLLLS.-..................................SGAKVNQPRQ.XXXX
ENSDORP00000011081  FDA..AGGG......N..PDCISLLLE.-..................................YGGSGNVPNR.AGHL
ENSDORP00000011018  HFA..ATQG......A..TEIVKMMIS.S..................................YSG-------.----
ENSDORP00000003291  AVA..LQQG......H..DQVVSLLLE.-..................................----------.----
ENSDORP00000008149  SWA..CLKG......H..LSVVRSLVD.-..................................----------.----
ENSDORP00000014950  HES..VSRN......D..LEVMEILVG.-..................................----------.----
ENSDORP00000012171  HYA..AASD......T..YRRAEPHTAsS..................................HDAEEDEPLK.ESRR
ENSDORP00000014237  HLA..AGYN......N..LEVAEYLLQ.-..................................----------.----
ENSDORP00000007749  ---..----......-..---------.-..................................----------.----
ENSDORP00000015309  HMA..AEIL......N..KDMIETLIV.-..................................----------.----
ENSDORP00000007119  ITA..CSASgseeq.I..LKCVELLLS.-..................................----------.----
ENSDORP00000011018  HHA..SMGG......Y..TQTMKVILD.-..................................----------.----
ENSDORP00000002435  HWA..---K......N..AEMARMLLK.-..................................----------.----
ENSDORP00000014274  MLA..ALAAveaek.D..MRVVEELFG.-..................................----------.----
ENSDORP00000004702  YLA..CKHG......N..KECIRLLLE.-..................................----------.----
ENSDORP00000013942  MWA..CYKG......R..TDVVELLLS.-..................................----------.----
ENSDORP00000011332  HLA..ARNG......Q..KKCMSKLLE.-..................................YSADVNICNN.EGLT
ENSDORP00000014237  ---..-QMG......N..ENVQQLLQE.-..................................----------.----
ENSDORP00000014578  ---..-KLG......N..PEIARRLLL.-..................................----------.----
ENSDORP00000005457  HLA..AQYG......H..YSTAEVLLR.-..................................----------.----
ENSDORP00000015160  HKA..AEKG......H..VDICSLLLQ.-..................................----------.----
ENSDORP00000011906  HDA..AMAD......C..PSSIQLLCD.-..................................----------.----
ENSDORP00000012571  HRA..AYSG......H..LDIVRELVA.-..................................----------.----
ENSDORP00000012644  ---..--FG......S..PAIALELLK.-..................................----------.----
ENSDORP00000007538  HEA..VKRG......H..TECMEILLA.-..................................----------.----
ENSDORP00000009863  MWA..AAHG......Q..IAVVEFLLQ.-..................................----------.----
ENSDORP00000010305  VHS..ALRG......H..GDVLQYLLT.-..................................----------.----
ENSDORP00000011587  TSA..RQEE......D..MTVIQRLFS.-..................................----------.----
ENSDORP00000000485  ---..----......-..---------.-..................................----------.----
ENSDORP00000014531  HIA..SIKG......D..VPSVEYLLQ.-..................................----------.----
ENSDORP00000012009  MWA..LKNG......D..LDEVKDYVA.-..................................----------.----
ENSDORP00000009257  HLA..ALNN......H..VEVAELLVH.-..................................QXXXXXXXXX.XXXX
ENSDORP00000008161  ---..----......-..---------.-..................................----------.----
ENSDORP00000009839  SRA..IESC......R..LDTVKYLLD.-..................................MGA-------.----
ENSDORP00000001630  DLA..CEFG......R..VGVVQLLLS.-..................................SNMCAALL--.----
ENSDORP00000012903  HLA..ATHG......H..SFTLQIMLR.-..................................----------.----
ENSDORP00000010147  ---..----......-..---------.-..................................----------.----
ENSDORP00000008900  ---..ANAN......D..VETVQQLLD.-..................................----------.----
ENSDORP00000004243  HLA..AQRA......R..LSCIQVLVE.-..................................----------.----
ENSDORP00000008700  HHA..ALNG......H..KDIVLKLLQ.-..................................----------.----
ENSDORP00000008105  ---..----......-..---------.-..................................----------.----
ENSDORP00000002464  ---..----......-..---------.-..................................-------N--.----
ENSDORP00000008204  HRA..ARDG......Y..LELLKEATR.-..................................----------.----
ENSDORP00000001653  MPV..LLIG......-..---------.-..................................----------.----
ENSDORP00000013463  LHA..LASSdgvqvhN..TDNIRLLLE.-..................................GGADVKATTK.DGDT
ENSDORP00000013412  ---..----......-..---------.-..................................----------.----
ENSDORP00000007180  ---..----......-..---------.-..................................----------.----
ENSDORP00000000309  HFA..AFYD......N..ICILIALCR.K..................................EPSL------.----
ENSDORP00000008007  YKA..ALDN......D..VHLVRHCIK.-..................................----------.----
ENSDORP00000010007  DLC..EDET......T..LDVIETCMA.Y..................................QGITQDKINE.MRAA
ENSDORP00000013572  -YC..RENN......I..DHITKAIKS.-..................................----------.----
ENSDORP00000002756  HEA..AKRG......N..LSWLRECLD.-..................................----------.----
ENSDORP00000008159  HQA..ASDG......Y..LDLLKEATK.-..................................----------.----
ENSDORP00000013968  HAA..AEAG......H..VDICHMLVQ.-..................................----------.----
ENSDORP00000010487  SLA..ASGG......Y..VNIIKILLN.-..................................----------.----
ENSDORP00000001351  ---..----......-..---------.-..................................----------.----
ENSDORP00000009580  ---..----......-..---------.-..................................----------.----
ENSDORP00000006712  DIA..EEEA......M..EELLQNEVN.R..................................QGVDIEAARK.EEER
ENSDORP00000014166  ---..----......-..---------.-..................................----------.----
ENSDORP00000013444  HYA..GCYG......Q..EKILLWLLQ.-..................................----------.----
ENSDORP00000004275  ---..----......-..---------.-..................................----------.----
ENSDORP00000001355  ---..----......-..-ECLIQLVR.-..................................----------.----
ENSDORP00000013087  ---..----......-..---------.-..................................----------.----
ENSDORP00000003943  VHA..LDRG......D..RETLATLLD.-..................................----------.----
ENSDORP00000009340  ---..----......-..---------.-..................................----------.----
ENSDORP00000008149  VHA..ALRG......H..LEVVKFLIQ.-..................................CDWTMAG---.----
ENSDORP00000015559  ---..----......-..---------.-..................................----------.----
ENSDORP00000006156  ---..----......-..---------.-..................................----------.----
ENSDORP00000002459  HRA..ARAR......D..LPALAAALA.-..................................----------.----
ENSDORP00000011514  CLA..KRRG......V..NKDVIRLL-.-..................................----------.----
ENSDORP00000007506  EKCdpYREG......Y..ADCATYLAD.-..................................----------.----
ENSDORP00000014195  ---..----......-..---------.-..................................----------.----
ENSDORP00000010305  ---..----......-..---------.-..................................----------.----
ENSDORP00000011086  ---..----......-..---------.-..................................----------.----
ENSDORP00000003906  ---..----......-..---------.-..................................----------.----
ENSDORP00000007061  ---..----......-..-ECVRLLID.-..................................----------.----
ENSDORP00000008791  ---..----......-..---------.-..................................----------.----
ENSDORP00000011286  ---..----......-..---------.-..................................----------.----
ENSDORP00000010487  XXX..XXXX......H..LEMVRFLLE.-..................................----------.----
ENSDORP00000001046  HLS..ILAR......N..EYVFNQLLQ.C..................................KQLDLDLKDH.EGST
ENSDORP00000013206  ---..----......-..---------.-..................................----------.----
ENSDORP00000000302  ---..----......-..---------.-..................................----------.----
ENSDORP00000004396  ---..----......-..---------.-..................................----------.----
ENSDORP00000009263  ALA..ACTN......Q..PEIVQLLME.N..................................EQTDITSQDS.RGNN
ENSDORP00000005406  ---..----......-..---------.-..................................----------.----
ENSDORP00000011018  ---..----......-..---------.-..................................----------.----
ENSDORP00000007862  IEA..AKRN......D..FCKLQELHR.-..................................----------.----
ENSDORP00000005974  ---..---G......S..ENQIKAFLS.-..................................----------.----
ENSDORP00000015386  ---..----......R..VSVLEQLLD.-..................................----------.----
ENSDORP00000004934  ---..----......-..---------.-..................................----------.----
ENSDORP00000007749  ---..----......-..---------.-..................................----------.----
ENSDORP00000011209  ---..----......-..---------.-..................................----------.----
ENSDORP00000014950  LVA..IRHG......C..LRTMRLLLD.-..................................----------.----
ENSDORP00000004508  M--..----......-..---------.-..................................----------.----
ENSDORP00000010830  ---..----......-..---------.DrakgllgttvtfddlmgilcksvleieraikqtqCPADPLQLNK.ALSI
ENSDORP00000008316  ---..----......-..---------.-..................................----------.----
ENSDORP00000011647  ---..----......-..---------.-..................................----------.----
ENSDORP00000001838  ---..----......-..---------.-..................................----------.----
ENSDORP00000007356  ---..----......-..---------.-..................................----------.----
ENSDORP00000007453  HYA..AYFD......V..PDLVRVLLK.-..................................----------.----
ENSDORP00000009265  ---..----......-..---------.-..................................----------.----
ENSDORP00000006222  ---..----......-..---------.-..................................----------.----
ENSDORP00000010465  ---..----......-..---------.-..................................----------.----
ENSDORP00000005903  HAL..VAIAdn....T..RENTKFVTK.M..................................YDLLLLKC--.----
ENSDORP00000006810  ---..----......-..---------.-..................................----------.----
ENSDORP00000000618  ---..----......-..---------.-..................................----------.----
ENSDORP00000005027  ---..----......-..---------.-..................................----------.----
ENSDORP00000014908  ---..----......-..---------.-..................................----------.----
ENSDORP00000013576  QEA..VSTR......D..LELVQLVLR.-..................................----------.----
ENSDORP00000015191  ---..----......-..---------.-..................................----------.----
ENSDORP00000001718  -KH..IASG......N..QKEVEKLLS.Q..................................QDCDRDVIQK.MCHP
ENSDORP00000004586  ---..----......-..---------.-..................................----------.----
ENSDORP00000010461  ---..----......-..---------.-..................................----------.----
ENSDORP00000011519  ---..----......-..---------.-..................................----------.----
ENSDORP00000010487  IEA..AKGG......H..TSVVCYLLD.-..................................----------.----
ENSDORP00000015746  EAS..H---......-..---------.-..................................----------.----
ENSDORP00000008684  ---..---G......E..KQVPPILLD.-..................................-------KQF.SE--
ENSDORP00000001089  ---..----......-..---------.-..................................----------.----
ENSDORP00000007061  ---..----......-..---------.-..................................----------.----
ENSDORP00000011837  SYA..VRKN......E..FPVIVRL--.-..................................----------.----
ENSDORP00000000883  ASC..LKYE......K..FSVFRYFIK.-..................................----------.----
ENSDORP00000008319  HLL..VWNN......D..YRQLEKELR.-..................................----------.----
ENSDORP00000011516  ---..----......-..---------.-..................................----------.----
ENSDORP00000005420  HAA..ARQGpda...Y..TDFFLPLLS.R..................................CPSA------.----
ENSDORP00000014434  ---..----......-..---------.-..................................----------.----
ENSDORP00000012876  ---..----......-..---------.-..................................----------.----
ENSDORP00000002492  ---..----......-..---------.-..................................----------.----
ENSDORP00000009438  PSA..LQYTlk....D..EVMLRMLLN.-..................................----------.----
ENSDORP00000006616  ---..----......-..---------.-..................................----------.----
ENSDORP00000014346  ---..----......-..---------.-..................................----------.----
ENSDORP00000005715  ---..----......-..---------.-..................................----------.----
ENSDORP00000007659  ---..----......-..---------.-..................................----------.----
ENSDORP00000000137  TVA..ADRS......T..RNEFRRFME.-..................................----------.----
ENSDORP00000011634  HIA..VSLPgee...G..---------.-..................................----------.----
ENSDORP00000007355  ---..----......-..---------.-..................................----------.----
ENSDORP00000001096  ---..----......-..---------.-..................................----------.----
ENSDORP00000007335  DIA..IMTN......N..VPIAKILLK.-..................................----------.----
ENSDORP00000001630  ---..----......-..---------.-..................................----------.----
ENSDORP00000010887  ---..----......-..---------.-..................................----------.----
ENSDORP00000013121  ---..----......-..---------.-..................................----------.----
ENSDORP00000007683  DLA..WSCG......F..PECAKFLT-.-..................................----------.----
ENSDORP00000002834  HQA..AAQS......Y..ATLIQTLIK.W..................................RTKHADSID-.----
ENSDORP00000014071  ---..----......-..---------.-..................................----------.----
ENSDORP00000000198  ---..----......-..---------.-..................................----------.----
ENSDORP00000006712  ---..----......-..---------.-..................................----------.----
ENSDORP00000009930  ---..----......-..---------.-..................................----------.----
ENSDORP00000010221  ---..----......-..---------.-..................................----------.----


                        180                                                                         
                          |                                                                         
d1s70b_               IMLRD.........................................................................
ENSDORP00000001438  PDPSP.........................................................................
ENSDORP00000003161  PLHLV.........................................................................
ENSDORP00000013687  TLYIL.........................................................................
ENSDORP00000003291  PLHVAahydnqkvalllldqgasphaaakxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhvd
ENSDORP00000015829  PDPSP.........................................................................
ENSDORP00000006395  PLHCA.........................................................................
ENSDORP00000006395  PLHLA.........................................................................
ENSDORP00000007897  PLHLA.........................................................................
ENSDORP00000012171  PLHVA.........................................................................
ENSDORP00000015191  LLHWA.........................................................................
ENSDORP00000005511  ALIHA.........................................................................
ENSDORP00000001089  ALTLA.........................................................................
ENSDORP00000001089  PLTLA.........................................................................
ENSDORP00000012094  -----.........................................................................
ENSDORP00000003161  PLHIA.........................................................................
ENSDORP00000008111  -----.........................................................................
ENSDORP00000010887  PLHLA.........................................................................
ENSDORP00000015756  -----.........................................................................
ENSDORP00000003012  -----.........................................................................
ENSDORP00000003803  -----.........................................................................
ENSDORP00000012171  PLHAA.........................................................................
ENSDORP00000010887  -----.........................................................................
ENSDORP00000010328  -----.........................................................................
ENSDORP00000010714  -----.........................................................................
ENSDORP00000005245  -----.........................................................................
ENSDORP00000012790  -----.........................................................................
ENSDORP00000001687  -----.........................................................................
ENSDORP00000000524  PFMDA.........................................................................
ENSDORP00000002516  -----.........................................................................
ENSDORP00000007933  -----.........................................................................
ENSDORP00000001938  QMLQD.........................................................................
ENSDORP00000002146  PELHM.........................................................................
ENSDORP00000006986  -----.........................................................................
ENSDORP00000013687  -----.........................................................................
ENSDORP00000011695  -----.........................................................................
ENSDORP00000003709  PLLAA.........................................................................
ENSDORP00000012607  -----.........................................................................
ENSDORP00000012790  -----.........................................................................
ENSDORP00000001046  FLHVA.........................................................................
ENSDORP00000012574  ALHAA.........................................................................
ENSDORP00000012710  -----.........................................................................
ENSDORP00000008802  -----.........................................................................
ENSDORP00000012790  PLHCA.........................................................................
ENSDORP00000000031  -----.........................................................................
ENSDORP00000013942  -----.........................................................................
ENSDORP00000000883  -----.........................................................................
ENSDORP00000012440  ALHWA.........................................................................
ENSDORP00000010065  -----.........................................................................
ENSDORP00000015111  -----.........................................................................
ENSDORP00000014007  -----.........................................................................
ENSDORP00000008737  -----.........................................................................
ENSDORP00000010826  PLILA.........................................................................
ENSDORP00000003161  XXXXX.........................................................................
ENSDORP00000002055  -----.........................................................................
ENSDORP00000011259  -----.........................................................................
ENSDORP00000014237  -----.........................................................................
ENSDORP00000007536  -----.........................................................................
ENSDORP00000004979  PLNML.........................................................................
ENSDORP00000010830  -----.........................................................................
ENSDORP00000008769  KSLVD.........................................................................
ENSDORP00000009839  ALMEA.........................................................................
ENSDORP00000015161  -----.........................................................................
ENSDORP00000001718  -----.........................................................................
ENSDORP00000002537  -----.........................................................................
ENSDORP00000001580  AFEIA.........................................................................
ENSDORP00000009438  -----.........................................................................
ENSDORP00000002055  -----.........................................................................
ENSDORP00000015480  -----.........................................................................
ENSDORP00000012408  -----.........................................................................
ENSDORP00000002055  -----.........................................................................
ENSDORP00000013812  -----.........................................................................
ENSDORP00000013528  SLILA.........................................................................
ENSDORP00000000083  -----.........................................................................
ENSDORP00000003321  -----.........................................................................
ENSDORP00000011353  -----.........................................................................
ENSDORP00000007355  -----.........................................................................
ENSDORP00000007546  -----.........................................................................
ENSDORP00000009016  XXXXX.........................................................................
ENSDORP00000011081  PIHRA.........................................................................
ENSDORP00000011018  -----.........................................................................
ENSDORP00000003291  -----.........................................................................
ENSDORP00000008149  -----.........................................................................
ENSDORP00000014950  -----.........................................................................
ENSDORP00000012171  KEAFF.........................................................................
ENSDORP00000014237  -----.........................................................................
ENSDORP00000007749  -----.........................................................................
ENSDORP00000015309  -----.........................................................................
ENSDORP00000007119  -----.........................................................................
ENSDORP00000011018  -----.........................................................................
ENSDORP00000002435  -----.........................................................................
ENSDORP00000014274  -----.........................................................................
ENSDORP00000004702  -----.........................................................................
ENSDORP00000013942  -----.........................................................................
ENSDORP00000011332  AXXXX.........................................................................
ENSDORP00000014237  -----.........................................................................
ENSDORP00000014578  -----.........................................................................
ENSDORP00000005457  -----.........................................................................
ENSDORP00000015160  -----.........................................................................
ENSDORP00000011906  -----.........................................................................
ENSDORP00000012571  -----.........................................................................
ENSDORP00000012644  -----.........................................................................
ENSDORP00000007538  -----.........................................................................
ENSDORP00000009863  -----.........................................................................
ENSDORP00000010305  -----.........................................................................
ENSDORP00000011587  -----.........................................................................
ENSDORP00000000485  -----.........................................................................
ENSDORP00000014531  -----.........................................................................
ENSDORP00000012009  -----.........................................................................
ENSDORP00000009257  XXXXX.........................................................................
ENSDORP00000008161  -----.........................................................................
ENSDORP00000009839  -----.........................................................................
ENSDORP00000001630  -----.........................................................................
ENSDORP00000012903  -----.........................................................................
ENSDORP00000010147  -----.........................................................................
ENSDORP00000008900  -----.........................................................................
ENSDORP00000004243  -----.........................................................................
ENSDORP00000008700  -----.........................................................................
ENSDORP00000008105  -----.........................................................................
ENSDORP00000002464  -----.........................................................................
ENSDORP00000008204  -----.........................................................................
ENSDORP00000001653  -----.........................................................................
ENSDORP00000013463  VFTCI.........................................................................
ENSDORP00000013412  -----.........................................................................
ENSDORP00000007180  -----.........................................................................
ENSDORP00000000309  -----.........................................................................
ENSDORP00000008007  -----.........................................................................
ENSDORP00000010007  PEQQM.........................................................................
ENSDORP00000013572  -----.........................................................................
ENSDORP00000002756  -----.........................................................................
ENSDORP00000008159  -----.........................................................................
ENSDORP00000013968  -----.........................................................................
ENSDORP00000010487  -----.........................................................................
ENSDORP00000001351  -----.........................................................................
ENSDORP00000009580  -----.........................................................................
ENSDORP00000006712  IMLRD.........................................................................
ENSDORP00000014166  -----.........................................................................
ENSDORP00000013444  -----.........................................................................
ENSDORP00000004275  -----.........................................................................
ENSDORP00000001355  -----.........................................................................
ENSDORP00000013087  -----.........................................................................
ENSDORP00000003943  -----.........................................................................
ENSDORP00000009340  PLMLA.........................................................................
ENSDORP00000008149  -----.........................................................................
ENSDORP00000015559  -----.........................................................................
ENSDORP00000006156  -----.........................................................................
ENSDORP00000002459  -----.........................................................................
ENSDORP00000011514  -----.........................................................................
ENSDORP00000007506  -----.........................................................................
ENSDORP00000014195  -----.........................................................................
ENSDORP00000010305  -----.........................................................................
ENSDORP00000011086  -----.........................................................................
ENSDORP00000003906  -----.........................................................................
ENSDORP00000007061  -----.........................................................................
ENSDORP00000008791  -----.........................................................................
ENSDORP00000011286  -----.........................................................................
ENSDORP00000010487  -----.........................................................................
ENSDORP00000001046  ALWLA.........................................................................
ENSDORP00000013206  -----.........................................................................
ENSDORP00000000302  -----.........................................................................
ENSDORP00000004396  -----.........................................................................
ENSDORP00000009263  ILHAL.........................................................................
ENSDORP00000005406  -----.........................................................................
ENSDORP00000011018  -----.........................................................................
ENSDORP00000007862  -----.........................................................................
ENSDORP00000005974  -----.........................................................................
ENSDORP00000015386  -----.........................................................................
ENSDORP00000004934  -----.........................................................................
ENSDORP00000007749  -----.........................................................................
ENSDORP00000011209  -----.........................................................................
ENSDORP00000014950  -----.........................................................................
ENSDORP00000004508  -----.........................................................................
ENSDORP00000010830  ILHLI.........................................................................
ENSDORP00000008316  -----.........................................................................
ENSDORP00000011647  -----.........................................................................
ENSDORP00000001838  -----.........................................................................
ENSDORP00000007356  -----.........................................................................
ENSDORP00000007453  -----.........................................................................
ENSDORP00000009265  -----.........................................................................
ENSDORP00000006222  -----.........................................................................
ENSDORP00000010465  -----.........................................................................
ENSDORP00000005903  -----.........................................................................
ENSDORP00000006810  -----.........................................................................
ENSDORP00000000618  -----.........................................................................
ENSDORP00000005027  -----.........................................................................
ENSDORP00000014908  -----.........................................................................
ENSDORP00000013576  -----.........................................................................
ENSDORP00000015191  -----.........................................................................
ENSDORP00000001718  LCFCD.........................................................................
ENSDORP00000004586  -----.........................................................................
ENSDORP00000010461  -----.........................................................................
ENSDORP00000011519  -----.........................................................................
ENSDORP00000010487  -----.........................................................................
ENSDORP00000015746  -----.........................................................................
ENSDORP00000008684  -----.........................................................................
ENSDORP00000001089  -----.........................................................................
ENSDORP00000007061  -----.........................................................................
ENSDORP00000011837  -----.........................................................................
ENSDORP00000000883  -----.........................................................................
ENSDORP00000008319  -----.........................................................................
ENSDORP00000011516  -----.........................................................................
ENSDORP00000005420  -----.........................................................................
ENSDORP00000014434  -----.........................................................................
ENSDORP00000012876  -----.........................................................................
ENSDORP00000002492  -----.........................................................................
ENSDORP00000009438  -----.........................................................................
ENSDORP00000006616  -----.........................................................................
ENSDORP00000014346  -----.........................................................................
ENSDORP00000005715  -----.........................................................................
ENSDORP00000007659  -----.........................................................................
ENSDORP00000000137  -----.........................................................................
ENSDORP00000011634  -----.........................................................................
ENSDORP00000007355  -----.........................................................................
ENSDORP00000001096  -----.........................................................................
ENSDORP00000007335  -----.........................................................................
ENSDORP00000001630  -----.........................................................................
ENSDORP00000010887  -----.........................................................................
ENSDORP00000013121  -----.........................................................................
ENSDORP00000007683  -----.........................................................................
ENSDORP00000002834  -----.........................................................................
ENSDORP00000014071  -----.........................................................................
ENSDORP00000000198  -----.........................................................................
ENSDORP00000006712  -----.........................................................................
ENSDORP00000009930  -----.........................................................................
ENSDORP00000010221  -----.........................................................................


                                                                                                  19
                                                                                                    
d1s70b_               .........................A.........................................RQWLNSGH...
ENSDORP00000001438  .........................Apepeypepsrekee...........................EQREEDWK...
ENSDORP00000003161  .........................Aqeghvpv..................................ADVLIKHG...
ENSDORP00000013687  .........................Alenqltm..................................AEYFLENG...
ENSDORP00000003291  mvslllsrnanvlsnkngltplhlaAqedrvnv..................................AEVLVNQG...
ENSDORP00000015829  .........................Apepeypepsrekee...........................EQREEDWK...
ENSDORP00000006395  .........................Arsghdqv..................................VELLLERG...
ENSDORP00000006395  .........................Sqeghadm..................................VTLLLDKG...
ENSDORP00000007897  .........................Aqrghyrv..................................ARILTDLC...
ENSDORP00000012171  .........................Avstngalc.................................LELLVNNG...
ENSDORP00000015191  .........................Alggnadv..................................CQILIENK...
ENSDORP00000005511  .........................Lldggeqaeav...............................AGLLLDHG...
ENSDORP00000001089  .........................Cfqgraev..................................VSLLLDRK...
ENSDORP00000001089  .........................Acgghvel..................................AALLIERG...
ENSDORP00000012094  .........................-.........................................------LH...
ENSDORP00000003161  .........................Ckknhirv..................................MELLLKTG...
ENSDORP00000008111  .........................-.........................................------HG...
ENSDORP00000010887  .........................Agynrvri..................................VQLLLQHG...
ENSDORP00000015756  .........................-.........................................------HG...
ENSDORP00000003012  .........................-.........................................------HG...
ENSDORP00000003803  .........................-.........................................------EG...
ENSDORP00000012171  .........................Afadnvsg..................................LRMLLQHQ...
ENSDORP00000010887  .........................-.........................................-------P...
ENSDORP00000010328  .........................-.........................................------SG...
ENSDORP00000010714  .........................-.........................................------RG...
ENSDORP00000005245  .........................-.........................................------EG...
ENSDORP00000012790  .........................-.........................................------LL...
ENSDORP00000001687  .........................-.........................................------HE...
ENSDORP00000000524  .........................Iqcghveva.................................RLLLEKHQ...
ENSDORP00000002516  .........................-.........................................------WR...
ENSDORP00000007933  .........................-.........................................------HN...
ENSDORP00000001938  .........................A.........................................RQWLNSGK...
ENSDORP00000002146  .........................Ldd.......................................LQSLLHAG...
ENSDORP00000006986  .........................-.........................................------AG...
ENSDORP00000013687  .........................-.........................................------AG...
ENSDORP00000011695  .........................-.........................................------KG...
ENSDORP00000003709  .........................Cdargqspaeaeasasrcfql.....................CSLLLSAG...
ENSDORP00000012607  .........................-.........................................------NG...
ENSDORP00000012790  .........................-.........................................------SG...
ENSDORP00000001046  .........................Vqnsdies..................................VLFLISVQ...
ENSDORP00000012574  .........................Aarghyslv.................................VWLATFTD...
ENSDORP00000012710  .........................-.........................................------RQ...
ENSDORP00000008802  .........................-.........................................------XX...
ENSDORP00000012790  .........................Iindhen...................................CASLLLGA...
ENSDORP00000000031  .........................-.........................................------KG...
ENSDORP00000013942  .........................-.........................................------CN...
ENSDORP00000000883  .........................-.........................................------KG...
ENSDORP00000012440  .........................Vqsgnril..................................CSIILSHH...
ENSDORP00000010065  .........................-.........................................------NK...
ENSDORP00000015111  .........................-.........................................------AD...
ENSDORP00000014007  .........................-.........................................------GG...
ENSDORP00000008737  .........................-.........................................------WG...
ENSDORP00000010826  .........................Arlavegm..................................LEDLINSH...
ENSDORP00000003161  .........................Xxxxxxxx..................................XXXXXXXX...
ENSDORP00000002055  .........................-.........................................------LG...
ENSDORP00000011259  .........................-.........................................------QG...
ENSDORP00000014237  .........................-.........................................--------...
ENSDORP00000007536  .........................-.........................................------YG...
ENSDORP00000004979  .........................Td........................................VKHFLSSG...
ENSDORP00000010830  .........................-.........................................------KG...
ENSDORP00000008769  .........................T.........................................IKCLIQMG...
ENSDORP00000009839  .........................Sregvlel..................................VREILERG...
ENSDORP00000015161  .........................-.........................................------QG...
ENSDORP00000001718  .........................-.........................................------SN...
ENSDORP00000002537  .........................-.........................................------HK...
ENSDORP00000001580  .........................LdckhrdladfldpvttvrpktdeekrrpdifhalkmgnfqlVKEIADED...
ENSDORP00000009438  .........................-.........................................------SG...
ENSDORP00000002055  .........................-.........................................------LG...
ENSDORP00000015480  .........................-.........................................------AG...
ENSDORP00000012408  .........................-.........................................------HG...
ENSDORP00000002055  .........................-.........................................--------...
ENSDORP00000013812  .........................-.........................................------HG...
ENSDORP00000013528  .........................Arlavegm..................................VEELIACH...
ENSDORP00000000083  .........................-.........................................------YG...
ENSDORP00000003321  .........................-.........................................--------...
ENSDORP00000011353  .........................-.........................................--------...
ENSDORP00000007355  .........................-.........................................------AG...
ENSDORP00000007546  .........................Eeelllhd..................................TRCWLNGG...
ENSDORP00000009016  .........................Xxxxxxxx..................................XXXXXXXX...
ENSDORP00000011081  .........................Ayeg......................................HYLALKHLipv
ENSDORP00000011018  .........................-.........................................------NN...
ENSDORP00000003291  .........................-.........................................--------...
ENSDORP00000008149  .........................-.........................................------NG...
ENSDORP00000014950  .........................-.........................................------GG...
ENSDORP00000012171  .........................C.........................................LEFLLDNG...
ENSDORP00000014237  .........................-.........................................------HG...
ENSDORP00000007749  .........................-.........................................------XX...
ENSDORP00000015309  .........................-.........................................------CG...
ENSDORP00000007119  .........................-.........................................------RN...
ENSDORP00000011018  .........................-.........................................------TN...
ENSDORP00000002435  .........................-.........................................------RG...
ENSDORP00000014274  .........................-.........................................-------C...
ENSDORP00000004702  .........................-.........................................------AG...
ENSDORP00000013942  .........................-.........................................------HG...
ENSDORP00000011332  .........................Xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxt.VQCLLDSG...
ENSDORP00000014237  .........................-.........................................--------...
ENSDORP00000014578  .........................-.........................................------KG...
ENSDORP00000005457  .........................-.........................................------AG...
ENSDORP00000015160  .........................-.........................................--------...
ENSDORP00000011906  .........................-.........................................------HG...
ENSDORP00000012571  .........................-.........................................------QG...
ENSDORP00000012644  .........................-.........................................------QG...
ENSDORP00000007538  .........................-.........................................------NN...
ENSDORP00000009863  .........................-.........................................------NG...
ENSDORP00000010305  .........................-.........................................CEWLASPS...
ENSDORP00000011587  .........................-.........................................-------M...
ENSDORP00000000485  .........................-.........................................--------...
ENSDORP00000014531  .........................-.........................................------NG...
ENSDORP00000012009  .........................-.........................................------KG...
ENSDORP00000009257  .........................Xxxxxxxxx.................................XXLLVRAG...
ENSDORP00000008161  .........................-.........................................------FH...
ENSDORP00000009839  .........................-.........................................--------...
ENSDORP00000001630  .........................-.........................................------EP...
ENSDORP00000012903  .........................-.........................................------SG...
ENSDORP00000010147  .........................-.........................................--------...
ENSDORP00000008900  .........................-.........................................------DG...
ENSDORP00000004243  .........................-.........................................-----EYK...
ENSDORP00000008700  .........................-.........................................------YE...
ENSDORP00000008105  .........................-.........................................------FH...
ENSDORP00000002464  .........................-.........................................------HH...
ENSDORP00000008204  .........................-.........................................--------...
ENSDORP00000001653  .........................-.........................................--------...
ENSDORP00000013463  .........................Ifllgetvggdkdevrlinrfclqv.................TQLLLAHG...
ENSDORP00000013412  .........................-.........................................--------...
ENSDORP00000007180  .........................-.........................................--------...
ENSDORP00000000309  .........................-.........................................--------...
ENSDORP00000008007  .........................-.........................................------NG...
ENSDORP00000010007  .........................Isd.......................................IHCMIAAG...
ENSDORP00000013572  .........................-.........................................------KN...
ENSDORP00000002756  .........................-.........................................------NR...
ENSDORP00000008159  .........................-.........................................--------...
ENSDORP00000013968  .........................-.........................................--------...
ENSDORP00000010487  .........................-.........................................------AG...
ENSDORP00000001351  .........................-.........................................--------...
ENSDORP00000009580  .........................-.........................................--------...
ENSDORP00000006712  .........................A.........................................RQWLNSGH...
ENSDORP00000014166  .........................-.........................................-----YAG...
ENSDORP00000013444  .........................-.........................................--------...
ENSDORP00000004275  .........................-.........................................--------...
ENSDORP00000001355  .........................-.........................................------AG...
ENSDORP00000013087  .........................-.........................................-------V...
ENSDORP00000003943  .........................-.........................................--------...
ENSDORP00000009340  .........................Rlmed.....................................LEELIAAG...
ENSDORP00000008149  .........................-.........................................------QQ...
ENSDORP00000015559  .........................-.........................................--------...
ENSDORP00000006156  .........................-.........................................------EG...
ENSDORP00000002459  .........................-.........................................------HG...
ENSDORP00000011514  .........................-.........................................--------...
ENSDORP00000007506  .........................-.........................................--------...
ENSDORP00000014195  .........................-.........................................--------...
ENSDORP00000010305  .........................-.........................................--------...
ENSDORP00000011086  .........................-.........................................------RK...
ENSDORP00000003906  .........................-.........................................--------...
ENSDORP00000007061  .........................-.........................................------VG...
ENSDORP00000008791  .........................-.........................................--------...
ENSDORP00000011286  .........................-.........................................--------...
ENSDORP00000010487  .........................-.........................................------AG...
ENSDORP00000001046  .........................Vqyitvssdqsvnpfed.........................V-------...
ENSDORP00000013206  .........................-.........................................--------...
ENSDORP00000000302  .........................-.........................................----LAHG...
ENSDORP00000004396  .........................-.........................................--------...
ENSDORP00000009263  .........................Vtvaedfktqndfvkrmyd.......................MILLRSGN...
ENSDORP00000005406  .........................-.........................................--------...
ENSDORP00000011018  .........................-.........................................--------...
ENSDORP00000007862  .........................-.........................................------AG...
ENSDORP00000005974  .........................-.........................................-----SHC...
ENSDORP00000015386  .........................-.........................................------EG...
ENSDORP00000004934  .........................-.........................................---WV---...
ENSDORP00000007749  .........................-.........................................--------...
ENSDORP00000011209  .........................-.........................................--------...
ENSDORP00000014950  .........................-.........................................------HG...
ENSDORP00000004508  .........................-.........................................--------...
ENSDORP00000010830  .........................Cllekvpctleqdhf...........................KKQTIYRF...
ENSDORP00000008316  .........................-.........................................--------...
ENSDORP00000011647  .........................-.........................................--------...
ENSDORP00000001838  .........................-.........................................--------...
ENSDORP00000007356  .........................-.........................................------FQ...
ENSDORP00000007453  .........................-.........................................-------G...
ENSDORP00000009265  .........................-.........................................--------...
ENSDORP00000006222  .........................-.........................................--------...
ENSDORP00000010465  .........................-.........................................--------...
ENSDORP00000005903  .........................-.........................................ARLF--PD...
ENSDORP00000006810  .........................-.........................................--------...
ENSDORP00000000618  .........................-.........................................--------...
ENSDORP00000005027  .........................-.........................................--------...
ENSDORP00000014908  .........................-.........................................--------...
ENSDORP00000013576  .........................-.........................................--------...
ENSDORP00000015191  .........................-.........................................--------...
ENSDORP00000001718  .........................D.........................................CEKLVSGR...
ENSDORP00000004586  .........................-.........................................--------...
ENSDORP00000010461  .........................-.........................................--------...
ENSDORP00000011519  .........................-.........................................-------D...
ENSDORP00000010487  .........................-.........................................--------...
ENSDORP00000015746  .........................-.........................................--------...
ENSDORP00000008684  .........................-.........................................--------...
ENSDORP00000001089  .........................-.........................................--------...
ENSDORP00000007061  .........................-.........................................--------...
ENSDORP00000011837  .........................-.........................................--------...
ENSDORP00000000883  .........................-.........................................------KG...
ENSDORP00000008319  .........................-.........................................-------D...
ENSDORP00000011516  .........................-.........................................--------...
ENSDORP00000005420  .........................-.........................................--------...
ENSDORP00000014434  .........................-.........................................--------...
ENSDORP00000012876  .........................-.........................................--------...
ENSDORP00000002492  .........................-.........................................--------...
ENSDORP00000009438  .........................-.........................................--------...
ENSDORP00000006616  .........................-.........................................--------...
ENSDORP00000014346  .........................-.........................................--------...
ENSDORP00000005715  .........................-.........................................--------...
ENSDORP00000007659  .........................-.........................................--------...
ENSDORP00000000137  .........................-.........................................--------...
ENSDORP00000011634  .........................-.........................................--------...
ENSDORP00000007355  .........................-.........................................--------...
ENSDORP00000001096  .........................-.........................................--------...
ENSDORP00000007335  .........................-.........................................--------...
ENSDORP00000001630  .........................-.........................................--------...
ENSDORP00000010887  .........................-.........................................--------...
ENSDORP00000013121  .........................-.........................................--------...
ENSDORP00000007683  .........................-.........................................--------...
ENSDORP00000002834  .........................-.........................................------LK...
ENSDORP00000014071  .........................-.........................................--------...
ENSDORP00000000198  .........................-.........................................--------...
ENSDORP00000006712  .........................-.........................................--------...
ENSDORP00000009930  .........................-.........................................--------...
ENSDORP00000010221  .........................-.........................................--------...


                      0                 200                                                       21
                      |                   |                                                         
d1s70b_               IN......DVRH..A..KSGG..T...................................ALHVAAAK...........
ENSDORP00000001438  LQ......LETE..N..YEGH..T...................................PLHVAIIH...........
ENSDORP00000003161  VS......VDAT..T..RMGY..T...................................PLHVASHY...........
ENSDORP00000013687  AN......VEAS..D..AEGR..T...................................ALHVSCWQ...........
ENSDORP00000003291  AH......VDAQ..T..KMGY..T...................................PLHVGCHY...........
ENSDORP00000015829  LQ......LETE..N..YEGH..T...................................PLHVAIIH...........
ENSDORP00000006395  AP......LLAR..T..KNGL..S...................................PLHMAAQG...........
ENSDORP00000006395  AN......IHMS..T..KSGL..T...................................SLHLAAQE...........
ENSDORP00000007897  SD......VNIC..S..LLAQ..T...................................PLHVAAET...........
ENSDORP00000012171  AD......VNYQ..V..LEGK..S...................................PLHMAAIH...........
ENSDORP00000015191  IN......PNVQ..D..YAGR..T...................................PLQCAAYG...........
ENSDORP00000005511  AD......VRVR..G..EQGK..T...................................PLILAVEK...........
ENSDORP00000001089  AN......VEHR..A..KTGL..T...................................PLMEAASG...........
ENSDORP00000001089  AN......LEEV..N..DEGY..T...................................PLMEAARE...........
ENSDORP00000012094  SI......LQAT..N..YNGH..T...................................CLHLASIH...........
ENSDORP00000003161  AS......IDAV..T..ESGL..T...................................PLHVASFM...........
ENSDORP00000008111  AD......IDAV..Di.KSGR..S...................................PLIHAVEN...........
ENSDORP00000010887  AD......VHAK..D..KGGL..V...................................PLHNACSY...........
ENSDORP00000015756  AD......LNAS..D..KDGH..I...................................ALHLAVRR...........
ENSDORP00000003012  AD......LNAS..D..KDGH..I...................................ALHLAVRR...........
ENSDORP00000003803  EA......KDPC..D..PNYT..T...................................PLHLAAKN...........
ENSDORP00000012171  AE......VNAT..D..HTGR..T...................................ALMTAAEN...........
ENSDORP00000010887  QN......VNCR..D..LEGRhsT...................................PLHFAAGY...........
ENSDORP00000010328  AD......IDAQe.G..TSGK..T...................................ALHLAVET...........
ENSDORP00000010714  AD......VTLT..D..NEEN..I...................................CLHWASFT...........
ENSDORP00000005245  CE......VDVM..Dt.GSGW..T...................................PLMRVSAVs..........
ENSDORP00000012790  SS......VNVS..D..RGGR..T...................................ALHHAALN...........
ENSDORP00000001687  AF......LDVL..D..NDGR..T...................................PLMIASLG...........
ENSDORP00000000524  AC......SSAE..D..SLGA..Q...................................ALHRAAVT...........
ENSDORP00000002516  AA......I-VV..N..GHGM..T...................................PLKVAAES...........
ENSDORP00000007933  AN......IDIQ..N..GF--..-...................................LLRYAVIK...........
ENSDORP00000001938  IE......DVKQ..A..RSGA..T...................................ALHVAAAK...........
ENSDORP00000002146  AD......LNEP..L..DNGA..T...................................LLHIAAAN...........
ENSDORP00000006986  AD......VNAPe.Q..KAGR..T...................................ALHLAVEQ...........
ENSDORP00000013687  VK......VDCA..D..ADSR..T...................................ALRAAAWG...........
ENSDORP00000011695  QD......VDMM..D..QNGM..T...................................PLMWAAYR...........
ENSDORP00000003709  AD......ADAA..D..QDKL..R...................................PLHLACRR...........
ENSDORP00000012607  AE......VEAAe.R..QGGR..T...................................ALHLATEM...........
ENSDORP00000012790  AD......FRKK..D..KCGR..T...................................PLHYAAAN...........
ENSDORP00000001046  AN......VNSRvqD..ASKL..T...................................PLHLAVQA...........
ENSDORP00000012574  IS......LTAR..D..NEGA..T...................................ALHFAARG...........
ENSDORP00000012710  AD......PNKQ..E..AEGK..T...................................PLHVAAYF...........
ENSDORP00000008802  XX......XXXX..X..XDGN..I...................................PLLLAVQN...........
ENSDORP00000012790  IDsni...VSCR..D..DKGR..T...................................PLHAAAFG...........
ENSDORP00000000031  QS......VNMT..D..VNGQ..T...................................PLMLSAYK...........
ENSDORP00000013942  PD......TEIC..T..KDGE..T...................................PLIKATKM...........
ENSDORP00000000883  AN......KECQ..D..DFGI..T...................................ALFVAAQY...........
ENSDORP00000012440  RGpsi...INYD..D..ESGK..T...................................CVHIAAAA...........
ENSDORP00000010065  AD......VNAQ..D..NEDH..V...................................PLHFCAHF...........
ENSDORP00000015111  VS......LSEQ..D..KDGA..T...................................AMHFAASR...........
ENSDORP00000014007  SR......ADLK..N..NAGD..T...................................CLHVAARY...........
ENSDORP00000008737  ID......VDQE..I..PHLG..T...................................PLYVACMA...........
ENSDORP00000010826  AD......VNAV..D..DLGK..S...................................ALHWAAAV...........
ENSDORP00000003161  XX......XXXX..X..XNGI..T...................................PLHIASRR...........
ENSDORP00000002055  VD......MNEP..N..AYGN..T...................................PLHVACYN...........
ENSDORP00000011259  AE......LEMK..D..IQGW..T...................................ALFHCTSA...........
ENSDORP00000014237  LN......VNCH..A..SDGX..XxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxdlvPLHNACSY...........
ENSDORP00000007536  GD......IDHN..I..NHLG..T...................................PLYQACKH...........
ENSDORP00000004979  GN......VNEK..N..DEGV..T...................................LLHMACTS...........
ENSDORP00000010830  AD......VNRK..S..VKGN..T...................................ALHDCAES...........
ENSDORP00000008769  AS......VEAK..Dr.KSGR..T...................................ALHLAAEE...........
ENSDORP00000009839  GK......VNAF..D..NERL..H...................................AAHFAAKG...........
ENSDORP00000015161  AQ......VNAQ..D..KIWS..T...................................PLHVAVRT...........
ENSDORP00000001718  VK......PDKK..D..LSGN..T...................................PLICACAE...........
ENSDORP00000002537  AN......LEAK..N..KDGY..T...................................PLLLAVVK...........
ENSDORP00000001580  PNh.....VNLV..N..GDGA..T...................................PLMLAAVT...........
ENSDORP00000009438  AQ......PDPQ..S..SYGF..T...................................PLALAAQG...........
ENSDORP00000002055  ASi.....VNAT..D..SKGR..T...................................SLHAAAFT...........
ENSDORP00000015480  VS......RDAR..T..KVDR..T...................................PLHMAASE...........
ENSDORP00000012408  AN......VALR..T..SQGE..T...................................ALNAACAGaegpgpgr...
ENSDORP00000002055  --......----..-..----..-...................................--------...........
ENSDORP00000013812  AV......VDSV..N..AHME..T...................................PLAVAAYWslrfkeqeysr
ENSDORP00000013528  AD......VNAV..D..ELGK..S...................................ALHWAAAV...........
ENSDORP00000000083  AN......PNAL..D..GNRD..T...................................PLHWAAFK...........
ENSDORP00000003321  --......----..-..----..-...................................ALHLAVRV...........
ENSDORP00000011353  --......---V..N..CYGR..R...................................PIQV-MMM...........
ENSDORP00000007355  SD......VNVP..N..KLHV..S...................................VLQIAIRN...........
ENSDORP00000007546  AM......PEARh.P..RTGA..S...................................ALHVAAAK...........
ENSDORP00000009016  XX......XXXX..X..XDGT..T...................................ALLKAANK...........
ENSDORP00000011081  TS......KNAI..Q..KSGL..S...................................PVHSAADG...........
ENSDORP00000011018  DI......VNAV..D..GNHE..T...................................LLHRASLF...........
ENSDORP00000003291  --......NDTK..G..KVRL..P...................................ALHIAARK...........
ENSDORP00000008149  AA......TDHA..D..KNGR..T...................................PLDLAAFY...........
ENSDORP00000014950  AK......VEAK..N..AYGI..T...................................PLFVAAQS...........
ENSDORP00000012171  AD......PSLR..D..RQGY..T...................................AVHYAAAY...........
ENSDORP00000014237  AD......VNAQ..D..KGGL..I...................................PLHNAASY...........
ENSDORP00000007749  XX......XXXX..X..XRGA..S...................................PLHLATSL...........
ENSDORP00000015309  AN......VNCAv.P..STGN..T...................................ALKLAVRT...........
ENSDORP00000007119  AD......PNVA..C..RRRM..T...................................PIMYASRY...........
ENSDORP00000011018  LK......CTDRl.D..EEGN..T...................................ALHFAARE...........
ENSDORP00000002435  CE......VEST..S..ASGN..T...................................ALHVAVMR...........
ENSDORP00000014274  GD......VNAKa.S..QAGQ..T...................................ALMLAVSH...........
ENSDORP00000004702  SD......RSVE..T..RDGW..T...................................PVHAAVDT...........
ENSDORP00000013942  AN......PSVT..G..LYSV..Y...................................PIIWAAGR...........
ENSDORP00000011332  AD......INRP..N..VSGA..T...................................PLYFACSH...........
ENSDORP00000014237  -G......IPLG..N..SEAD..R...................................QLLEAAKA...........
ENSDORP00000014578  AN......PNLK..D..GTGF..A...................................VIHDAARA...........
ENSDORP00000005457  VS......RDAR..T..KVDR..T...................................PLHMAAAD...........
ENSDORP00000015160  --......----..-..----..-...................................--------...........
ENSDORP00000011906  AS......VNAK..D..IDGR..T...................................PLVLDTLM...........
ENSDORP00000012571  AD......IHAI..T..VDGW..T...................................ALHSACKW...........
ENSDORP00000012644  AS......PNVQ..D..ASGT..S...................................PVHDAART...........
ENSDORP00000007538  VN......IDQE..L..PHIG..T...................................PLYVACTY...........
ENSDORP00000009863  AD......PQLL..G..KGRE..S...................................ALSLACSK...........
ENSDORP00000010305  QP......GTLRk.S..QALQ..Q...................................ALTAAASM...........
ENSDORP00000011587  GD......VNAKa.S..QTGQ..T...................................ALMLAITH...........
ENSDORP00000000485  --......----..-..----..-...................................--------...........
ENSDORP00000014531  ND......PNVK..D..HAGW..T...................................PLHEACNH...........
ENSDORP00000012009  ED......VNRT..L..EGGR..K...................................PLHYAADC...........
ENSDORP00000009257  AK......LDIQ..D..KDGD..T...................................PLHEALRH...........
ENSDORP00000008161  LS......PHNL..I..YYGE..H...................................PLSFAACV...........
ENSDORP00000009839  --......----..-..----..-...................................--------...........
ENSDORP00000001630  RP......GDAT..D..PNST..S...................................PLHLAAKN...........
ENSDORP00000012903  VD......PSVT..D..KREW..R...................................PVHYAAFH...........
ENSDORP00000010147  --......----..-..----..-...................................--------...........
ENSDORP00000008900  TD......PCAA..D..DKGR..T...................................ALHFASCN...........
ENSDORP00000004243  FP......VDLP..T..DDCR..T...................................PLHLVIHK...........
ENSDORP00000008700  AS......TNVA..D..NKGY..F...................................PIHLAAWK...........
ENSDORP00000008105  LS......PHNL..I..YYGE..H...................................PLSFAACV...........
ENSDORP00000002464  LT......PDAQ..P..PFSR..Rltslvvc............................PLYISAAY...........
ENSDORP00000008204  RE......LNAP..D..EDGM..T...................................PTLWAAYH...........
ENSDORP00000001653  --......----..-..----..Y...................................FLMVSKTK...........
ENSDORP00000013463  AD......PSECp.A..HESL..T...................................YICLKSFR...........
ENSDORP00000013412  --......----..-..----..-...................................--------...........
ENSDORP00000007180  --......----..-..----..-...................................--------...........
ENSDORP00000000309  LE......AEAT..A..ENQC..T...................................PLLLAATS...........
ENSDORP00000008007  GN......VNQP..C..YAGW..T...................................ALHEASVG...........
ENSDORP00000010007  QD......LDWI..D..AQGA..T...................................LLHIAGAN...........
ENSDORP00000013572  VE......VNMR..D..EEGR..A...................................LLHWACDR...........
ENSDORP00000002756  VG......VNGL..D..KAGS..T...................................ALYWACHG...........
ENSDORP00000008159  RD......LNLC..D..EDGM..T...................................PTLLAAYH...........
ENSDORP00000013968  --......----..-..-EEN..I...................................CLHWAAFS...........
ENSDORP00000010487  AE......INSRtgS..KLGI..S...................................PLMLAAMN...........
ENSDORP00000001351  --......----..-..----..-...................................--------...........
ENSDORP00000009580  --......----..-..----..-...................................--------...........
ENSDORP00000006712  IN......DIRH..A..KSGG..T...................................ALHVAAAK...........
ENSDORP00000014166  LD......LERR..D..QRGF..T...................................ALMKAAVQ...........
ENSDORP00000013444  --......----..-..----..-...................................--------...........
ENSDORP00000004275  VD......INVK..D..NAGW..T...................................PLHEACNY...........
ENSDORP00000001355  AT......LNTSt.T..RYAQ..T...................................PAHIAAFG...........
ENSDORP00000013087  DD......PSLP..N..DEGI..T...................................ALHNAVCA...........
ENSDORP00000003943  --......----..-..----..-...................................--------...........
ENSDORP00000009340  AN......VGAA..D..KWGK..T...................................ALHWAAAV...........
ENSDORP00000008149  QG......VFKK..S..HAIQ..Q...................................ALIAAASM...........
ENSDORP00000015559  --......----..-..----..-...................................--------...........
ENSDORP00000006156  SA......VNSGe.D..SYAE..T...................................PLQLASAA...........
ENSDORP00000002459  AE......VNWV..DteDEGK..T...................................PLVQAVLG...........
ENSDORP00000011514  --......----..-..----..-...................................--------...........
ENSDORP00000007506  --......----..-..----..-...................................--------...........
ENSDORP00000014195  -V......EHGE..E..NYSE..T...................................PLQLAAAV...........
ENSDORP00000010305  --......----..D..KEGL..S...................................ALSWACLK...........
ENSDORP00000011086  VS......LDTI..H..PSGL..A...................................ALHEAVLS...........
ENSDORP00000003906  --......----..-..----..-...................................--------...........
ENSDORP00000007061  AN......LEAH..D..CHFG..T...................................PLHVACAR...........
ENSDORP00000008791  --......----..-..----..-...................................--------...........
ENSDORP00000011286  --......----..-..----..-...................................--------...........
ENSDORP00000010487  AD......QEHK..T..DEMH..T...................................ALMEACM-...........
ENSDORP00000001046  --......----..-..----..-...................................PVVNGTSF...........
ENSDORP00000013206  --......----..-..----..-...................................--------...........
ENSDORP00000000302  AD......VNWV..NggQENA..T...................................PLIRSTAA...........
ENSDORP00000004396  --......--CR..D..DDGV..Takdlsk.............................QLHSSVRT...........
ENSDORP00000009263  WE......LETMc.N..HDGL..T...................................PLQLAAKM...........
ENSDORP00000005406  FE......VNFM..D..DVGQ..T...................................LLNWASAF...........
ENSDORP00000011018  --......----..-..--NV..S...................................PLHHAAAE...........
ENSDORP00000007862  GD......LMHR..D..QQSR..T...................................LLHHAVST...........
ENSDORP00000005974  YN......AATTk.D..AFGR..N...................................ALHLASSC...........
ENSDORP00000015386  AD......PNCS..D..NEGR..P...................................AITVAVVN...........
ENSDORP00000004934  --......----..S..QRAF..V...................................ALYITSHR...........
ENSDORP00000007749  --......----..-..----..-...................................--------...........
ENSDORP00000011209  --......----..-..----..-...................................--------...........
ENSDORP00000014950  AD......IDAY..V..ATHP..Taf.................................PATIMFAM...........
ENSDORP00000004508  --......----..-..----..-...................................--------...........
ENSDORP00000010830  LK......LHPR..G..KNNF..S...................................PLHLAVDK...........
ENSDORP00000008316  --......----..-..----..-...................................-LHSSVRT...........
ENSDORP00000011647  --......----..-..----..-...................................-LHNSAAE...........
ENSDORP00000001838  --......----..-..----..-...................................-LLFAAYS...........
ENSDORP00000007356  KH......QGTC..F..YFGE..L...................................PLSLAACT...........
ENSDORP00000007453  AR......PRVV..N..ST--..-...................................--------...........
ENSDORP00000009265  --......----..F..YFGE..L...................................PLSLAACT...........
ENSDORP00000006222  --......-DVE..D..SSGW..T...................................ALHHAAAG...........
ENSDORP00000010465  --......----..-..----..-...................................-LLFAAYT...........
ENSDORP00000005903  SN......LEAVl.N..NDGL..S...................................PLMMAAKT...........
ENSDORP00000006810  --......----..-..----..-...................................-LWAAVQA...........
ENSDORP00000000618  --......----..-..----..A...................................ALMEAARA...........
ENSDORP00000005027  --......----..-..----..-...................................----ATAD...........
ENSDORP00000014908  --......----..-..----..-...................................PIILAAHC...........
ENSDORP00000013576  --......----..-..----..-...................................--------...........
ENSDORP00000015191  --......----..-..----..-...................................--------...........
ENSDORP00000001718  MNdpsvvtPFSR..D..DSGY..T...................................PLHMAALC...........
ENSDORP00000004586  --......----..P..ITGY..T...................................LLHWLAKH...........
ENSDORP00000010461  --......---R..F..SHDI..-...................................--------...........
ENSDORP00000011519  GN......PNKR..N..VHNE..T...................................SMHLLCMG...........
ENSDORP00000010487  --......----..-..----..-...................................--------...........
ENSDORP00000015746  --......----..-..----..-...................................--------...........
ENSDORP00000008684  --......----..F..TPDI..T...................................PIILAAHT...........
ENSDORP00000001089  --......----..-..----..-...................................--------...........
ENSDORP00000007061  --......----..-..---R..T...................................PVHEAAQR...........
ENSDORP00000011837  --......----..-..----..-...................................PLYAAIKA...........
ENSDORP00000000883  CP......LT--..-..----..-...................................--------...........
ENSDORP00000008319  QN......VEAL..D..PRGR..T...................................LLHLAVSL...........
ENSDORP00000011516  --......----..-..----..-...................................--------...........
ENSDORP00000005420  --......----..-..----..-...................................--------...........
ENSDORP00000014434  --......----..-..----..-...................................--------...........
ENSDORP00000012876  --......----..-..----..-...................................--------...........
ENSDORP00000002492  --......----..-..----..-...................................--------...........
ENSDORP00000009438  --......----..-..----..-...................................--------...........
ENSDORP00000006616  --......----..-..----..-...................................--------...........
ENSDORP00000014346  --......VNKR..N..ERGE..T...................................PLHMAAIR...........
ENSDORP00000005715  --......----..-..----..-...................................--------...........
ENSDORP00000007659  --......----..-..----..-...................................--------...........
ENSDORP00000000137  --......----..-..----..-...................................--------...........
ENSDORP00000011634  --......----..-..----..-...................................--------...........
ENSDORP00000007355  --......----..-..----..-...................................--------...........
ENSDORP00000001096  --......----..-..----..-...................................--------...........
ENSDORP00000007335  --......----..-..----..-...................................--------...........
ENSDORP00000001630  --......----..-..----..-...................................--------...........
ENSDORP00000010887  --......----..-..----..-...................................--------...........
ENSDORP00000013121  --......----..-..----..-...................................--------...........
ENSDORP00000007683  --......----..-..----..-...................................--------...........
ENSDORP00000002834  LE......VDPW..N..VDHF..C...................................TPMWACAL...........
ENSDORP00000014071  --......----..-..----..-...................................--------...........
ENSDORP00000000198  --......----..-..----..-...................................--------...........
ENSDORP00000006712  --......----..-..----..-...................................--------...........
ENSDORP00000009930  --......----..-..----..-...................................--------...........
ENSDORP00000010221  --......----..-..----..-...................................--------...........


                      0                                                                             
                      |                                                                             
d1s70b_               G.............Y....T..........................................................
ENSDORP00000001438  K.............D....A..........................................................
ENSDORP00000003161  G.............N....I..........................................................
ENSDORP00000013687  G.............H....V..........................................................
ENSDORP00000003291  G.............N....I..........................................................
ENSDORP00000015829  K.............D....A..........................................................
ENSDORP00000006395  D.............H....V..........................................................
ENSDORP00000006395  D.............K....V..........................................................
ENSDORP00000007897  G.............H....T..........................................................
ENSDORP00000012171  G.............R....F..........................................................
ENSDORP00000015191  G.............Y....I..........................................................
ENSDORP00000005511  R.............R....L..........................................................
ENSDORP00000001089  G.............Y....A..........................................................
ENSDORP00000001089  G.............H....E..........................................................
ENSDORP00000012094  G.............Y....L..........................................................
ENSDORP00000003161  G.............H....L..........................................................
ENSDORP00000008111  N.............T....L..........................................................
ENSDORP00000010887  G.............H....Y..........................................................
ENSDORP00000015756  C.............Q....V..........................................................
ENSDORP00000003012  C.............Q....V..........................................................
ENSDORP00000003803  G.............H....R..........................................................
ENSDORP00000012171  G.............Q....T..........................................................
ENSDORP00000010887  N.............R....V..........................................................
ENSDORP00000010328  Q.............E....R..........................................................
ENSDORP00000010714  G.............S....A..........................................................
ENSDORP00000005245  G.............S....Q..........................................................
ENSDORP00000012790  G.............H....I..........................................................
ENSDORP00000001687  G.............H....A..........................................................
ENSDORP00000000524  G.............Q....D..........................................................
ENSDORP00000002516  C.............K....A..........................................................
ENSDORP00000007933  S.............N....H..........................................................
ENSDORP00000001938  G.............Y....S..........................................................
ENSDORP00000002146  G.............F....S..........................................................
ENSDORP00000006986  D.............N....I..........................................................
ENSDORP00000013687  G.............H....E..........................................................
ENSDORP00000011695  T.............Hs...V..........................................................
ENSDORP00000003709  G.............H....S..........................................................
ENSDORP00000012607  E.............E....L..........................................................
ENSDORP00000012790  C.............H....F..........................................................
ENSDORP00000001046  G.............S....E..........................................................
ENSDORP00000012574  G.............H....T..........................................................
ENSDORP00000012710  G.............H....V..........................................................
ENSDORP00000008802  G.............H....S..........................................................
ENSDORP00000012790  D.............H....V..........................................................
ENSDORP00000000031  Vi............G....S..........................................................
ENSDORP00000013942  R.............N....I..........................................................
ENSDORP00000000883  G.............K....L..........................................................
ENSDORP00000012440  G.............F....G..........................................................
ENSDORP00000010065  G.............H....H..........................................................
ENSDORP00000015111  G.............H....A..........................................................
ENSDORP00000014007  N.............H....L..........................................................
ENSDORP00000008737  Q.............Q....F..........................................................
ENSDORP00000010826  N.............N....V..........................................................
ENSDORP00000003161  G.............N....V..........................................................
ENSDORP00000002055  G.............Q....D..........................................................
ENSDORP00000011259  G.............H....Q..........................................................
ENSDORP00000014237  G.............H....Y..........................................................
ENSDORP00000007536  Q.............H....V..........................................................
ENSDORP00000004979  G.............Y....Q..........................................................
ENSDORP00000010830  G.............S....L..........................................................
ENSDORP00000008769  A.............N....L..........................................................
ENSDORP00000009839  G.............Y....F..........................................................
ENSDORP00000015161  G.............H....S..........................................................
ENSDORP00000001718  G.............H....H..........................................................
ENSDORP00000002537  N.............N....A..........................................................
ENSDORP00000001580  G.............Q....L..........................................................
ENSDORP00000009438  G.............H....T..........................................................
ENSDORP00000002055  D.............H....V..........................................................
ENSDORP00000015480  G.............H....A..........................................................
ENSDORP00000012408  Q.............H....E..........................................................
ENSDORP00000002055  -.............-....-..........................................................
ENSDORP00000013812  E.............H....H..........................................................
ENSDORP00000013528  N.............N....V..........................................................
ENSDORP00000000083  N.............N....A..........................................................
ENSDORP00000003321  Anqa..........S....L..........................................................
ENSDORP00000011353  G.............N....T..........................................................
ENSDORP00000007355  G.............H....T..........................................................
ENSDORP00000007546  G.............Y....I..........................................................
ENSDORP00000009016  G.............Y....S..........................................................
ENSDORP00000011081  Q.............N....A..........................................................
ENSDORP00000011018  D.............H....H..........................................................
ENSDORP00000003291  D.............D....T..........................................................
ENSDORP00000008149  G.............D....A..........................................................
ENSDORP00000014950  G.............Q....L..........................................................
ENSDORP00000012171  G.............N....R..........................................................
ENSDORP00000014237  G.............H....V..........................................................
ENSDORP00000007749  N.............F....P..........................................................
ENSDORP00000015309  A.............S....Skagqllaagv................................................
ENSDORP00000007119  G.............H....T..........................................................
ENSDORP00000011018  G.............H....A..........................................................
ENSDORP00000002435  N.............R....F..........................................................
ENSDORP00000014274  G.............R....I..........................................................
ENSDORP00000004702  G.............N....V..........................................................
ENSDORP00000013942  G.............H....A..........................................................
ENSDORP00000011332  G.............Q....R..........................................................
ENSDORP00000014237  G.............D....V..........................................................
ENSDORP00000014578  G.............F....L..........................................................
ENSDORP00000005457  G.............H....A..........................................................
ENSDORP00000015160  -.............-....-..........................................................
ENSDORP00000011906  C.............R....P..........................................................
ENSDORP00000012571  N.............N....T..........................................................
ENSDORP00000012644  G.............F....L..........................................................
ENSDORP00000007538  E.............K....E..........................................................
ENSDORP00000009863  G.............Y....T..........................................................
ENSDORP00000010305  G.............H....S..........................................................
ENSDORP00000011587  G.............R....Q..........................................................
ENSDORP00000000485  -.............-....-..........................................................
ENSDORP00000014531  G.............H....L..........................................................
ENSDORP00000012009  G.............Q....L..........................................................
ENSDORP00000009257  H.............T....L..........................................................
ENSDORP00000008161  G.............S....E..........................................................
ENSDORP00000009839  -.............-....-..........................................................
ENSDORP00000001630  G.............H....I..........................................................
ENSDORP00000012903  G.............R....L..........................................................
ENSDORP00000010147  -.............-....-..........................................................
ENSDORP00000008900  G.............N....D..........................................................
ENSDORP00000004243  D.............NktmaV..........................................................
ENSDORP00000008700  G.............D....V..........................................................
ENSDORP00000008105  G.............S....E..........................................................
ENSDORP00000002464  H.............N....L..........................................................
ENSDORP00000008204  G.............N....L..........................................................
ENSDORP00000001653  Q.............N....E..........................................................
ENSDORP00000013463  L.............H....L..........................................................
ENSDORP00000013412  -.............-....-..........................................................
ENSDORP00000007180  G.............Y....Y..........................................................
ENSDORP00000000309  G.............A....L..........................................................
ENSDORP00000008007  G.............F....Y..........................................................
ENSDORP00000010007  G.............Y....L..........................................................
ENSDORP00000013572  G.............H....K..........................................................
ENSDORP00000002756  G.............H....K..........................................................
ENSDORP00000008159  G.............N....L..........................................................
ENSDORP00000013968  G.............C....V..........................................................
ENSDORP00000010487  G.............H....T..........................................................
ENSDORP00000001351  G.............Y....T..........................................................
ENSDORP00000009580  -.............-....-..........................................................
ENSDORP00000006712  G.............Y....T..........................................................
ENSDORP00000014166  D.............-....-..........................................................
ENSDORP00000013444  -.............-....-..........................................................
ENSDORP00000004275  G.............N....T..........................................................
ENSDORP00000001355  G.............H....P..........................................................
ENSDORP00000013087  G.............H....T..........................................................
ENSDORP00000003943  -.............-....-..........................................................
ENSDORP00000009340  N.............N....D..........................................................
ENSDORP00000008149  G.............Y....T..........................................................
ENSDORP00000015559  -.............-....-..........................................................
ENSDORP00000006156  G.............N....Y..........................................................
ENSDORP00000002459  G.............S....L..........................................................
ENSDORP00000011514  -.............-....-..........................................................
ENSDORP00000007506  -.............-....-..........................................................
ENSDORP00000014195  G.............N....F..........................................................
ENSDORP00000010305  G.............H....K..........................................................
ENSDORP00000011086  G.............N....L..........................................................
ENSDORP00000003906  -.............-....-..........................................................
ENSDORP00000007061  E.............H....L..........................................................
ENSDORP00000008791  -.............-....-..........................................................
ENSDORP00000011286  -.............-....-..........................................................
ENSDORP00000010487  -.............-....-..........................................................
ENSDORP00000001046  D.............E....N..........................................................
ENSDORP00000013206  -.............-....-..........................................................
ENSDORP00000000302  N.............S....L..........................................................
ENSDORP00000004396  G.............N....L..........................................................
ENSDORP00000009263  G.............K....A..........................................................
ENSDORP00000005406  G.............T....Q..........................................................
ENSDORP00000011018  G.............Q....V..........................................................
ENSDORP00000007862  G.............S....K..........................................................
ENSDORP00000005974  G.............K....K..........................................................
ENSDORP00000015386  K.............H....H..........................................................
ENSDORP00000004934  G.............H....V..........................................................
ENSDORP00000007749  G.............H....E..........................................................
ENSDORP00000011209  -.............-....-..........................................................
ENSDORP00000014950  K.............C....L..........................................................
ENSDORP00000004508  -.............-....-..........................................................
ENSDORP00000010830  NttcvgrypvckfpS....L..........................................................
ENSDORP00000008316  G.............N....L..........................................................
ENSDORP00000011647  G.............D....I..........................................................
ENSDORP00000001838  G.............D....V..........................................................
ENSDORP00000007356  K.............Q....W..........................................................
ENSDORP00000007453  -.............-....-..........................................................
ENSDORP00000009265  N.............Q....L..........................................................
ENSDORP00000006222  G.............C....L..........................................................
ENSDORP00000010465  G.............D....V..........................................................
ENSDORP00000005903  G.............K....I..........................................................
ENSDORP00000006810  Q.............D....V..........................................................
ENSDORP00000000618  N.............N....V..........................................................
ENSDORP00000005027  E.............D....L..........................................................
ENSDORP00000014908  Q.............K....Y..........................................................
ENSDORP00000013576  -.............-....-..........................................................
ENSDORP00000015191  -.............-....-..........................................................
ENSDORP00000001718  X.............X....Xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ENSDORP00000004586  G.............Y....H..........................................................
ENSDORP00000010461  -.............-....-..........................................................
ENSDORP00000011519  P.............Q....Imisegalhprlarpveddfrra....................................
ENSDORP00000010487  -.............-....-..........................................................
ENSDORP00000015746  -.............-....-..........................................................
ENSDORP00000008684  N.............N....Y..........................................................
ENSDORP00000001089  -.............-....-..........................................................
ENSDORP00000007061  G.............E....S..........................................................
ENSDORP00000011837  G.............N....E..........................................................
ENSDORP00000000883  -.............-....-..........................................................
ENSDORP00000008319  G.............H....L..........................................................
ENSDORP00000011516  G.............K....V..........................................................
ENSDORP00000005420  -.............-....-..........................................................
ENSDORP00000014434  -.............-....-..........................................................
ENSDORP00000012876  -.............-....-..........................................................
ENSDORP00000002492  -.............-....-..........................................................
ENSDORP00000009438  -.............-....-..........................................................
ENSDORP00000006616  -.............-....-..........................................................
ENSDORP00000014346  G.............D....V..........................................................
ENSDORP00000005715  -.............-....-..........................................................
ENSDORP00000007659  -.............-....-..........................................................
ENSDORP00000000137  -.............-....-..........................................................
ENSDORP00000011634  -.............-....V..........................................................
ENSDORP00000007355  -.............-....-..........................................................
ENSDORP00000001096  -.............-....-..........................................................
ENSDORP00000007335  -.............-....-..........................................................
ENSDORP00000001630  -.............-....-..........................................................
ENSDORP00000010887  -.............H....V..........................................................
ENSDORP00000013121  -.............-....-..........................................................
ENSDORP00000007683  -.............-....-..........................................................
ENSDORP00000002834  G.............H....L..........................................................
ENSDORP00000014071  -.............-....-..........................................................
ENSDORP00000000198  -.............-....-..........................................................
ENSDORP00000006712  -.............-....-..........................................................
ENSDORP00000009930  -.............-....-..........................................................
ENSDORP00000010221  -.............-....-..........................................................


                                   220                                                              
                                     |                                                              
d1s70b_               ........EVLKLLIQA......R...YD.................................................
ENSDORP00000001438  ........EMVRLLWHA......G...AD.................................................
ENSDORP00000003161  ........KLVKFLLQH......Q...AD.................................................
ENSDORP00000013687  ........EMVQVLIAC......H...AD.................................................
ENSDORP00000003291  ........KIVNFLLQH......S...AK.................................................
ENSDORP00000015829  ........EMVRLLWHA......G...AD.................................................
ENSDORP00000006395  ........ECVKHLLQH......K...AP.................................................
ENSDORP00000006395  ........NVADILTKH......G...AD.................................................
ENSDORP00000007897  ........STARLLLHR......G...AG.................................................
ENSDORP00000012171  ........TRSQILIQN......G...SE.................................................
ENSDORP00000015191  ........NCMAVLMEN......N...AD.................................................
ENSDORP00000005511  ........ALVRMLLEQd.....A...LE.................................................
ENSDORP00000001089  ........EVGRVLLDK......G...AD.................................................
ENSDORP00000001089  ........EMVALLLAQ......G...AN.................................................
ENSDORP00000012094  ........GIVEHLVSL......G...AD.................................................
ENSDORP00000003161  ........PIVKNLLQR......G...AS.................................................
ENSDORP00000008111  ........SMVQLLLQH......G...AN.................................................
ENSDORP00000010887  ........EVTELLLKH......G...AC.................................................
ENSDORP00000015756  ........EVMKALLSH......G...CS.................................................
ENSDORP00000003012  ........EVMKALLSH......G...CS.................................................
ENSDORP00000003803  ........EVIRQLLRA......G...IE.................................................
ENSDORP00000012171  ........AAVEFLLYRg.....K...AD.................................................
ENSDORP00000010887  ........SVVEYLLHH......G...AD.................................................
ENSDORP00000010328  ........SLVQYLLQA......G...AR.................................................
ENSDORP00000010714  ........AIAEVLLNA......R...CD.................................................
ENSDORP00000005245  ........KVASVLIDA......G...AD.................................................
ENSDORP00000012790  ........EMVNLLLAK......G...AN.................................................
ENSDORP00000001687  ........AICSQLLQR......G...AR.................................................
ENSDORP00000000524  ........EAIRFLVSDl.....G...ID.................................................
ENSDORP00000002516  ........DVVELLLSHa.....D...CDrrsriealellgasfandrenydimktyhylylamlerfqdgenileke
ENSDORP00000007933  ........SYCRMFLQR......G...AD.................................................
ENSDORP00000001938  ........EVLRLLIQA......G...YE.................................................
ENSDORP00000002146  ........EAAALLLEH......G...AS.................................................
ENSDORP00000006986  ........SLAGCLLLEg.....D...AH.................................................
ENSDORP00000013687  ........DIVLNLLQH......G...AE.................................................
ENSDORP00000011695  ........DPTRLLLTF......N...VS.................................................
ENSDORP00000003709  ........AVVELLLSH......G...VS.................................................
ENSDORP00000012607  ........GLVTYLVTKl.....H...AN.................................................
ENSDORP00000012790  ........HCIETLVTT......G...AN.................................................
ENSDORP00000001046  ........IIVRNLLLA......G...AK.................................................
ENSDORP00000012574  ........PILDRLLLL......G...AP.................................................
ENSDORP00000012710  ........SLVKLLTGQ......G...AE.................................................
ENSDORP00000008802  ........EVCRFLLDH......G...AD.................................................
ENSDORP00000012790  ........ECLQLLLRH......N...AQ.................................................
ENSDORP00000000031  ........EPTGFLLKF......N...PS.................................................
ENSDORP00000013942  ........EVVELLLDK......G...AK.................................................
ENSDORP00000000883  ........ESLRILISS......G...AN.................................................
ENSDORP00000012440  ........DIINDLAKVp.....E...CN.................................................
ENSDORP00000010065  ........DIVKYLLQSdl....E...VQ.................................................
ENSDORP00000015111  ........KVLSWLLLH......G...GE.................................................
ENSDORP00000014007  ........PIIRLLLSA......F...CS.................................................
ENSDORP00000008737  ........HCVWKLLYA......G...AD.................................................
ENSDORP00000010826  ........DAAVVLLKN......G...AN.................................................
ENSDORP00000003161  ........IMVRLLLDR......G...AQ.................................................
ENSDORP00000002055  ........VVVNELIDC......G...AN.................................................
ENSDORP00000011259  ........QMVKFLLDS......G...AN.................................................
ENSDORP00000014237  ........EVTXXXXXH......G...AC.................................................
ENSDORP00000007536  ........DCAKRLLQS......G...AN.................................................
ENSDORP00000004979  ........EVVSLILEH......G...GD.................................................
ENSDORP00000010830  ........DIMKMLLMY......C...AK.................................................
ENSDORP00000008769  ........ELIRLFLEL......PsclSF.................................................
ENSDORP00000009839  ........DILKLLFAY......N...GD.................................................
ENSDORP00000015161  ........DCLEHLIEC......G...AH.................................................
ENSDORP00000001718  ........EVAALLLQH......G...AS.................................................
ENSDORP00000002537  ........KMVKFLLKK......G...AD.................................................
ENSDORP00000001580  ........LLVQLLVER......H...AD.................................................
ENSDORP00000009438  ........EIMELLLQK......G...K-.................................................
ENSDORP00000002055  ........ECLQLLLSH......N...AQ.................................................
ENSDORP00000015480  ........SIVEVLLKH......G...AD.................................................
ENSDORP00000012408  ........ATARRLLEA......G...AD.................................................
ENSDORP00000002055  ........---------......G...AS.................................................
ENSDORP00000013812  ........LICRTLLDH......H...AE.................................................
ENSDORP00000013528  ........EAALALLXX......X...XX.................................................
ENSDORP00000000083  ........ECVRALLES......G...AS.................................................
ENSDORP00000003321  ........PTVDFIIQN......C...GH.................................................
ENSDORP00000011353  ........RVAELLLLH......G...AE.................................................
ENSDORP00000007355  ........SLVNFLLSE......N...IDlhlrmexxxxxxxxxxxxxxxxxxxxxxxxxxx................
ENSDORP00000007546  ........EVMRLLLQA......G...YD.................................................
ENSDORP00000009016  ........DVIQELLKF......S...PT.................................................
ENSDORP00000011081  ........QCLQLLIEN......G...FD.................................................
ENSDORP00000011018  ........ELADYLISV......G...AD.................................................
ENSDORP00000003291  ........KAAALLLQN......D...NN.................................................
ENSDORP00000008149  ........EVVQFLVDH......G...AM.................................................
ENSDORP00000014950  ........EALRFLAKH......-...--.................................................
ENSDORP00000012171  ........QNLELLLEM......S...FN.................................................
ENSDORP00000014237  ........DVAALLIKY......N...AC.................................................
ENSDORP00000007749  ........AVVQLLIAA......H...SD.................................................
ENSDORP00000015309  ........GCIRLLLTH......G...AN.................................................
ENSDORP00000007119  ........QVVVLLVAH......G...AE.................................................
ENSDORP00000011018  ........KAVALLLNH......D...AD.................................................
ENSDORP00000002435  ........DCVMVLLTY......G...AN.................................................
ENSDORP00000014274  ........DMVKGLLAC......G...AD.................................................
ENSDORP00000004702  ........DSLKLLMYH......R...VPargnslheeepklgftleggeespedtskpvvpadl.............
ENSDORP00000013942  ........DIVHLLLQN......G...AK.................................................
ENSDORP00000011332  ........DTAQILLLR......G...AK.................................................
ENSDORP00000014237  ........ETVKKLCTIq.....S...VN.................................................
ENSDORP00000014578  ........DTLQTLLEF......Q...AD.................................................
ENSDORP00000005457  ........HXXXXXXXN......G...AD.................................................
ENSDORP00000015160  ........---------......-...--.................................................
ENSDORP00000011906  ........MICQLLIDK......G...AD.................................................
ENSDORP00000012571  ........RVASFLLQH......D...AD.................................................
ENSDORP00000012644  ........DTLKVLVEH......G...AD.................................................
ENSDORP00000007538  ........DCLKKLLEL......G...AN.................................................
ENSDORP00000009863  ........DIVKMLLDC......G...VD.................................................
ENSDORP00000010305  ........SVVQCLLGMeeeh..E...IE.................................................
ENSDORP00000011587  ........DMVAALLEC......G...AD.................................................
ENSDORP00000000485  ........---------......-...--.................................................
ENSDORP00000014531  ........KVVELLLQH......K...AL.................................................
ENSDORP00000012009  ........EILEFLLLK......G...AD.................................................
ENSDORP00000009257  ........SQLRQL---......-...--.................................................
ENSDORP00000008161  ........EIVRLLIEH......G...AD.................................................
ENSDORP00000009839  ........---------......-...--.................................................
ENSDORP00000001630  ........DIIRLLLQA......G...ID.................................................
ENSDORP00000012903  ........GCLQLLVKW......G...CG.................................................
ENSDORP00000010147  ........---------......-...-D.................................................
ENSDORP00000008900  ........QIVQLLLDH......G...AD.................................................
ENSDORP00000004243  ........PCIDYLLQK......G...AA.................................................
ENSDORP00000008700  ........EIVKILIHH......G...PS.................................................
ENSDORP00000008105  ........EIVRLLIEH......G...AD.................................................
ENSDORP00000002464  ........QCFRLLLQA......G...ANpdfncngp.........................................
ENSDORP00000008204  ........ESLRLIVSR......G...SD.................................................
ENSDORP00000001653  ........YLVRMLLDA......G...VE.................................................
ENSDORP00000013463  ........PLLRFLLES......G...AA.................................................
ENSDORP00000013412  ........---------......-...--.................................................
ENSDORP00000007180  ........DIAKQLLAA......G...AE.................................................
ENSDORP00000000309  ........DTIQYLFSL......G...AN.................................................
ENSDORP00000008007  ........QIVSELLKG......G...AD.................................................
ENSDORP00000010007  ........RAAELLLDH......G...VR.................................................
ENSDORP00000013572  ........ELVTVLLQY......K...AD.................................................
ENSDORP00000002756  ........DVVEVLFTQs.....N...IE.................................................
ENSDORP00000008159  ........EALEVICSR......G...GD.................................................
ENSDORP00000013968  ........DIAEILLAA......K...CD.................................................
ENSDORP00000010487  ........AAVKLLLDM......G...SD.................................................
ENSDORP00000001351  ........DIVALLLDC......D...VD.................................................
ENSDORP00000009580  ........---------......-...--.................................................
ENSDORP00000006712  ........EVLKLLIQA......G...YD.................................................
ENSDORP00000014166  ........--------R......R...AD.................................................
ENSDORP00000013444  ........----FMQEQ......G...IS.................................................
ENSDORP00000004275  ........VCVQEILQR......C...PE.................................................
ENSDORP00000001355  ........QCLVWLIQA......G...AN.................................................
ENSDORP00000013087  ........EIVKFLVQF......G...VN.................................................
ENSDORP00000003943  ........---------......-...--.................................................
ENSDORP00000009340  ........RAARSLLQA......G...AD.................................................
ENSDORP00000008149  ........EIVSYLLD-......-...--.................................................
ENSDORP00000015559  ........---------......-...--.................................................
ENSDORP00000006156  ........ELVSLLLSR......G...ADpllsmleang.......................................
ENSDORP00000002459  ........IVCEFLLQN......G...AD.................................................
ENSDORP00000011514  ........---------......-...--.................................................
ENSDORP00000007506  ........---------......-...--.................................................
ENSDORP00000014195  ........ELVSLLLER......G...AD.................................................
ENSDORP00000010305  ........TVVQYLIEE......G...AE.................................................
ENSDORP00000011086  ........ECVKLLVKY......G...AD.................................................
ENSDORP00000003906  ........---------......-...--.................................................
ENSDORP00000007061  ........DCVKVLLNA......G...AN.................................................
ENSDORP00000008791  ........---------......-...--.................................................
ENSDORP00000011286  ........---------......-...--.................................................
ENSDORP00000010487  ........---------......-...--.................................................
ENSDORP00000001046  ........SFAARLIQR......G...SN.................................................
ENSDORP00000013206  ........---------......-...--.................................................
ENSDORP00000000302  ........LACEFLLQN......G...AN.................................................
ENSDORP00000004396  ........ETCLRLLSL......G...AQ.................................................
ENSDORP00000009263  ........EILKYILSR......E...--.................................................
ENSDORP00000005406  ........EMVEFLCER......G...AD.................................................
ENSDORP00000011018  ........ELMKMIISGs.....S...CD.................................................
ENSDORP00000007862  ........EVVRYLLDHap....Q...EI.................................................
ENSDORP00000005974  ........GVLDWLMEK......G...AD.................................................
ENSDORP00000015386  ........EAIPVLAQR......G...AD.................................................
ENSDORP00000004934  ........EAVQYLLEH......G...AS.................................................
ENSDORP00000007749  ........QAVRLLLKH......K...AA.................................................
ENSDORP00000011209  ........--------Y......N...AS.................................................
ENSDORP00000014950  ........SLLKFLMDL......G...CD.................................................
ENSDORP00000004508  ........---------......-...--.................................................
ENSDORP00000010830  ........QVTAILIEC......G...AD.................................................
ENSDORP00000008316  ........ETCLRLLSL......G...AQ.................................................
ENSDORP00000011647  ........GKLTGILHHf.....P...SL.................................................
ENSDORP00000001838  ........SALRRFALS......A...MD.................................................
ENSDORP00000007356  ........DVVTYLLENpyq...P...AS.................................................
ENSDORP00000007453  ........---------......-...--.................................................
ENSDORP00000009265  ........AIVKFLLQNswq...P...AD.................................................
ENSDORP00000006222  ........SCSELLCSF......K...AHlnprdrsgatxxxxxxxxxxxxxxxxxxxxxxxx...............
ENSDORP00000010465  ........SALRRFALS......A...MD.................................................
ENSDORP00000005903  ........GIFQHI---......-...--.................................................
ENSDORP00000006810  ........AAVLLLLAHarhg..P...LD.................................................
ENSDORP00000000618  ........PEVTRLLSE......G...AD.................................................
ENSDORP00000005027  ........RSVILLLAH......Gsr.EE.................................................
ENSDORP00000014908  ........EVVHMLLLK......G...AR.................................................
ENSDORP00000013576  ........---------......-...--.................................................
ENSDORP00000015191  ........---------......-...--.................................................
ENSDORP00000001718  xxxxxxxxXCVKALVYY......D...AQlcr..............................................
ENSDORP00000004586  ........EEMILVYDFakrqglP...LD.................................................
ENSDORP00000010461  ........---------......-...--.................................................
ENSDORP00000011519  ........DCLQMILRWk.....G...AKldqgeyeraa.......................................
ENSDORP00000010487  ........---------......-...--.................................................
ENSDORP00000015746  ........---------......-...-Dkeirnmlexxxxxxxxxxxxxxxxxxxxxxxxxxxxxlsrpnppd....
ENSDORP00000008684  ........EIIKLLVQK......G...VS.................................................
ENSDORP00000001089  ........---------......-...--.................................................
ENSDORP00000007061  ........LQLQQLIEN......G...AC.................................................
ENSDORP00000011837  ........DIAIFLLRH......G...A-.................................................
ENSDORP00000000883  ........---------......-...--.................................................
ENSDORP00000008319  ........ESARVLLRH......K...AD.................................................
ENSDORP00000011516  ........EATRILLEKg.....K...CN.................................................
ENSDORP00000005420  ........---------......-...--.................................................
ENSDORP00000014434  ........---------......-...--.................................................
ENSDORP00000012876  ........---------......-...--.................................................
ENSDORP00000002492  ........---------......-...--.................................................
ENSDORP00000009438  ........---------......-...--.................................................
ENSDORP00000006616  ........---------......-...--.................................................
ENSDORP00000014346  ........KQVKELISL......G...AN.................................................
ENSDORP00000005715  ........---------......-...--.................................................
ENSDORP00000007659  ........---------......-...--.................................................
ENSDORP00000000137  ........---------......-...--.................................................
ENSDORP00000011634  ........KITELLLHAit....N...VDakatdqdevykaskldllpsslklnnelgppssyytavp..........
ENSDORP00000007355  ........-----LFEK......K...VN.................................................
ENSDORP00000001096  ........---------......-...--.................................................
ENSDORP00000007335  ........---------......-...--.................................................
ENSDORP00000001630  ........---------......K...IN.................................................
ENSDORP00000010887  ........DIAALLIKY......N...TC.................................................
ENSDORP00000013121  ........---------......-...--.................................................
ENSDORP00000007683  ........---------......-...--.................................................
ENSDORP00000002834  ........EAAVVLYKWd.....R...RA.................................................
ENSDORP00000014071  ........---------......-...--.................................................
ENSDORP00000000198  ........---------......-...--.................................................
ENSDORP00000006712  ........---------......-...--.................................................
ENSDORP00000009930  ........---------......-...--.................................................
ENSDORP00000010221  ........---------......-...--.................................................


                                                                                                    
                                                                                                    
d1s70b_               ..............................................................................
ENSDORP00000001438  ..............................................................................
ENSDORP00000003161  ..............................................................................
ENSDORP00000013687  ..............................................................................
ENSDORP00000003291  ..............................................................................
ENSDORP00000015829  ..............................................................................
ENSDORP00000006395  ..............................................................................
ENSDORP00000006395  ..............................................................................
ENSDORP00000007897  ..............................................................................
ENSDORP00000012171  ..............................................................................
ENSDORP00000015191  ..............................................................................
ENSDORP00000005511  ..............................................................................
ENSDORP00000001089  ..............................................................................
ENSDORP00000001089  ..............................................................................
ENSDORP00000012094  ..............................................................................
ENSDORP00000003161  ..............................................................................
ENSDORP00000008111  ..............................................................................
ENSDORP00000010887  ..............................................................................
ENSDORP00000015756  ..............................................................................
ENSDORP00000003012  ..............................................................................
ENSDORP00000003803  ..............................................................................
ENSDORP00000012171  ..............................................................................
ENSDORP00000010887  ..............................................................................
ENSDORP00000010328  ..............................................................................
ENSDORP00000010714  ..............................................................................
ENSDORP00000005245  ..............................................................................
ENSDORP00000012790  ..............................................................................
ENSDORP00000001687  ..............................................................................
ENSDORP00000000524  ..............................................................................
ENSDORP00000002516  vlppihaygnrtecrnpqlesirxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxlhl
ENSDORP00000007933  ..............................................................................
ENSDORP00000001938  ..............................................................................
ENSDORP00000002146  ..............................................................................
ENSDORP00000006986  ..............................................................................
ENSDORP00000013687  ..............................................................................
ENSDORP00000011695  ..............................................................................
ENSDORP00000003709  ..............................................................................
ENSDORP00000012607  ..............................................................................
ENSDORP00000012790  ..............................................................................
ENSDORP00000001046  ..............................................................................
ENSDORP00000012574  ..............................................................................
ENSDORP00000012710  ..............................................................................
ENSDORP00000008802  ..............................................................................
ENSDORP00000012790  ..............................................................................
ENSDORP00000000031  ..............................................................................
ENSDORP00000013942  ..............................................................................
ENSDORP00000000883  ..............................................................................
ENSDORP00000012440  ..............................................................................
ENSDORP00000010065  ..............................................................................
ENSDORP00000015111  ..............................................................................
ENSDORP00000014007  ..............................................................................
ENSDORP00000008737  ..............................................................................
ENSDORP00000010826  ..............................................................................
ENSDORP00000003161  ..............................................................................
ENSDORP00000002055  ..............................................................................
ENSDORP00000011259  ..............................................................................
ENSDORP00000014237  ..............................................................................
ENSDORP00000007536  ..............................................................................
ENSDORP00000004979  ..............................................................................
ENSDORP00000010830  ..............................................................................
ENSDORP00000008769  ..............................................................................
ENSDORP00000009839  ..............................................................................
ENSDORP00000015161  ..............................................................................
ENSDORP00000001718  ..............................................................................
ENSDORP00000002537  ..............................................................................
ENSDORP00000001580  ..............................................................................
ENSDORP00000009438  ..............................................................................
ENSDORP00000002055  ..............................................................................
ENSDORP00000015480  ..............................................................................
ENSDORP00000012408  ..............................................................................
ENSDORP00000002055  ..............................................................................
ENSDORP00000013812  ..............................................................................
ENSDORP00000013528  ..............................................................................
ENSDORP00000000083  ..............................................................................
ENSDORP00000003321  ..............................................................................
ENSDORP00000011353  ..............................................................................
ENSDORP00000007355  ..............................................................................
ENSDORP00000007546  ..............................................................................
ENSDORP00000009016  ..............................................................................
ENSDORP00000011081  ..............................................................................
ENSDORP00000011018  ..............................................................................
ENSDORP00000003291  ..............................................................................
ENSDORP00000008149  ..............................................................................
ENSDORP00000014950  ..............................................................................
ENSDORP00000012171  ..............................................................................
ENSDORP00000014237  ..............................................................................
ENSDORP00000007749  ..............................................................................
ENSDORP00000015309  ..............................................................................
ENSDORP00000007119  ..............................................................................
ENSDORP00000011018  ..............................................................................
ENSDORP00000002435  ..............................................................................
ENSDORP00000014274  ..............................................................................
ENSDORP00000004702  ..............................................................................
ENSDORP00000013942  ..............................................................................
ENSDORP00000011332  ..............................................................................
ENSDORP00000014237  ..............................................................................
ENSDORP00000014578  ..............................................................................
ENSDORP00000005457  ..............................................................................
ENSDORP00000015160  ..............................................................................
ENSDORP00000011906  ..............................................................................
ENSDORP00000012571  ..............................................................................
ENSDORP00000012644  ..............................................................................
ENSDORP00000007538  ..............................................................................
ENSDORP00000009863  ..............................................................................
ENSDORP00000010305  ..............................................................................
ENSDORP00000011587  ..............................................................................
ENSDORP00000000485  ..............................................................................
ENSDORP00000014531  ..............................................................................
ENSDORP00000012009  ..............................................................................
ENSDORP00000009257  ..............................................................................
ENSDORP00000008161  ..............................................................................
ENSDORP00000009839  ..............................................................................
ENSDORP00000001630  ..............................................................................
ENSDORP00000012903  ..............................................................................
ENSDORP00000010147  ..............................................................................
ENSDORP00000008900  ..............................................................................
ENSDORP00000004243  ..............................................................................
ENSDORP00000008700  ..............................................................................
ENSDORP00000008105  ..............................................................................
ENSDORP00000002464  ..............................................................................
ENSDORP00000008204  ..............................................................................
ENSDORP00000001653  ..............................................................................
ENSDORP00000013463  ..............................................................................
ENSDORP00000013412  ..............................................................................
ENSDORP00000007180  ..............................................................................
ENSDORP00000000309  ..............................................................................
ENSDORP00000008007  ..............................................................................
ENSDORP00000010007  ..............................................................................
ENSDORP00000013572  ..............................................................................
ENSDORP00000002756  ..............................................................................
ENSDORP00000008159  ..............................................................................
ENSDORP00000013968  ..............................................................................
ENSDORP00000010487  ..............................................................................
ENSDORP00000001351  ..............................................................................
ENSDORP00000009580  ..............................................................................
ENSDORP00000006712  ..............................................................................
ENSDORP00000014166  ..............................................................................
ENSDORP00000013444  ..............................................................................
ENSDORP00000004275  ..............................................................................
ENSDORP00000001355  ..............................................................................
ENSDORP00000013087  ..............................................................................
ENSDORP00000003943  ..............................................................................
ENSDORP00000009340  ..............................................................................
ENSDORP00000008149  ..............................................................................
ENSDORP00000015559  ..............................................................................
ENSDORP00000006156  ..............................................................................
ENSDORP00000002459  ..............................................................................
ENSDORP00000011514  ..............................................................................
ENSDORP00000007506  ..............................................................................
ENSDORP00000014195  ..............................................................................
ENSDORP00000010305  ..............................................................................
ENSDORP00000011086  ..............................................................................
ENSDORP00000003906  ..............................................................................
ENSDORP00000007061  ..............................................................................
ENSDORP00000008791  ..............................................................................
ENSDORP00000011286  ..............................................................................
ENSDORP00000010487  ..............................................................................
ENSDORP00000001046  ..............................................................................
ENSDORP00000013206  ..............................................................................
ENSDORP00000000302  ..............................................................................
ENSDORP00000004396  ..............................................................................
ENSDORP00000009263  ..............................................................................
ENSDORP00000005406  ..............................................................................
ENSDORP00000011018  ..............................................................................
ENSDORP00000007862  ..............................................................................
ENSDORP00000005974  ..............................................................................
ENSDORP00000015386  ..............................................................................
ENSDORP00000004934  ..............................................................................
ENSDORP00000007749  ..............................................................................
ENSDORP00000011209  ..............................................................................
ENSDORP00000014950  ..............................................................................
ENSDORP00000004508  ..............................................................................
ENSDORP00000010830  ..............................................................................
ENSDORP00000008316  ..............................................................................
ENSDORP00000011647  ..............................................................................
ENSDORP00000001838  ..............................................................................
ENSDORP00000007356  ..............................................................................
ENSDORP00000007453  ..............................................................................
ENSDORP00000009265  ..............................................................................
ENSDORP00000006222  ..............................................................................
ENSDORP00000010465  ..............................................................................
ENSDORP00000005903  ..............................................................................
ENSDORP00000006810  ..............................................................................
ENSDORP00000000618  ..............................................................................
ENSDORP00000005027  ..............................................................................
ENSDORP00000014908  ..............................................................................
ENSDORP00000013576  ..............................................................................
ENSDORP00000015191  ..............................................................................
ENSDORP00000001718  ..............................................................................
ENSDORP00000004586  ..............................................................................
ENSDORP00000010461  ..............................................................................
ENSDORP00000011519  ..............................................................................
ENSDORP00000010487  ..............................................................................
ENSDORP00000015746  ..............................................................................
ENSDORP00000008684  ..............................................................................
ENSDORP00000001089  ..............................................................................
ENSDORP00000007061  ..............................................................................
ENSDORP00000011837  ..............................................................................
ENSDORP00000000883  ..............................................................................
ENSDORP00000008319  ..............................................................................
ENSDORP00000011516  ..............................................................................
ENSDORP00000005420  ..............................................................................
ENSDORP00000014434  ..............................................................................
ENSDORP00000012876  ..............................................................................
ENSDORP00000002492  ..............................................................................
ENSDORP00000009438  ..............................................................................
ENSDORP00000006616  ..............................................................................
ENSDORP00000014346  ..............................................................................
ENSDORP00000005715  ..............................................................................
ENSDORP00000007659  ..............................................................................
ENSDORP00000000137  ..............................................................................
ENSDORP00000011634  ..............................................................................
ENSDORP00000007355  ..............................................................................
ENSDORP00000001096  ..............................................................................
ENSDORP00000007335  ..............................................................................
ENSDORP00000001630  ..............................................................................
ENSDORP00000010887  ..............................................................................
ENSDORP00000013121  ..............................................................................
ENSDORP00000007683  ..............................................................................
ENSDORP00000002834  ..............................................................................
ENSDORP00000014071  ..............................................................................
ENSDORP00000000198  ..............................................................................
ENSDORP00000006712  ..............................................................................
ENSDORP00000009930  ..............................................................................
ENSDORP00000010221  ..............................................................................


                                                                                                    
                                                                                                    
d1s70b_               ..............................................................................
ENSDORP00000001438  ..............................................................................
ENSDORP00000003161  ..............................................................................
ENSDORP00000013687  ..............................................................................
ENSDORP00000003291  ..............................................................................
ENSDORP00000015829  ..............................................................................
ENSDORP00000006395  ..............................................................................
ENSDORP00000006395  ..............................................................................
ENSDORP00000007897  ..............................................................................
ENSDORP00000012171  ..............................................................................
ENSDORP00000015191  ..............................................................................
ENSDORP00000005511  ..............................................................................
ENSDORP00000001089  ..............................................................................
ENSDORP00000001089  ..............................................................................
ENSDORP00000012094  ..............................................................................
ENSDORP00000003161  ..............................................................................
ENSDORP00000008111  ..............................................................................
ENSDORP00000010887  ..............................................................................
ENSDORP00000015756  ..............................................................................
ENSDORP00000003012  ..............................................................................
ENSDORP00000003803  ..............................................................................
ENSDORP00000012171  ..............................................................................
ENSDORP00000010887  ..............................................................................
ENSDORP00000010328  ..............................................................................
ENSDORP00000010714  ..............................................................................
ENSDORP00000005245  ..............................................................................
ENSDORP00000012790  ..............................................................................
ENSDORP00000001687  ..............................................................................
ENSDORP00000000524  ..............................................................................
ENSDORP00000002516  rqkgnrnthkdllrfaqvfsqmihlnetvkapdiecvlrcsvleieqsmnrvknitdadvhsamdnyecnlytflylv
ENSDORP00000007933  ..............................................................................
ENSDORP00000001938  ..............................................................................
ENSDORP00000002146  ..............................................................................
ENSDORP00000006986  ..............................................................................
ENSDORP00000013687  ..............................................................................
ENSDORP00000011695  ..............................................................................
ENSDORP00000003709  ..............................................................................
ENSDORP00000012607  ..............................................................................
ENSDORP00000012790  ..............................................................................
ENSDORP00000001046  ..............................................................................
ENSDORP00000012574  ..............................................................................
ENSDORP00000012710  ..............................................................................
ENSDORP00000008802  ..............................................................................
ENSDORP00000012790  ..............................................................................
ENSDORP00000000031  ..............................................................................
ENSDORP00000013942  ..............................................................................
ENSDORP00000000883  ..............................................................................
ENSDORP00000012440  ..............................................................................
ENSDORP00000010065  ..............................................................................
ENSDORP00000015111  ..............................................................................
ENSDORP00000014007  ..............................................................................
ENSDORP00000008737  ..............................................................................
ENSDORP00000010826  ..............................................................................
ENSDORP00000003161  ..............................................................................
ENSDORP00000002055  ..............................................................................
ENSDORP00000011259  ..............................................................................
ENSDORP00000014237  ..............................................................................
ENSDORP00000007536  ..............................................................................
ENSDORP00000004979  ..............................................................................
ENSDORP00000010830  ..............................................................................
ENSDORP00000008769  ..............................................................................
ENSDORP00000009839  ..............................................................................
ENSDORP00000015161  ..............................................................................
ENSDORP00000001718  ..............................................................................
ENSDORP00000002537  ..............................................................................
ENSDORP00000001580  ..............................................................................
ENSDORP00000009438  ..............................................................................
ENSDORP00000002055  ..............................................................................
ENSDORP00000015480  ..............................................................................
ENSDORP00000012408  ..............................................................................
ENSDORP00000002055  ..............................................................................
ENSDORP00000013812  ..............................................................................
ENSDORP00000013528  ..............................................................................
ENSDORP00000000083  ..............................................................................
ENSDORP00000003321  ..............................................................................
ENSDORP00000011353  ..............................................................................
ENSDORP00000007355  ..............................................................................
ENSDORP00000007546  ..............................................................................
ENSDORP00000009016  ..............................................................................
ENSDORP00000011081  ..............................................................................
ENSDORP00000011018  ..............................................................................
ENSDORP00000003291  ..............................................................................
ENSDORP00000008149  ..............................................................................
ENSDORP00000014950  ..............................................................................
ENSDORP00000012171  ..............................................................................
ENSDORP00000014237  ..............................................................................
ENSDORP00000007749  ..............................................................................
ENSDORP00000015309  ..............................................................................
ENSDORP00000007119  ..............................................................................
ENSDORP00000011018  ..............................................................................
ENSDORP00000002435  ..............................................................................
ENSDORP00000014274  ..............................................................................
ENSDORP00000004702  ..............................................................................
ENSDORP00000013942  ..............................................................................
ENSDORP00000011332  ..............................................................................
ENSDORP00000014237  ..............................................................................
ENSDORP00000014578  ..............................................................................
ENSDORP00000005457  ..............................................................................
ENSDORP00000015160  ..............................................................................
ENSDORP00000011906  ..............................................................................
ENSDORP00000012571  ..............................................................................
ENSDORP00000012644  ..............................................................................
ENSDORP00000007538  ..............................................................................
ENSDORP00000009863  ..............................................................................
ENSDORP00000010305  ..............................................................................
ENSDORP00000011587  ..............................................................................
ENSDORP00000000485  ..............................................................................
ENSDORP00000014531  ..............................................................................
ENSDORP00000012009  ..............................................................................
ENSDORP00000009257  ..............................................................................
ENSDORP00000008161  ..............................................................................
ENSDORP00000009839  ..............................................................................
ENSDORP00000001630  ..............................................................................
ENSDORP00000012903  ..............................................................................
ENSDORP00000010147  ..............................................................................
ENSDORP00000008900  ..............................................................................
ENSDORP00000004243  ..............................................................................
ENSDORP00000008700  ..............................................................................
ENSDORP00000008105  ..............................................................................
ENSDORP00000002464  ..............................................................................
ENSDORP00000008204  ..............................................................................
ENSDORP00000001653  ..............................................................................
ENSDORP00000013463  ..............................................................................
ENSDORP00000013412  ..............................................................................
ENSDORP00000007180  ..............................................................................
ENSDORP00000000309  ..............................................................................
ENSDORP00000008007  ..............................................................................
ENSDORP00000010007  ..............................................................................
ENSDORP00000013572  ..............................................................................
ENSDORP00000002756  ..............................................................................
ENSDORP00000008159  ..............................................................................
ENSDORP00000013968  ..............................................................................
ENSDORP00000010487  ..............................................................................
ENSDORP00000001351  ..............................................................................
ENSDORP00000009580  ..............................................................................
ENSDORP00000006712  ..............................................................................
ENSDORP00000014166  ..............................................................................
ENSDORP00000013444  ..............................................................................
ENSDORP00000004275  ..............................................................................
ENSDORP00000001355  ..............................................................................
ENSDORP00000013087  ..............................................................................
ENSDORP00000003943  ..............................................................................
ENSDORP00000009340  ..............................................................................
ENSDORP00000008149  ..............................................................................
ENSDORP00000015559  ..............................................................................
ENSDORP00000006156  ..............................................................................
ENSDORP00000002459  ..............................................................................
ENSDORP00000011514  ..............................................................................
ENSDORP00000007506  ..............................................................................
ENSDORP00000014195  ..............................................................................
ENSDORP00000010305  ..............................................................................
ENSDORP00000011086  ..............................................................................
ENSDORP00000003906  ..............................................................................
ENSDORP00000007061  ..............................................................................
ENSDORP00000008791  ..............................................................................
ENSDORP00000011286  ..............................................................................
ENSDORP00000010487  ..............................................................................
ENSDORP00000001046  ..............................................................................
ENSDORP00000013206  ..............................................................................
ENSDORP00000000302  ..............................................................................
ENSDORP00000004396  ..............................................................................
ENSDORP00000009263  ..............................................................................
ENSDORP00000005406  ..............................................................................
ENSDORP00000011018  ..............................................................................
ENSDORP00000007862  ..............................................................................
ENSDORP00000005974  ..............................................................................
ENSDORP00000015386  ..............................................................................
ENSDORP00000004934  ..............................................................................
ENSDORP00000007749  ..............................................................................
ENSDORP00000011209  ..............................................................................
ENSDORP00000014950  ..............................................................................
ENSDORP00000004508  ..............................................................................
ENSDORP00000010830  ..............................................................................
ENSDORP00000008316  ..............................................................................
ENSDORP00000011647  ..............................................................................
ENSDORP00000001838  ..............................................................................
ENSDORP00000007356  ..............................................................................
ENSDORP00000007453  ..............................................................................
ENSDORP00000009265  ..............................................................................
ENSDORP00000006222  ..............................................................................
ENSDORP00000010465  ..............................................................................
ENSDORP00000005903  ..............................................................................
ENSDORP00000006810  ..............................................................................
ENSDORP00000000618  ..............................................................................
ENSDORP00000005027  ..............................................................................
ENSDORP00000014908  ..............................................................................
ENSDORP00000013576  ..............................................................................
ENSDORP00000015191  ..............................................................................
ENSDORP00000001718  ..............................................................................
ENSDORP00000004586  ..............................................................................
ENSDORP00000010461  ..............................................................................
ENSDORP00000011519  ..............................................................................
ENSDORP00000010487  ..............................................................................
ENSDORP00000015746  ..............................................................................
ENSDORP00000008684  ..............................................................................
ENSDORP00000001089  ..............................................................................
ENSDORP00000007061  ..............................................................................
ENSDORP00000011837  ..............................................................................
ENSDORP00000000883  ..............................................................................
ENSDORP00000008319  ..............................................................................
ENSDORP00000011516  ..............................................................................
ENSDORP00000005420  ..............................................................................
ENSDORP00000014434  ..............................................................................
ENSDORP00000012876  ..............................................................................
ENSDORP00000002492  ..............................................................................
ENSDORP00000009438  ..............................................................................
ENSDORP00000006616  ..............................................................................
ENSDORP00000014346  ..............................................................................
ENSDORP00000005715  ..............................................................................
ENSDORP00000007659  ..............................................................................
ENSDORP00000000137  ..............................................................................
ENSDORP00000011634  ..............................................................................
ENSDORP00000007355  ..............................................................................
ENSDORP00000001096  ..............................................................................
ENSDORP00000007335  ..............................................................................
ENSDORP00000001630  ..............................................................................
ENSDORP00000010887  ..............................................................................
ENSDORP00000013121  ..............................................................................
ENSDORP00000007683  ..............................................................................
ENSDORP00000002834  ..............................................................................
ENSDORP00000014071  ..............................................................................
ENSDORP00000000198  ..............................................................................
ENSDORP00000006712  ..............................................................................
ENSDORP00000009930  ..............................................................................
ENSDORP00000010221  ..............................................................................


                                                             230                                    
                                                               |                                    
d1s70b_               .........................V..NIK.........DY....DGW.............................
ENSDORP00000001438  .........................L..NKP.........EPt...CGR.............................
ENSDORP00000003161  .........................V..NAK.........TK....LGY.............................
ENSDORP00000013687  .........................V..NAA.........DN....EKR.............................
ENSDORP00000003291  .........................V..NAK.........TK....NGY.............................
ENSDORP00000015829  .........................L..NKP.........EPt...CGR.............................
ENSDORP00000006395  .........................V..DDV.........TL....DYL.............................
ENSDORP00000006395  .........................K..DAH.........TK....LGY.............................
ENSDORP00000007897  .........................K..EAV.........TA....EGC.............................
ENSDORP00000012171  .........................I..DCA.........DK....FGN.............................
ENSDORP00000015191  .........................P..NIQ.........DK....EGR.............................
ENSDORP00000005511  .........................I..DDT.........DH....EGT.............................
ENSDORP00000001089  .........................V..NAP.........PVps..SRD.............................
ENSDORP00000001089  .........................I..NAQ.........TE....ETQetaltlaccggfsevadflikagadielg
ENSDORP00000012094  .........................V..NAQ.........EPc...NGR.............................
ENSDORP00000003161  .........................P..NVS.........NV....KVE.............................
ENSDORP00000008111  .........................V..NAQ.........MY....SGS.............................
ENSDORP00000010887  .........................V..NAM.........DL....WQF.............................
ENSDORP00000015756  .........................V..DFQ.........DR....HGN.............................
ENSDORP00000003012  .........................V..DFQ.........DR....HGN.............................
ENSDORP00000003803  .........................I..NRQ.........TK....TG-.............................
ENSDORP00000012171  .........................L..TVL.........DE....NKN.............................
ENSDORP00000010887  .........................V..HAK.........DK....GGL.............................
ENSDORP00000010328  .........................V..DAR.........ML....NGC.............................
ENSDORP00000010714  .........................L..HAV.........NY....HGD.............................
ENSDORP00000005245  .........................V..NVR.........DK....DGK.............................
ENSDORP00000012790  .........................I..NAF.........DK....KDR.............................
ENSDORP00000001687  .........................V..NVK.........DK....DDK.............................
ENSDORP00000000524  .........................V..DVR.........ATt...THH.............................
ENSDORP00000002516  cistktqcseedqckinkqiynlihL..DPR.........TR....EGF.............................
ENSDORP00000007933  .........................T..NLG.........RLe...DGQ.............................
ENSDORP00000001938  .........................L..NVQ.........DH....DGW.............................
ENSDORP00000002146  .........................L..SAK.........DQ....DGW.............................
ENSDORP00000006986  .........................V..DST.........TF....DGT.............................
ENSDORP00000013687  .........................V..NKA.........DN....EGR.............................
ENSDORP00000011695  .........................V..NLG.........DKy...HKN.............................
ENSDORP00000003709  .........................A..NAM.........DY....GGH.............................
ENSDORP00000012607  .........................V..NAR.........TF....AGN.............................
ENSDORP00000012790  .........................V..NET.........DD....WGR.............................
ENSDORP00000001046  .........................V..NEL.........TK....HRQ.............................
ENSDORP00000012574  .........................I..-MR.........DS....WGG.............................
ENSDORP00000012710  .........................L..D-V.........GQ....DLR.............................
ENSDORP00000008802  .........................V..NSR.........DK....NGR.............................
ENSDORP00000012790  .........................V..NAV.........DN....SGK.............................
ENSDORP00000000031  .........................L..NVV.........DKv...HQN.............................
ENSDORP00000013942  .........................V..SAA.........DK....KGD.............................
ENSDORP00000000883  .........................V..NCQ.........AL....DKA.............................
ENSDORP00000012440  .........................L..QAL.........DV....DDR.............................
ENSDORP00000010065  .........................P..HVV.........NI....YGD.............................
ENSDORP00000015111  .........................I..-SA.........DL....WGG.............................
ENSDORP00000014007  .........................V..HEK.........NQ....AGD.............................
ENSDORP00000008737  .........................V..-QK.........GK....YWD.............................
ENSDORP00000010826  .........................K..DMQ.........NN....KEE.............................
ENSDORP00000003161  .........................I..ETR.........TK....DEL.............................
ENSDORP00000002055  .........................V..NQK.........NE....KGF.............................
ENSDORP00000011259  .........................A..NVR.........EPt...YGF.............................
ENSDORP00000014237  .........................V..NAM.........DL....WQF.............................
ENSDORP00000007536  .........................V..NL-.........GK....GLD.............................
ENSDORP00000004979  .........................L..NTA.........DN....QYW.............................
ENSDORP00000010830  .........................M..-EK.........DG....YGM.............................
ENSDORP00000008769  .........................V..NTK.........AY....NGN.............................
ENSDORP00000009839  .........................M..GII.........AM....NGN.............................
ENSDORP00000015161  .........................L..NAQ.........DK....EGD.............................
ENSDORP00000001718  .........................M..NAS.........NS....KGN.............................
ENSDORP00000002537  .........................V..NAS.........DN....NQR.............................
ENSDORP00000001580  .........................I..DKQ.........DSv...HGW.............................
ENSDORP00000009438  .........................-..-IF.........AS....DAS.............................
ENSDORP00000002055  .........................V..NSV.........DS....SGK.............................
ENSDORP00000015480  .........................V..NAK.........DM....LKM.............................
ENSDORP00000012408  .........................P..RAA.........GR....KQH.............................
ENSDORP00000002055  .........................V..NDL.........DE....RGC.............................
ENSDORP00000013812  .........................V..NAR.........DD....DFK.............................
ENSDORP00000013528  .........................X..XXX.........XX....XEE.............................
ENSDORP00000000083  .........................V..NAL.........DY....NND.............................
ENSDORP00000003321  .........................L..DAK.........AT....DGN.............................
ENSDORP00000011353  .........................A..NCA.........DPt...TLT.............................
ENSDORP00000007355  .........................X..XXX.........XX....RQR.............................
ENSDORP00000007546  .........................P..ELR.........DG....DGW.............................
ENSDORP00000009016  .........................L..GIL.........-K....NGT.............................
ENSDORP00000011081  .........................V..NMLlddhisqsyDD....ERK.............................
ENSDORP00000011018  .........................I..NTT.........DS....EGR.............................
ENSDORP00000003291  .........................A..DVE.........SK....SGF.............................
ENSDORP00000008149  .........................I..EHV.........DY....SGM.............................
ENSDORP00000014950  .........................-..---.........--....---.............................
ENSDORP00000012171  .........................CleDVE.........ST....IPV.............................
ENSDORP00000014237  .........................V..NAT.........DK....WAF.............................
ENSDORP00000007749  .........................L..DAV.........DS....RQQ.............................
ENSDORP00000015309  .........................V..NVQ.........DH....EGK.............................
ENSDORP00000007119  .........................V..NAQ.........DE....NGY.............................
ENSDORP00000011018  .........................I..-VM.........NK....QQA.............................
ENSDORP00000002435  .........................A..GAR.........GE....NGN.............................
ENSDORP00000014274  .........................V..NIQ.........DD....EGS.............................
ENSDORP00000004702  .........................I..NHA.........DR....EGW.............................
ENSDORP00000013942  .........................V..NCS.........D-....---.............................
ENSDORP00000011332  .........................Y..-LP.........DK....NGV.............................
ENSDORP00000014237  .........................C..RDI.........EG....RQS.............................
ENSDORP00000014578  .........................V..NIE.........DN....EGN.............................
ENSDORP00000005457  .........................V..NAK.........DM....LKM.............................
ENSDORP00000015160  .........................-..---.........--....---.............................
ENSDORP00000011906  .........................V..NSK.........DC....---.............................
ENSDORP00000012571  .........................I..NAQ.........TK....GLL.............................
ENSDORP00000012644  .........................V..NVP.........DA....TGA.............................
ENSDORP00000007538  .........................P..D-Q.........GQ....WLN.............................
ENSDORP00000009863  .........................V..NEY.........DW....NGG.............................
ENSDORP00000010305  .........................V..NGT.........DTl...WGE.............................
ENSDORP00000011587  .........................V..NTQ.........DA....DGA.............................
ENSDORP00000000485  .........................-..---.........--....---.............................
ENSDORP00000014531  .........................V..NST.........GY....HND.............................
ENSDORP00000012009  .........................I..NAP.........DK....HHI.............................
ENSDORP00000009257  .........................-..---.........--....---.............................
ENSDORP00000008161  .........................I..RAQ.........DS....LGN.............................
ENSDORP00000009839  .........................-..---.........--....---.............................
ENSDORP00000001630  .........................I..NRQ.........TK....AG-.............................
ENSDORP00000012903  .........................I..EEV.........DC....NGN.............................
ENSDORP00000010147  .........................P..GGQ.........GC....DGI.............................
ENSDORP00000008900  .........................P..NQR.........DG....LGN.............................
ENSDORP00000004243  .........................I..NSV.........TL....NRS.............................
ENSDORP00000008700  .........................H..SRV.........NEqt..EKG.............................
ENSDORP00000008105  .........................I..RAQ.........DS....LGN.............................
ENSDORP00000002464  .........................V..NTQ.........EF....YRGsp...........................
ENSDORP00000008204  .........................P..DKC.........DI....WGN.............................
ENSDORP00000001653  .........................V..NAT.........DC....YGC.............................
ENSDORP00000013463  .........................Y..N--.........--....---.............................
ENSDORP00000013412  .........................L..DKQ.........TG....KGS.............................
ENSDORP00000007180  .........................V..NTK.........GL....DDD.............................
ENSDORP00000000309  .........................W..RKT.........DT....KGN.............................
ENSDORP00000008007  .........................V..NTK.........GM....HQI.............................
ENSDORP00000010007  .........................V..DVK.........DW....DGW.............................
ENSDORP00000013572  .........................I..NCQ.........DN....EGQ.............................
ENSDORP00000002756  .........................L..NQQ.........NK....LGD.............................
ENSDORP00000008159  .........................A..DRC.........DI....WGN.............................
ENSDORP00000013968  .........................L..HAV.........NI....HGD.............................
ENSDORP00000010487  .........................I..NAQ.........IEt...NRN.............................
ENSDORP00000001351  .........................I..NIF.........DW....NGG.............................
ENSDORP00000009580  .........................-..---.........--....---.............................
ENSDORP00000006712  .........................V..NIK.........DY....DGW.............................
ENSDORP00000014166  .........................L..TSV.........DPv...RGK.............................
ENSDORP00000013444  .........................L..DEV.........DQ....DGN.............................
ENSDORP00000004275  .........................V..DLL.........TQv...DGV.............................
ENSDORP00000001355  .........................I..NKP.........DC....EGE.............................
ENSDORP00000013087  .........................V..NAA.........DS....DGW.............................
ENSDORP00000003943  .........................-..---.........--....---.............................
ENSDORP00000009340  .........................K..DAQ.........DG....REQ.............................
ENSDORP00000008149  .........................-..---.........--....---.............................
ENSDORP00000015559  .........................-..---.........--....---.............................
ENSDORP00000006156  .........................M..ASS.........LH....EDM.............................
ENSDORP00000002459  .........................V..NQR.........DS....LGR.............................
ENSDORP00000011514  .........................-..---.........--....---.............................
ENSDORP00000007506  .........................-..---.........--....---.............................
ENSDORP00000014195  .........................-..---.........--....---.............................
ENSDORP00000010305  .........................I..DQT.........DK....NGR.............................
ENSDORP00000011086  .........................I..HQR.........DE....TGW.............................
ENSDORP00000003906  .........................-..---.........--....---.............................
ENSDORP00000007061  .........................V..NAA.........-K....FHE.............................
ENSDORP00000008791  .........................-..---.........--....---.............................
ENSDORP00000011286  .........................-..---.........--....LGE.............................
ENSDORP00000010487  .........................-..---.........--....---.............................
ENSDORP00000001046  .........................T..DAP.........DAm...TGN.............................
ENSDORP00000013206  .........................-..---.........--....---.............................
ENSDORP00000000302  .........................V..NQA.........DS....AGR.............................
ENSDORP00000004396  .........................A..NFF.........HPe...KGT.............................
ENSDORP00000009263  .........................-..---.........--....---.............................
ENSDORP00000005406  .........................V..NR-.........-G....QRS.............................
ENSDORP00000011018  .........................Vl.NAM.........DD....YGN.............................
ENSDORP00000007862  .........................L..DAV.........EE....NGE.............................
ENSDORP00000005974  .........................P..LVR.........DKe...SGW.............................
ENSDORP00000015386  .........................I..DQQ.........WGp...FRN.............................
ENSDORP00000004934  .........................C..VSK.........TP....VGR.............................
ENSDORP00000007749  .........................V..DDE.........DSaclcFGM.............................
ENSDORP00000011209  .........................I..ESQ.........TK....DGL.............................
ENSDORP00000014950  .........................-..---.........--....---.............................
ENSDORP00000004508  .........................-..---.........--....---.............................
ENSDORP00000010830  .........................V..NVR.........DS....DDN.............................
ENSDORP00000008316  .........................A..NFF.........HPe...KGN.............................
ENSDORP00000011647  .........................L..NET.........SE....NGW.............................
ENSDORP00000001838  .........................M..EQK.........DY....DSR.............................
ENSDORP00000007356  .........................L..QAA.........DS....LGN.............................
ENSDORP00000007453  .........................-..-CS.........DF....NHG.............................
ENSDORP00000009265  .........................I..SAR.........DS....VGN.............................
ENSDORP00000006222  .........................X..NDQ.........DL....QGR.............................
ENSDORP00000010465  .........................M..EQR.........DY....DSR.............................
ENSDORP00000005903  .........................-..---.........--....---.............................
ENSDORP00000006810  .........................T..SVE.........DP....QLR.............................
ENSDORP00000000618  .........................V..NAR.........HK....LGW.............................
ENSDORP00000005027  .........................V..NET.........CGeg..DGR.............................
ENSDORP00000014908  .........................I..---.........--....---.............................
ENSDORP00000013576  .........................-..---.........--....---.............................
ENSDORP00000015191  .........................-..---.........--....---.............................
ENSDORP00000001718  .........................L..DIS.........NE....KGD.............................
ENSDORP00000004586  .........................V..SAT.........GS....GGF.............................
ENSDORP00000010461  .........................-..---.........--....---.............................
ENSDORP00000011519  .........................I..DAV.........DN....KKN.............................
ENSDORP00000010487  .........................-..---.........--....---.............................
ENSDORP00000015746  .........................V..NCS.........DQ....LGN.............................
ENSDORP00000008684  .........................-..---.........--....---.............................
ENSDORP00000001089  .........................-..---.........--....---.............................
ENSDORP00000007061  .........................V..NQV.........TV....DSI.............................
ENSDORP00000011837  .........................-..---.........--....---.............................
ENSDORP00000000883  .........................-..---.........--....---.............................
ENSDORP00000008319  .........................V..TKE.........NG....QGW.............................
ENSDORP00000011516  .........................P..NLL.........NG....QLS.............................
ENSDORP00000005420  .........................-..---.........--....---.............................
ENSDORP00000014434  .........................-..---.........--....---.............................
ENSDORP00000012876  .........................-..---.........--....---.............................
ENSDORP00000002492  .........................-..---.........--....---.............................
ENSDORP00000009438  .........................-..---.........--....---.............................
ENSDORP00000006616  .........................-..---.........--....---.............................
ENSDORP00000014346  .........................V..NVK.........DF....AXX.............................
ENSDORP00000005715  .........................-..---.........--....TGE.............................
ENSDORP00000007659  .........................V..NLA.........DR....NGN.............................
ENSDORP00000000137  .........................-..---.........--....---.............................
ENSDORP00000011634  .........................T..CVP.........EE....GGR.............................
ENSDORP00000007355  .........................I..NAV.........DI....MNR.............................
ENSDORP00000001096  .........................-..---.........--....--E.............................
ENSDORP00000007335  .........................-..---.........--....---.............................
ENSDORP00000001630  .........................V..NFQ.........DP....DGF.............................
ENSDORP00000010887  .........................V..NAT.........DK....WAF.............................
ENSDORP00000013121  .........................-..---.........--....---.............................
ENSDORP00000007683  .........................-..---.........--....---.............................
ENSDORP00000002834  .........................I..SIP.........DS....LGR.............................
ENSDORP00000014071  .........................-..---.........--....---.............................
ENSDORP00000000198  .........................-..---.........--....DGS.............................
ENSDORP00000006712  .........................-..---.........--....---.............................
ENSDORP00000009930  .........................-..---.........--....--E.............................
ENSDORP00000010221  .........................-..---.........--....---.............................


                            240                                                            250      
                              |                                                              |      
d1s70b_               ..TPLHAAAHWG.........KEE............................................ACRILVEN..
ENSDORP00000001438  ..SPLHLAVEAQ.........AAD............................................VLELLLRA..
ENSDORP00000003161  ..SPLHQAAQQG.........HTD............................................IVTLLLKN..
ENSDORP00000013687  ..SALQSAAWQG.........HVR............................................VCQLLIEH..
ENSDORP00000003291  ..TPLHQAAQQG.........HTH............................................IINVLLQN..
ENSDORP00000015829  ..SPLHLAVEAQ.........AAD............................................VLELLLRA..
ENSDORP00000006395  ..TALHVAAHCG.........HYR............................................VTKLLLDK..
ENSDORP00000006395  ..TPLIVACHYG.........NVK............................................MVNFLLKQ..
ENSDORP00000007897  ..TALHLAARHG.........HLA............................................TVKLLLEE..
ENSDORP00000012171  ..TPLHVAARYG.........HEL............................................LISTLMTN..
ENSDORP00000015191  ..TALHWSCNNG.........YLD............................................AIKLLLHY..
ENSDORP00000005511  ..TALRAAVELG.........SRE............................................MVRALCDR..
ENSDORP00000001089  ..TALTIAADKG.........HYK............................................FCELLINR..
ENSDORP00000001089  csTPLMEASQEG.........HLE............................................LVKYLLAA..
ENSDORP00000012094  ..TALHLAVDLQ.........NPD............................................LVSLLLKC..
ENSDORP00000003161  ..TPLHMAARAG.........HTE............................................VAKYLLQN..
ENSDORP00000008111  ..SALHSASGRG.........LLP............................................LVRTLVRS..
ENSDORP00000010887  ..TPLHEAASKN.........RVE............................................VCSLLLSH..
ENSDORP00000015756  ..TPLHVACKDG.........NVP............................................IVVALCEA..
ENSDORP00000003012  ..TPLHVACKDG.........NVP............................................IVVALCEA..
ENSDORP00000003803  ..TALHEAALYG.........KTE............................................VVRLLLEG..
ENSDORP00000012171  ..TALHLACSKG.........HEK............................................CALMILAE..
ENSDORP00000010887  ..VPLHNACSYG.........HYE............................................VAELLVRH..
ENSDORP00000010328  ..TPLHLAAGRG.........LRA............................................ISSTLCEA..
ENSDORP00000010714  ..TPLHIAARES.........YHD............................................CVLLFLSR..
ENSDORP00000005245  ..TPLMVAVLNN.........HEQ............................................LVQLLLDR..
ENSDORP00000012790  ..RALHWAAYMG.........HLD............................................VA--LINH..
ENSDORP00000001687  ..SALILACEKG.........SAE............................................VAELLLSH..
ENSDORP00000000524  ..TALHYAAKEG.........HTS............................................TLETLLSL..
ENSDORP00000002516  ..TLLHLAVNSNtpvddf...H-Tndvcsfpnal..................................VTKLLLDC..
ENSDORP00000007933  ..TPLHLSALRD.........DVL............................................CARMLYNY..
ENSDORP00000001938  ..TPLHAAAHWG.........VKE............................................ACSILAEA..
ENSDORP00000002146  ..EPLHAAAYWG.........QVH............................................LVELLVAL..
ENSDORP00000006986  ..TPLHIAAGRR.........STR............................................LAALLQAX..
ENSDORP00000013687  ..TALIAAAYMG.........HRE............................................IVEHLLDH..
ENSDORP00000011695  ..TALHWAVLAG.........NTT............................................VISLLLEA..
ENSDORP00000003709  ..TALHCALQGPaaalaqs..PEH............................................MVRALLNH..
ENSDORP00000012607  ..TPLHLAAGLG.........SPT............................................LTRLLLKA..
ENSDORP00000012790  ..TALHYAAASD.........IDRsktilgnghenseelersremkekeaal................CLEFLLQN..
ENSDORP00000001046  ..TALHLAAQQD.........LPT............................................VCSVLLEN..
ENSDORP00000012574  ..TPLHDAAENG.........QME............................................CCQTLLSH..
ENSDORP00000012710  ..TPLHLAVERG.........KVR............................................AIQFLLKS..
ENSDORP00000008802  ..TALMLACEIG.........SSH............................................TVEALIKK..
ENSDORP00000012790  ..TALMMAAENG.........QAG............................................AVDILVNSa.
ENSDORP00000000031  ..TPLHWAVASG.........NVN............................................AVDKLLEA..
ENSDORP00000013942  ..TPLHIAIRGR.........SRK............................................LAELLLRNpk
ENSDORP00000000883  ..TPLFIAAQEG.........HSE............................................CVELLLSS..
ENSDORP00000012440  ..TPLHWAAAAG.........KAE............................................CVRSLLEL..
ENSDORP00000010065  ..TPLHLACYNG.........KFE............................................VAKEIIQVtg
ENSDORP00000015111  ..TPLHDAAENG.........ELE............................................CCQILVVN..
ENSDORP00000014007  ..TALHVAAALN.........HKK............................................VVKILLEA..
ENSDORP00000008737  ..TPLHAAAQQS.........STE............................................VVNLLLEF..
ENSDORP00000010826  ..TPLFLAAREG.........SHE............................................TAKVLLDH..
ENSDORP00000003161  ..TPLHCAARNG.........HVR............................................ISEILLDH..
ENSDORP00000002055  ..TPLHFAAAST.........HGAl...........................................CLELLVGH..
ENSDORP00000011259  ..TPLMEAAAAG.........HEI............................................IVQYFLSH..
ENSDORP00000014237  ..TPLHEAASKN.........RVE............................................VCSLLLSY..
ENSDORP00000007536  ..SPLHVVARGS.........NDK............................................MACLLIDF..
ENSDORP00000004979  ..TPLHLAAKYG.........QTH............................................LVKLLLLH..
ENSDORP00000010830  ..TPLLSASVTG.........HTN............................................IVDFLTHH..
ENSDORP00000008769  ..TALHVAASLQyrvt.....QLD............................................AVRLLMRK..
ENSDORP00000009839  ..TPLHYAAMGG.........FAD............................................CCKYIAQR..
ENSDORP00000015161  ..TALHEAVRHG.........HYK............................................AMKLLLLY..
ENSDORP00000001718  ..TALHEAVIGN.........HVF............................................VVELLLLH..
ENSDORP00000002537  ..TALMIALSFE.........PTN............................................LVSLLLQQ..
ENSDORP00000001580  ..TALMQATYHG.........NKE............................................IVKYLLNQ..
ENSDORP00000009438  ..SILLEAARGG.........NPD............................................SVTLLLEY..
ENSDORP00000002055  ..TPLMMAAENG.........QTN............................................TVEMLVSSa.
ENSDORP00000015480  ..TALHWATEHN.........HQE............................................VVELLIKY..
ENSDORP00000012408  ..TPLHNACASG.........CGG............................................LAALLLSH..
ENSDORP00000002055  ..TPLHYAATSDt........DGK............................................CLEYLLRN..
ENSDORP00000013812  ..SPLHKAAWNC.........DHV............................................LMHMMLEA..
ENSDORP00000013528  ..TPLFLAAREG.........SYE............................................VVKLLLDH..
ENSDORP00000000083  ..TPLSWAAMKG.........NLE............................................SVSILLDY..
ENSDORP00000003321  ..TALHFAALHG.........QPD............................................CLKLLLKG..
ENSDORP00000011353  ..RPVHDAAREG.........FLD............................................TLVMLHRA..
ENSDORP00000007355  ..TPLHIAADLG.........NVE............................................AVEALLQA..
ENSDORP00000007546  ..TPLHAAAHWG.........VED............................................ACRLLAEH..
ENSDORP00000009016  ..SALHAAVLSG.........NIK............................................TVALLLEA..
ENSDORP00000011081  ..TALYFAVSNN.........DIH............................................CTEVLLAA..
ENSDORP00000011018  ..SPLILATASA.........SWN............................................IVNLLLSK..
ENSDORP00000003291  ..TPLHIAAHYG.........NIN............................................VATLLLNR..
ENSDORP00000008149  ..RPLDRAVGCR.........NTS............................................VVVTLLKK..
ENSDORP00000014950  ..----------.........---............................................--------..
ENSDORP00000012171  ..SPLHLAAYNG.........---............................................--------..
ENSDORP00000014237  ..TPLHEAAQKG.........RTQ............................................LCALLLAH..
ENSDORP00000007749  ..TPLHLAAEHA.........FQD............................................VAEMLLVA..
ENSDORP00000015309  ..TALHQACFGG.........REA............................................IINLLLEF..
ENSDORP00000007119  ..TALTWAARQG.........HKN............................................VILKLLEL..
ENSDORP00000011018  ..SFLHIALHNK.........RKE............................................VV------..
ENSDORP00000002435  ..TPLHLAMSND.........NLD............................................LVKALIVF..
ENSDORP00000014274  ..TALMCASEHG.........HVE............................................IVKLLLAQp.
ENSDORP00000004702  ..TAAHIAASKG.........FKN............................................CLEILCRHg.
ENSDORP00000013942  ..----------.........---............................................--------..
ENSDORP00000011332  ..TPLDLCVQGG.........YGE............................................TCEVLIQY..
ENSDORP00000014237  ..TPLHFAAGYN.........RVS............................................VVEYLLQH..
ENSDORP00000014578  ..LPLHLAAKEG.........HLP............................................VVEFLVKHt.
ENSDORP00000005457  ..TALH-ATEHH.........HRD............................................VVELLIKY..
ENSDORP00000015160  ..----------.........---............................................--------..
ENSDORP00000011906  ..----------.........---............................................--------..
ENSDORP00000012571  ..TPLHLAAGNRd........SKD............................................TLELLLMNr.
ENSDORP00000012644  ..LPIHLAVREG.........HSA............................................VVSFLAP-..
ENSDORP00000007538  ..TPLHAAAKQS.........NLE............................................IIYTLVDY..
ENSDORP00000009863  ..TPLLYAVHGN.........HVK............................................CVKMLLEN..
ENSDORP00000010305  ..TALTAAAGRG.........KLE............................................VCELLLEQ..
ENSDORP00000011587  ..TALMCASEYG.........RLD............................................TVRLLLAQp.
ENSDORP00000000485  ..-PLHYACFWG.........QDQ............................................VAEDLVAN..
ENSDORP00000014531  ..SPLHDAARNG.........HLD............................................IVKLLLSH..
ENSDORP00000012009  ..TPLLSAVYEG.........HVS............................................CVKLLLSK..
ENSDORP00000009257  ..----------.........---............................................--------..
ENSDORP00000008161  ..TVLHILILQP.........NKTfacq........................................MYNLLLSYd.
ENSDORP00000009839  ..----------.........---............................................--------..
ENSDORP00000001630  ..TALHEAALCG.........KTE............................................VVRLLLDS..
ENSDORP00000012903  ..LPVHLAAMEG.........HLH............................................CFKFLVSRms
ENSDORP00000010147  ..TPLHDALNCG.........HFE............................................VAELLIQR..
ENSDORP00000008900  ..TPLHLAACTN.........HVP............................................VITTLLRG..
ENSDORP00000004243  ..TPLHLAACDG.........MLT............................................CMKVLVQN..
ENSDORP00000008700  ..SALHEAALFG.........KVD............................................VVRVLLET..
ENSDORP00000008105  ..TVLHILILQP.........NKTfacq........................................MYNLLLSYd.
ENSDORP00000002464  ..ACVMDAVLRHgc.......EAA............................................FVSLLVEF..
ENSDORP00000008204  ..TPLHLAASNG.........HLH............................................CLSFLVSF..
ENSDORP00000001653  ..TALHYACKMK.........NQA............................................LIPLLLQA..
ENSDORP00000013463  ..----------.........---............................................--------..
ENSDORP00000013412  ..TALHYCCLTD.........NAE............................................CLKLLLRG..
ENSDORP00000007180  ..TPLHDAANNG.........HYK............................................VGELLLRY..
ENSDORP00000000309  ..NIIHLSVLTF.........HTE............................................ILKYIIEL..
ENSDORP00000008007  ..TPLHDAVING.........HHK............................................VAELLLLN..
ENSDORP00000010007  ..EPLHAAAFWG.........QMQ............................................MAELLVSH..
ENSDORP00000013572  ..TALHYAAACE.........FLD............................................IVELLLQS..
ENSDORP00000002756  ..TALHAAAWKG.........YAD............................................IVQLLLAK..
ENSDORP00000008159  ..TPLHYAASNG.........HAH............................................CVSFLINF..
ENSDORP00000013968  ..SPLHIAAREN.........RYD............................................CVVLFLSR..
ENSDORP00000010487  ..TALTLACFQG.........RTE............................................VVSLLLDR..
ENSDORP00000001351  ..TPLLYAVRGN.........HVK............................................CVEALLAR..
ENSDORP00000009580  ..----------.........---............................................--------..
ENSDORP00000006712  ..TPLHAAAHWG.........KEE............................................ACRILVDN..
ENSDORP00000014166  ..TSLEWAVLTD.........SFN............................................TVR-----..
ENSDORP00000013444  ..SAVHVASQHG.........YLG............................................CIQTLVEY..
ENSDORP00000004275  ..TPLHDALSNG.........HVE............................................IGKLLLQH..
ENSDORP00000001355  ..TPIHKAARSG.........SLE............................................CISTLVAN..
ENSDORP00000013087  ..TPLHCAASCN.........NVQ............................................VCKFLVES..
ENSDORP00000003943  ..----------.........---............................................--------..
ENSDORP00000009340  ..TPLFLAAREG.........AVE............................................VAQLLLGL..
ENSDORP00000008149  ..----------.........---............................................--------..
ENSDORP00000015559  ..----------.........---............................................--------..
ENSDORP00000006156  ..NCFSHSAAHG.........HRN............................................VLRKLL--..
ENSDORP00000002459  ..APLHHATLLG.........RTG............................................QVCLFLKR..
ENSDORP00000011514  ..----------.........---............................................--------..
ENSDORP00000007506  ..----------.........---............................................--------..
ENSDORP00000014195  ..----------.........---............................................--------..
ENSDORP00000010305  ..TPLDLAAFYG.........DAE............................................TVLYLVDK..
ENSDORP00000011086  ..TSLHMACSDG.........YPD............................................IARYLISL..
ENSDORP00000003906  ..----------.........---............................................--------..
ENSDORP00000007061  ..DALYHAAKVK.........NVD............................................LIEMLIEF..
ENSDORP00000008791  ..----------.........---............................................--------..
ENSDORP00000011286  ..TALHLAVRTAdht......SLH............................................LVD-----..
ENSDORP00000010487  ..----------.........---............................................--------..
ENSDORP00000001046  ..CLLQRAAGAG.........NEA............................................AALFLASN..
ENSDORP00000013206  ..----------.........---............................................--------..
ENSDORP00000000302  ..GPLHHATILG.........HTG............................................LACLFLKR..
ENSDORP00000004396  ..TPLHVAAKAG.........QTL............................................QAELLVVY..
ENSDORP00000009263  ..----------.........---............................................--------..
ENSDORP00000005406  ..SSLHYAXXXX.........XXX............................................XXXTLLRH..
ENSDORP00000011018  ..TPLHWAAENN.........QVG............................................SVKFLLCQ..
ENSDORP00000007862  ..TCLHQAAAMG.........QRT............................................ICHYIVEA..
ENSDORP00000005974  ..TALHRSIFYG.........HID............................................CAWSLLKH..
ENSDORP00000015386  ..TALHEATLLG.........LEE............................................SVTMLLGC..
ENSDORP00000004934  ..TPLHAAAAMG.........RTD............................................CVTQLVRH..
ENSDORP00000007749  ..NALLLSAWFG.........HLP............................................VLQVLVNA..
ENSDORP00000011209  ..TPLLLALKEN.........KQQ............................................MAEFLIEN..
ENSDORP00000014950  ..----------.........---............................................--------..
ENSDORP00000004508  ..----------.........---............................................--------..
ENSDORP00000010830  ..SPLHIAAINN.........HPD............................................IMNLLIKS..
ENSDORP00000008316  ..TPLHVASKAG.........QIL............................................QAELLAVY..
ENSDORP00000011647  ..TALMYAARNG.........HPD............................................VVQLLLEK..
ENSDORP00000001838  ..TALHVAAAEG.........HTE............................................VVKFLIEAc.
ENSDORP00000007356  ..TALHALVMIA.........DNSpensalvir...................................MYDGLLQL..
ENSDORP00000007453  ..SALHIAASNL.........CLG............................................AAKCLLEH..
ENSDORP00000009265  ..TVLHALVEVAdnttdntkfVTS............................................MYNEILIL..
ENSDORP00000006222  ..TALMLACEGA.........SPE............................................TVEVLLQG..
ENSDORP00000010465  ..TALHVAAAEG.........HVE............................................VVKFLLEAc.
ENSDORP00000005903  ..----------.........---............................................--------..
ENSDORP00000006810  ..SPLHLAAELA.........HVV............................................ITQLLLWY..
ENSDORP00000000618  ..TALMVAAISR.........NDS............................................VVQVLLAA..
ENSDORP00000005027  ..TALHLACRKG.........NVV............................................LAQLLIWY..
ENSDORP00000014908  ..----------.........---............................................--------..
ENSDORP00000013576  ..----------.........---............................................--------..
ENSDORP00000015191  ..----------.........---............................................--------..
ENSDORP00000001718  ..TPLHIAARWG.........YQG............................................IIETLLQN..
ENSDORP00000004586  ..TPLHLAALQG.........HDM............................................VIKVLVGAl.
ENSDORP00000010461  ..TPIILAAHCQ.........EYE............................................IVHILLRR..
ENSDORP00000011519  ..TPLHYAAASG.........MKA............................................CVELLVKH..
ENSDORP00000010487  ..----------.........---............................................--------..
ENSDORP00000015746  ..TPLHCAAYRA.........HKQ............................................CAIKLLKS..
ENSDORP00000008684  ..----------.........---............................................--------..
ENSDORP00000001089  ..----------.........---............................................--------..
ENSDORP00000007061  ..TPLHAASLQG.........QAR............................................CVQLLLAA..
ENSDORP00000011837  ..----------.........---............................................--------..
ENSDORP00000000883  ..----------.........---............................................--------..
ENSDORP00000008319  ..T---------.........---............................................--------..
ENSDORP00000011516  ..SPLHFAAGGG.........HAE............................................IVQILLNHp.
ENSDORP00000005420  ..----------.........---............................................--------..
ENSDORP00000014434  ..----------.........---............................................--------..
ENSDORP00000012876  ..----------.........---............................................--------..
ENSDORP00000002492  ..----------.........---............................................--------..
ENSDORP00000009438  ..----------.........---............................................--------..
ENSDORP00000006616  ..TALMVAAGRG.........FTS............................................QVEQLISM..
ENSDORP00000014346  ..X---------.........--XxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIVKLLLRH..
ENSDORP00000005715  ..TALHKAACQR.........NRA............................................VCQLLVDA..
ENSDORP00000007659  ..TALHYSVSHS.........NFA............................................IVKLLLDT..
ENSDORP00000000137  ..----------.........---............................................--------..
ENSDORP00000011634  ..TALHVAC---.........---............................................--------..
ENSDORP00000007355  ..TALHFAVGGN.........NLS............................................AVDFLLSH..
ENSDORP00000001096  ..TPLFLAAREG.........SYE............................................AAKILLDH..
ENSDORP00000007335  ..----------.........---............................................--------..
ENSDORP00000001630  ..SALHHAALNG.........NTE............................................LITLLLEA..
ENSDORP00000010887  ..TPLHEAAQKG.........-TQ............................................LCALLLAH..
ENSDORP00000013121  ..----------.........---............................................--------..
ENSDORP00000007683  ..----------.........---............................................--------..
ENSDORP00000002834  ..LPLGIARSRG.........HVK............................................LAECL---..
ENSDORP00000014071  ..-PVHDAVVND.........NLE............................................TIWLLLSY..
ENSDORP00000000198  ..TPVHAAAFSG.........NQW............................................ILSKLLDA..
ENSDORP00000006712  ..----------.........---............................................--------..
ENSDORP00000009930  ..TVLHLAVRWG.........LTK............................................LCRFLLCLpg
ENSDORP00000010221  ..----------.........-KD............................................ITWVMLEA..


                                       260                                              270         
                                         |                                                |         
d1s70b_               ..L..CD...ME.......AV..NK..V.................................GQ..TAFDVAD--....
ENSDORP00000001438  ..G..AD...PA.......AQ..MY..G.................................GR..TPLGSALLR....
ENSDORP00000003161  ..G..AS...PN.......EV..SS..N.................................GT..TPLAIAKRL....
ENSDORP00000013687  ..G..AQ...VD.......HT..CN..Q.................................GA..TALCIAAQE....
ENSDORP00000003291  ..N..AS...PN.......EL..TV..N.................................GN..TALAIARRL....
ENSDORP00000015829  ..G..AD...PA.......AQ..MY..G.................................GR..TPLGSALLR....
ENSDORP00000006395  ..R..AN...PN.......AR..AL..N.................................GF..TPLHIACKK....
ENSDORP00000006395  ..G..AN...VN.......AK..TK..N.................................GY..TPLHQAAQQ....
ENSDORP00000007897  ..K..AN...VL.......AR..GP..L.................................NQ..TALHLAAAH....
ENSDORP00000012171  ..G..AD...TA.......RR..GI..H.................................DM..FPLHLAVLF....
ENSDORP00000015191  ..A..AF...PN.......QMenNE..E.................................RY..TPLDYALLG....
ENSDORP00000005511  ..G..AS...VS.......C-..--..-.................................--..---------....
ENSDORP00000001089  ..G..AH...ID.......VR..NK..K.................................GN..TPLWLASNG....
ENSDORP00000001089  ..G..AN...VH.......AT..TA..T.................................GD..TALTYACEN....
ENSDORP00000012094  ..G..AD...VN.......RV..TY..Q.................................GY..SPYQLTWGR....
ENSDORP00000003161  ..K..AK...VN.......AK..AK..D.................................DQ..TPLHCAAIH....
ENSDORP00000008111  ..G..AD...SG.......LK..NC..H.................................ND..TPLMVARRH....
ENSDORP00000010887  ..G..AD...PT.......LV..NC..H.................................GK..SAVDMA---....
ENSDORP00000015756  ..G..CN...LD.......IS..NK..XxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxdGK..TAEDLAKSA....
ENSDORP00000003012  ..G..CN...LD.......IS..NK..XxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxdGK..TAEDLAKSA....
ENSDORP00000003803  ..G..VD...VN.......IR..NT..Y.................................NQ..TALDIV---....
ENSDORP00000012171  ..T..QDlglIN.......AT..NS..A.................................LQ..MPLHIAARN....
ENSDORP00000010887  ..G..AS...VN.......VA..DL..W.................................KF..TPLHEAAAK....
ENSDORP00000010328  ..G..AD...SL.......LL..NV..E.................................DE..TPQ------....
ENSDORP00000010714  ..G..AN...PE.......LR..NK..E.................................GD..TAWDL----....
ENSDORP00000005245  ..G..AD...PS.......VK..NE..F.................................GK..GVLEMARVF....
ENSDORP00000012790  ..G..AE...VT.......CK..DK..K.................................GY..TPLHAAASN....
ENSDORP00000001687  ..G..AD...AG.......AL..DS..L.................................GH..NALYYALQT....
ENSDORP00000000524  ..G..AD...IN.......AK..DE..R.................................NR..SALHLACAG....
ENSDORP00000002516  ..G..AE...VN.......AV..DN..E.................................GN..SALHIIVQY....
ENSDORP00000007933  ..G..AD...TN.......TR..NY..E.................................GQ..TPLAV----....
ENSDORP00000001938  ..L..CN...MD.......IR..NK..L.................................GQ..TPFDVA---....
ENSDORP00000002146  ..G..AD...LN.......GK..SL..L.................................DE..TPLDL----....
ENSDORP00000006986  ..X..AD...PL.......VE..NF..-.................................--..---------....
ENSDORP00000013687  ..G..AK...VD.......HE..DV..D.................................GR..TALSVAA--....
ENSDORP00000011695  ..G..AN...VD.......AQ..NI..K.................................GE..SALDLAKQR....
ENSDORP00000003709  ..G..A-...--.......--..--..-.................................--..---------....
ENSDORP00000012607  ..G..AD...IH.......AE..NE..E.................................P-..---------....
ENSDORP00000012790  ..D..AN...PS.......IQ..DK..E.................................GY..NSIHYAAAY....
ENSDORP00000001046  ..G..VD...FA.......AV..DE..N.................................GN..NALHLAVMH....
ENSDORP00000012574  ..R..VD...PS.......LR..DE..D.................................GY..TAADLAEYH....
ENSDORP00000012710  ..G..A-...--.......--..--..-.................................--..---------....
ENSDORP00000008802  ..G..AD...LN.......LV..DS..L.................................GH..NALHYSKLS....
ENSDORP00000012790  ..Q..AD...LT.......IK..DK..D.................................LN..TPLHLASSK....
ENSDORP00000000031  ..G..SS...LD.......IR..NV..K.................................GE..TPLDMALQN....
ENSDORP00000013942  .dG..RL...LY.......RP..NK..A.................................GE..TPYN-----....
ENSDORP00000000883  ..G..AD...PD.......LY..CN..E.................................DNwqLPIHAAAQM....
ENSDORP00000012440  ..G..MD...SN.......LR..DI..N.................................ES..TPLAYALYC....
ENSDORP00000010065  ..T..ES...LT.......KE..NI..F.................................SE..TAFHSACTYg...
ENSDORP00000015111  ..G..AE...LD.......VR..DR..D.................................GY..TAADLS---....
ENSDORP00000014007  ..G..AD...GT.......IV..NN..A.................................GQ..TPLETARYH....
ENSDORP00000008737  ..G..AD...IN.......AK..NT..E.................................LL..RPIDVATAN....
ENSDORP00000010826  ..F..AN...RD.......IT..DH..M.................................DR..LPRDIAQER....
ENSDORP00000003161  ..G..AP...IQ.......AK..TK..N.................................GL..SPIHMAA--....
ENSDORP00000002055  ..G..AD...VN.......MK..--..-.................................--..---------....
ENSDORP00000011259  ..G..VE...VD.......TR..DH..S.................................GA..TARMLARQY....
ENSDORP00000014237  ..G..AD...PT.......LL..NC..H.................................NK..SAIDLA---....
ENSDORP00000007536  ..G..AD...MH.......AK..DI..D.................................GK..RPVDL----....
ENSDORP00000004979  ..H..AN...PC.......LV..NC..N.................................EE..KPSDIAA--....
ENSDORP00000010830  ..-..--...--.......--..--..-.................................--..---------....
ENSDORP00000008769  ..G..AD...PS.......TR..NL..E.................................NE..QPVHL----....
ENSDORP00000009839  ..G..CD...LK.......WK..NL..E.................................HK..TPRAVAKDG....
ENSDORP00000015161  ..G..AK...LG.......VQ..NM..A.................................AL..TPVQL----....
ENSDORP00000001718  ..G..AS...VH.......IM..NK..R.................................QR..TAIDCAD--....
ENSDORP00000002537  ..G..VD...LS.......CQ..D-..-.................................--..---------....
ENSDORP00000001580  ..G..AD...VT.......LR..AK..N.................................GY..TAFDL----....
ENSDORP00000009438  ..G..AD...AN.......IP..KN..S.................................GH..LPIHVAADR....
ENSDORP00000002055  ..S..AD...LT.......LQ..DN..C.................................KN..TALHLACGK....
ENSDORP00000015480  ..G..AD...VH.......TQ..SK..F.................................CK..TAFDISIDN....
ENSDORP00000012408  ..G..AH...AG.......AR..NG..A.................................GH..TPMDCAL--....
ENSDORP00000002055  ..D..AN...PG.......IR..DK..Q.................................GY..NAVHYSAAY....
ENSDORP00000013812  ..G..AE...AN.......LM..DI..N.................................GC..AAIQYV---....
ENSDORP00000013528  ..F..AN...RE.......IT..DH..M.................................DR..LPRDVAHER....
ENSDORP00000000083  ..G..AE...VK.......VI..NL..K.................................GQ..TPI------....
ENSDORP00000003321  ..R..AP...VG.......TV..NE..A.................................GE..TALDIARKK....
ENSDORP00000011353  ..G..AR...LD.......VR..DA..W.................................GR..LPVDLAEER....
ENSDORP00000007355  ..G..CH...LK.......LT..DK..Q.................................GK..TALAVASRS....
ENSDORP00000007546  ..G..GG...MD.......SL..TH..A.................................GQ..RPCDLA---....
ENSDORP00000009016  ..G..AD...PA.......LR..NK..A.................................NE..LPAEL----....
ENSDORP00000011081  ..G..AD...PN.......--..-L..D.................................PL..NCLLVAVRA....
ENSDORP00000011018  ..G..AK...VD.......IK..DH..L.................................GR..NFLHLT---....
ENSDORP00000003291  ..A..AA...VD.......FT..AR..XxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxdGL..TPLHCGARS....
ENSDORP00000008149  ..G..AK...IG.......CQ..TLpsR.................................PR..GPATWAMAT....
ENSDORP00000014950  ..-..--...--.......--..--..-.................................--..---------....
ENSDORP00000012171  ..-..--...--.......--..--..-.................................--..---------....
ENSDORP00000014237  ..G..AD...PT.......LK..NQ..E.................................GQ..TPLDLV---....
ENSDORP00000007749  ..G..VD...LN.......LK..DK..Q.................................GK..TALAVAARS....
ENSDORP00000015309  ..E..AN...VN.......IL..TR..N.................................GE..SPVYV----....
ENSDORP00000007119  ..G..AN...KM.......LQ..TK..D.................................GR..TPSEIAKRN....
ENSDORP00000011018  ..-..--...--.......--..--..-.................................--..---------....
ENSDORP00000002435  ..G..AE...VD.......VP..ND..F.................................GE..TPALIAS--....
ENSDORP00000014274  ..G..CN...GH.......LE..DN..D.................................GS..TALSIALDA....
ENSDORP00000004702  ..G..LE...PE.......KR..DK..C.................................NR..TVHDVAT--....
ENSDORP00000013942  ..-..--...--.......--..--..-.................................--..---------....
ENSDORP00000011332  ..-..--...--.......--..--..-.................................--..---------....
ENSDORP00000014237  ..G..AD...VH.......AK..DK..-.................................--..---------....
ENSDORP00000014578  ..A..SH...VG.......HR..NH..K.................................GD..TAFDLARLY....
ENSDORP00000005457  ..G..AD...VH.......AF..SK..F.................................DK..SAFDIALEK....
ENSDORP00000015160  ..-..--...--.......--..--..-.................................--..---------....
ENSDORP00000011906  ..-..--...--.......--..--..-.................................--..---------....
ENSDORP00000012571  ..Y..IK...PG.......LR..NN..L.................................EE..TAFDIARR-....
ENSDORP00000012644  ..E..SD...LH.......HR..DA..R.................................GL..TPLELARQR....
ENSDORP00000007538  ..G..AN...LR.......LR..NA..Q.................................GK..IPLDLAAPK....
ENSDORP00000009863  ..G..AD...PT.......IE..TD..S.................................GY..NSMDLAVAL....
ENSDORP00000010305  ..G..AA...VS.......RT..NR..R.................................GV..PPLFCAARQ....
ENSDORP00000011587  ..G..CD...PA.......IL..DN..E.................................GT..SALAIALEA....
ENSDORP00000000485  ..G..AL...VS.......IC..NK..Y.................................GE..MPMDK----....
ENSDORP00000014531  ..G..AS...RS.......VV..NI..F.................................GL..RPVDC----....
ENSDORP00000012009  ..G..AD...KS.......VK..GP..D.................................GL..TALE-----....
ENSDORP00000009257  ..-..--...--.......--..--..-.................................--..---------....
ENSDORP00000008161  ..G..GD...HLqslel..VP..NH..Q.................................GL..TPFKLAGVE....
ENSDORP00000009839  ..-..--...--.......--..--..-.................................--..---------....
ENSDORP00000001630  ..G..IN...AQ.......VR..NT..Y.................................SQ..TALDIVHQFttsq
ENSDORP00000012903  seK..QA...LK.......AF..ND..N.................................GE..NVLDLAQRF....
ENSDORP00000010147  ..G..AS...VT.......LR..TK..K.................................GH..SPL------....
ENSDORP00000008900  ..G..AR...VD.......AL..DR..A.................................GR..TPLHLAKSK....
ENSDORP00000004243  ..G..AD...VH.......AR..DA..T.................................GC..KPIDYCKIW....
ENSDORP00000008700  ..G..ID...AN.......IK..DS..L.................................GR..TVLDILK--....
ENSDORP00000008105  ..G..GD...HLqslel..VP..NH..Q.................................GL..TPFKLAGVE....
ENSDORP00000002464  ..G..AN...LN.......LV..KW..-.................................--..---------....
ENSDORP00000008204  ..G..AN...IW.......CL..DN..D.................................YH..TPLDMAAMK....
ENSDORP00000001653  ..H..AD...PM.......IK..NK..E.................................GE..SSLDIVKKL....
ENSDORP00000013463  ..-..--...--.......--..--..-.................................--..---------....
ENSDORP00000013412  ..K..AS...IE.......--..--..-.................................--..---------....
ENSDORP00000007180  ..G..-N...PQ.......QS..NR..K.................................GE..TPL------....
ENSDORP00000000309  ..-..--...--.......--..--..-.................................--..---------....
ENSDORP00000008007  ..G..AD...PL.......FR..SD..N.................................GK..CPWDEAKDS....
ENSDORP00000010007  ..G..AS...LS.......AR..TS..M.................................DE..MPIDLCEE-....
ENSDORP00000013572  ..G..AD...PT.......LR..DQ..D.................................GC..LP-------....
ENSDORP00000002756  ..G..AR...TD.......LR..NN..E.................................KK..LALDMAT--....
ENSDORP00000008159  ..G..AN...IF.......AL..DN..D.................................LQ..SPLDAAASR....
ENSDORP00000013968  ..D..SD...VT.......LK..NK..E.................................GE..TPLQCASLN....
ENSDORP00000010487  ..K..AN...VE.......H-..--..-.................................--..---------....
ENSDORP00000001351  ..G..AD...LT.......TE..AD..S.................................GY..TPMDLAVAL....
ENSDORP00000009580  ..-..--...--.......--..--..-.................................--..---------....
ENSDORP00000006712  ..L..CD...ME.......MV..NK..-.................................--..---------....
ENSDORP00000014166  ..-..--...--.......--..--..-.................................--..---------....
ENSDORP00000013444  ..G..AN...VT.......MQ..NH..A.................................GE..KPSQSAERH....
ENSDORP00000004275  ..GgaVL...LQ.......QR..DS..K.................................GE..LPLDY----....
ENSDORP00000001355  ..G..AQ...AD.......LR..NA..S.................................GL..TAADIAQTQ....
ENSDORP00000013087  ..G..AA...VF.......AM..TY..S.................................DMq.TAAD-----....
ENSDORP00000003943  ..-..--...--.......--..--..-.................................--..---------....
ENSDORP00000009340  ..G..AA...RG.......LR..DQ..A.................................GL..APADIARQR....
ENSDORP00000008149  ..-..--...--.......--..--..-.................................--..---------....
ENSDORP00000015559  ..-..--...--.......--..--..-.................................--..---------....
ENSDORP00000006156  ..-..--...--.......--..--..-.................................--..---------....
ENSDORP00000002459  ..G..AD...LH.......AV..DQ..E.................................QQ..DPLSIAVQV....
ENSDORP00000011514  ..-..--...--.......--..--..-.................................--..---------....
ENSDORP00000007506  ..-..--...--.......--..--..-.................................--..---------....
ENSDORP00000014195  ..-..--...--.......--..--..-.................................--..---------....
ENSDORP00000010305  ..G..AV...IE.......HV..DH..S.................................GM..RPLDRAIGC....
ENSDORP00000011086  ..G..AD...RA.......AA..ND..D.................................GA..LPS------....
ENSDORP00000003906  ..-..--...--.......--..--..-.................................--..---------....
ENSDORP00000007061  ..G..SN...IY.......AR..DN..R.................................GK..KPSDY----....
ENSDORP00000008791  ..-..--...--.......--..--..-.................................--..---------....
ENSDORP00000011286  ..-..--...--.......--..--..-.................................--..---------....
ENSDORP00000010487  ..-..--...--.......--..--..-.................................--..---------....
ENSDORP00000001046  ..G..AH...VN.......HR..NK..-.................................--..---------....
ENSDORP00000013206  ..-..--...--.......--..--..-.................................--..---------....
ENSDORP00000000302  ..G..AD...LG.......AQ..DS..E.................................GR..DALTIAMET....
ENSDORP00000004396  ..G..AD...PG.......SP..DV..N.................................GR..TPIDYARQA....
ENSDORP00000009263  ..-..--...--.......--..--..-.................................--..---------....
ENSDORP00000005406  ..G..AN...PD.......LR..DE..D.................................GK..TPLDKARER....
ENSDORP00000011018  ..G..AN...PN.......LR..NS..N.................................MM..APLHIAVQG....
ENSDORP00000007862  ..G..AS...LM.......KT..DQ..Q.................................GD..TPRQRAEKA....
ENSDORP00000005974  ..G..VS...LY.......MQ..DK..E.................................GL..SPLDLL---....
ENSDORP00000015386  ..N..AS...IQ.......KK..NA..R.................................GQ..TAYDVALEI....
ENSDORP00000004934  ..G..AS...IH.......ER..DA..H.................................GE..SPIGMARRL....
ENSDORP00000007749  ..G..AK...IH.......CE..N-..-.................................--..---------....
ENSDORP00000011209  ..K..AN...IH.......AV..D-..-.................................--..---------....
ENSDORP00000014950  ..-..--...--.......--..--..-.................................--..---------....
ENSDORP00000004508  ..-..--...--.......--..--..-.................................--..---------....
ENSDORP00000010830  ..G..AH...FD.......AT..NL..H.................................KQ..TASDL----....
ENSDORP00000008316  ..G..AD...PG.......TQ..DS..S.................................GK..TPVDYARQG....
ENSDORP00000011647  ..G..CD...RS.......IV..NK..S.................................RQ..TALDIATFW....
ENSDORP00000001838  ..K..VN...PF.......AK..DR..W.................................GN..IPLDDAVQF....
ENSDORP00000007356  ..G..AR...LCptvqledIH..NL..Q.................................GL..TPLKLAAKE....
ENSDORP00000007453  ..G..AN...PA.......LR..NR..K.................................GQ..VP-------....
ENSDORP00000009265  ..G..AK...LHptlkleeLT..NK..K.................................GL..TPLTLAASS....
ENSDORP00000006222  ..G..AQ...TG.......IT..DA..L.................................GQ..DAAHYGARV....
ENSDORP00000010465  ..K..VN...PF.......PK..DR..W.................................NN..TPMDEALHF....
ENSDORP00000005903  ..-..--...--.......--..--..-.................................--..---------....
ENSDORP00000006810  ..G..AD...VA.......AR..DA..Q.................................GR..TALFYARQA....
ENSDORP00000000618  ..G..AD...PN.......LG..--..-.................................--..---------....
ENSDORP00000005027  ..G..VD...VM.......AR..DA..H.................................GN..TALAYARQA....
ENSDORP00000014908  ..-..--...-E.......--..--..-.................................--..---------....
ENSDORP00000013576  ..-..--...--.......--..--..-.................................--..---------....
ENSDORP00000015191  ..-..--...--.......--..--..-.................................--..---------....
ENSDORP00000001718  ..G..AP...TD.......VQ..NR..M.................................KE..TPLQCA---....
ENSDORP00000004586  ..G..AD...PT.......RR..DH..S.................................GH..RACHY----....
ENSDORP00000010461  ..G..AR...IE.......--..--..-.................................--..---------....
ENSDORP00000011519  ..G..GD...LF.......AE..NE..N.................................KD..TPCDCAEKQ....
ENSDORP00000010487  ..-..--...--.......--..--..-.................................--..---------....
ENSDORP00000015746  ..G..AD...PN.......LR..NK..N.................................DQ..KPLDLAQ--....
ENSDORP00000008684  ..-..--...--.......--..--..-.................................--..---------....
ENSDORP00000001089  ..-..--...--.......--..--..-.................................--..---------....
ENSDORP00000007061  ..G..A-...--.......--..--..-.................................--..---------....
ENSDORP00000011837  ..-..--...--.......--..--..-.................................--..---------....
ENSDORP00000000883  ..-..--...--.......--..--..-.................................--..---------....
ENSDORP00000008319  ..-..--...--.......--..--..-.................................--..---------....
ENSDORP00000011516  ..E..VD...RH.......IT..DQ..Q.................................GR..SPLNICEENkqn.
ENSDORP00000005420  ..-..--...MG.......IK..NK..D.................................GE..TP-------....
ENSDORP00000014434  ..-..--...--.......--..--..-.................................--..---------....
ENSDORP00000012876  ..-..--...--.......--..--..-.................................--..---------....
ENSDORP00000002492  ..-..--...--.......--..--..-.................................--..---------....
ENSDORP00000009438  ..-..--...--.......--..--..-.................................--..---------....
ENSDORP00000006616  ..G..AN...VH.......SK..AS..N.................................GW..MALDWAKHF....
ENSDORP00000014346  ..G..GD...PF.......QA..NK..H.................................GE..RPVDVA---....
ENSDORP00000005715  ..G..AS...LR.......KT..DS..K.................................GK..TPQDRAQQA....
ENSDORP00000007659  ..Gv.CN...VD.......HQ..NK..A.................................GY..TAVMI----....
ENSDORP00000000137  ..-..--...--.......--..--..-.................................--..---------....
ENSDORP00000011634  ..-..--...--.......--..--..-.................................--..---------....
ENSDORP00000007355  ..K..AR...VD.......VA..D-..-.................................--..---------....
ENSDORP00000001096  ..F..AN...RD.......IT..DH..M.................................DR..LPRDVARDR....
ENSDORP00000007335  ..-..--...--.......--..--..-.................................--..---------....
ENSDORP00000001630  ..Q..AA...VD.......IK..DN..-.................................--..---------....
ENSDORP00000010887  ..G..AD...PT.......M-..--..-.................................--..---------....
ENSDORP00000013121  ..-..--...--.......--..--..-.................................--..---------....
ENSDORP00000007683  ..-..--...--.......--..--..-.................................--..---------....
ENSDORP00000002834  ..-..--...--.......--..--..-.................................--..---------....
ENSDORP00000014071  ..G..AD...PT.......LA..TY..S.................................GQ..TAMKLA---....
ENSDORP00000000198  ..G..GD...LR.......LH..DE..K.................................GR..NPQTWALS-....
ENSDORP00000006712  ..-..--...--.......--..--..-.................................--..---------....
ENSDORP00000009930  ..G..VQa..LA.......LP..NE..E.................................GA..TPLDLASHG....
ENSDORP00000010221  ..G..AE...TD.......VV..NS..V.................................GR..TAAQMAAFV....


                        280       290                                                  
                          |         |                                                  
d1s70b_               ----------------edilgyleelqkkqnllh...............................
ENSDORP00000001438  PNASLASLLRAHGA--pepededdk........................................
ENSDORP00000003161  GYISVTDV--------lkvvtdetsvvlvsdkhrmsype..........................
ENSDORP00000013687  GHVDVVQVLLEHAAD-pnhadqfgrtamrvaaknghsqiikllek....................
ENSDORP00000003291  GYISVVD---------tlkvvteetit......................................
ENSDORP00000015829  PNASLASLLRAHGA--pepededdk........................................
ENSDORP00000006395  NRIKVMELLVKYGAS-iqait............................................
ENSDORP00000006395  GHTHIINVLLQHGAK-pnatt............................................