SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Ankyrin repeat alignments in Tetraodon nigroviridis 76_8

These alignments are sequences aligned to the 0049331 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1s70b_               mkmada........................................................................
ENSTNIP00000018931  ltplhvasfmghlnivkillqkgaspsasnvaqkvetplhmasraghyevaefllqnaapvdakakddqt........
ENSTNIP00000004671  ltplhvaafmghlnivktllqrgaspnasnvkvetplhmasraghcevaqfllqntaqvdakakddqt..........
ENSTNIP00000008004  ltplhvaafmghlnivktllqrgaspnasnvkvetplhmasraghcevaqfllqntaqvdakakddqt..........
ENSTNIP00000017432  lt............................................................................
ENSTNIP00000020962  ltpihvaafmghlsivllllqngaspdirnirgetalhmaaragqmevvrcllrngalvdamaredqt..........
ENSTNIP00000020961  ltpihvaafmghlsivllllqngaspdirnirgetalhmaaragqmevvrcllrngalvdamaredqt..........
ENSTNIP00000020964  ltpihvaafmghlsivllllqngaspdirnirgetalhmaaragqmevvrcllrngalvdamaredqt..........
ENSTNIP00000020160  lt............................................................................
ENSTNIP00000022654  lt............................................................................
ENSTNIP00000007965  ltpihvaafmghlnivllllqsgaspdvsnirgetalhmaaragqvevvtllrngamvdarareeqt...........
ENSTNIP00000020160  atvdaatkkgnt..................................................................
ENSTNIP00000022654  atvdaatkkgnt..................................................................
ENSTNIP00000004254  pliqaifsgdpegdtllwcnpddvsvkdaekrtplhaaaflgdaeiaellilsgarvnakdsmwlt............
ENSTNIP00000015489  plvqaifnrnaeevqlllhkkedvnaldqerrt.............................................
ENSTNIP00000009879  tpldhtaksghekmvslllskganvnandkkerk............................................
ENSTNIP00000007449  hldrfkevdgrsdngqt.............................................................
ENSTNIP00000005052  hldrfkevdgrsdngqt.............................................................
ENSTNIP00000001326  hldrfkevdgrsdngqt.............................................................
ENSTNIP00000020926  llraifnvdpdevrslilkkedvnvqdnekrtplhaaaylgdwailtptlrlkesrgarvnakdnkwlt.........
ENSTNIP00000022840  hldrfkevdgrsdngqt.............................................................
ENSTNIP00000004030  nlaavkahldkfrdvdsrsdngqt......................................................
ENSTNIP00000020447  nlaavkahldkfrdvdsrsdngqt......................................................
ENSTNIP00000002067  dnlaavkahldkfrdvdsrsdngqt.....................................................
ENSTNIP00000003481  dnlaavkahldkfrdvdsrsdngqt.....................................................
ENSTNIP00000001972  ..............................................................................
ENSTNIP00000001668  dnlaavkahldkfrdvdsrsdngqt.....................................................
ENSTNIP00000000101  egt...........................................................................
ENSTNIP00000000847  elllthgahiniqskdrkt...........................................................
ENSTNIP00000021608  llkaifnvdpdevrslifkkedvnaqdnekrt..............................................
ENSTNIP00000011850  sa............................................................................
ENSTNIP00000011850  snhdt.........................................................................
ENSTNIP00000010597  ..............................................................................
ENSTNIP00000018931  tkgkvrlp......................................................................
ENSTNIP00000021608  srhgalclellvcngadvnikskdgkt...................................................
ENSTNIP00000021608  vs............................................................................
ENSTNIP00000004671  tkgkvrlp......................................................................
ENSTNIP00000008004  tkgkvrlp......................................................................
ENSTNIP00000000651  lcvhs.........................................................................
ENSTNIP00000017452  lcvhs.........................................................................
ENSTNIP00000020962  hdtkgkvrlp....................................................................
ENSTNIP00000020961  hdtkgkvrlp....................................................................
ENSTNIP00000019592  nvkvsrllmlaganvnyrtevlnnapv...................................................
ENSTNIP00000007965  ..............................................................................
ENSTNIP00000018708  sydvnqpnkhgip.................................................................
ENSTNIP00000011422  llldggdsl.....................................................................
ENSTNIP00000017008  v.............................................................................
ENSTNIP00000020964  dtkgkvrlp.....................................................................
ENSTNIP00000012589  ..............................................................................
ENSTNIP00000007468  aihqaawygqdkclrvllsaqpgminkkterget............................................
ENSTNIP00000015489  ehvl..........................................................................
ENSTNIP00000020926  t.............................................................................
ENSTNIP00000016214  eavqqilsenvpvrnsdvdyr.........................................................
ENSTNIP00000016215  avqqilsenvpvrnsdvdyr..........................................................
ENSTNIP00000020449  dttsrlhtlcdavkardifsliqvyaegvdlmepiplangh.....................................
ENSTNIP00000000938  dttsrlhtlcdavkardifsliqvyaegvdlmepiplangh.....................................
ENSTNIP00000000106  dttsrlhtlcdavkardifsliqvyaegvdlmepiplangh.....................................
ENSTNIP00000011013  hinyldkskss...................................................................
ENSTNIP00000022975  lq............................................................................
ENSTNIP00000001836  e.............................................................................
ENSTNIP00000005054  daasrrqllyeavrkrdvlsliqvyfegldlmdtcpqpneh.....................................
ENSTNIP00000000636  daasrrqllyeavrkrdvlsliqvyfegldlmdtcpqpneh.....................................
ENSTNIP00000022060  f.............................................................................
ENSTNIP00000017877  ..............................................................................
ENSTNIP00000013825  vie...........................................................................
ENSTNIP00000007887  q.............................................................................
ENSTNIP00000006529  d.............................................................................
ENSTNIP00000013614  nlsyrtekglsllhlcc.............................................................
ENSTNIP00000012342  avh...........................................................................
ENSTNIP00000010055  h.............................................................................
ENSTNIP00000002777  a.............................................................................
ENSTNIP00000015489  t.............................................................................
ENSTNIP00000001972  daadsqgqt.....................................................................
ENSTNIP00000004254  aadsqgqt......................................................................
ENSTNIP00000020780  na............................................................................
ENSTNIP00000020505  ..............................................................................
ENSTNIP00000019489  ..............................................................................
ENSTNIP00000001972  qp............................................................................
ENSTNIP00000022060  ..............................................................................
ENSTNIP00000020274  aaakmielfeavqsrdllaliqvyaegvelmeplpea.........................................
ENSTNIP00000011600  vdctdeegnt....................................................................
ENSTNIP00000020643  lrhadsrgws....................................................................
ENSTNIP00000008767  dttsrlhtlcdavkardifsliqvyaegvdlmepiplangh.....................................
ENSTNIP00000008004  f.............................................................................
ENSTNIP00000020403  reeadpsr......................................................................
ENSTNIP00000005775  ktngat........................................................................
ENSTNIP00000016350  ..............................................................................
ENSTNIP00000006475  q.............................................................................
ENSTNIP00000004288  fpdavt........................................................................
ENSTNIP00000007797  shvddyst......................................................................
ENSTNIP00000010973  fpdavt........................................................................
ENSTNIP00000009851  arsanslqqdhkkhvsfa............................................................
ENSTNIP00000003355  l.............................................................................
ENSTNIP00000013324  ..............................................................................
ENSTNIP00000002256  gwi...........................................................................
ENSTNIP00000015625  kqkr..........................................................................
ENSTNIP00000001122  v.............................................................................
ENSTNIP00000016215  ..............................................................................
ENSTNIP00000000847  dkps..........................................................................
ENSTNIP00000000101  gysa..........................................................................
ENSTNIP00000019171  v.............................................................................
ENSTNIP00000003589  v.............................................................................
ENSTNIP00000021546  v.............................................................................
ENSTNIP00000016214  ..............................................................................
ENSTNIP00000008096  ae............................................................................
ENSTNIP00000021658  rerdsrgrl.....................................................................
ENSTNIP00000009879  dc............................................................................
ENSTNIP00000009476  i.............................................................................
ENSTNIP00000020961  f.............................................................................
ENSTNIP00000014947  elltaktltgdvkdalgat...........................................................
ENSTNIP00000020962  f.............................................................................
ENSTNIP00000003486  vqs...........................................................................
ENSTNIP00000002157  vqs...........................................................................
ENSTNIP00000022028  vqs...........................................................................
ENSTNIP00000009270  ..............................................................................
ENSTNIP00000009271  ..............................................................................
ENSTNIP00000005251  ..............................................................................
ENSTNIP00000005250  ..............................................................................
ENSTNIP00000002767  vqs...........................................................................
ENSTNIP00000005249  ..............................................................................
ENSTNIP00000017214  ytlmp.........................................................................
ENSTNIP00000018491  ..............................................................................
ENSTNIP00000001443  ddr...........................................................................
ENSTNIP00000012425  ddr...........................................................................
ENSTNIP00000000418  r.............................................................................
ENSTNIP00000011989  nknde.........................................................................
ENSTNIP00000019096  t.............................................................................
ENSTNIP00000022908  k.............................................................................
ENSTNIP00000021546  dsqgat........................................................................
ENSTNIP00000001350  c.............................................................................
ENSTNIP00000022034  nv............................................................................
ENSTNIP00000003225  c.............................................................................
ENSTNIP00000004105  c.............................................................................
ENSTNIP00000010006  c.............................................................................
ENSTNIP00000014371  nv............................................................................
ENSTNIP00000017023  kvn...........................................................................
ENSTNIP00000015550  sgissghgasshplssllsiw.........................................................
ENSTNIP00000004821  sgissghgasshplssllsiw.........................................................
ENSTNIP00000018664  m.............................................................................
ENSTNIP00000020926  did...........................................................................
ENSTNIP00000011335  n.............................................................................
ENSTNIP00000004556  swdi..........................................................................
ENSTNIP00000013317  aveqgevlllsqllqqsgafqqrdgrgwlplhraavqpvpevlrtvlrsatqrrsleertaages.............
ENSTNIP00000009417  lds...........................................................................
ENSTNIP00000021733  m.............................................................................
ENSTNIP00000003914  ldsd..........................................................................
ENSTNIP00000022373  lltepk........................................................................
ENSTNIP00000011405  deea..........................................................................
ENSTNIP00000016960  nslmsda.......................................................................
ENSTNIP00000007293  ..............................................................................
ENSTNIP00000008146  ..............................................................................
ENSTNIP00000016915  slma..........................................................................
ENSTNIP00000020652  fl............................................................................
ENSTNIP00000020964  sd............................................................................
ENSTNIP00000015802  ..............................................................................
ENSTNIP00000011405  ..............................................................................
ENSTNIP00000002262  sg............................................................................
ENSTNIP00000019154  sg............................................................................
ENSTNIP00000015812  ey............................................................................
ENSTNIP00000018163  aairsfph......................................................................
ENSTNIP00000006897  mygdmkgvytvlkdpgmvnalletvkeemvwtqrw...........................................
ENSTNIP00000011305  v.............................................................................
ENSTNIP00000016930  qd............................................................................
ENSTNIP00000019629  r.............................................................................
ENSTNIP00000000664  iqd...........................................................................
ENSTNIP00000005820  gpy...........................................................................
ENSTNIP00000005228  f.............................................................................
ENSTNIP00000007470  kr............................................................................
ENSTNIP00000011306  v.............................................................................
ENSTNIP00000004387  kswam.........................................................................
ENSTNIP00000000847  thl...........................................................................
ENSTNIP00000001107  vm............................................................................
ENSTNIP00000021112  mdyiq.........................................................................
ENSTNIP00000017960  mdyiq.........................................................................
ENSTNIP00000005432  nlkrf.........................................................................
ENSTNIP00000000101  l.............................................................................
ENSTNIP00000013166  ..............................................................................
ENSTNIP00000002306  f.............................................................................
ENSTNIP00000018558  vdq...........................................................................
ENSTNIP00000001438  dvm...........................................................................
ENSTNIP00000021633  e.............................................................................
ENSTNIP00000022373  fv............................................................................
ENSTNIP00000011850  s.............................................................................
ENSTNIP00000008855  q.............................................................................
ENSTNIP00000007188  agk...........................................................................
ENSTNIP00000004671  ast...........................................................................
ENSTNIP00000004034  vm............................................................................
ENSTNIP00000018931  flr...........................................................................
ENSTNIP00000010671  afl...........................................................................
ENSTNIP00000013098  hv............................................................................
ENSTNIP00000016922  rf............................................................................
ENSTNIP00000021111  kkfm..........................................................................
ENSTNIP00000003381  a.............................................................................
ENSTNIP00000020505  a.............................................................................
ENSTNIP00000018712  a.............................................................................
ENSTNIP00000021261  v.............................................................................
ENSTNIP00000022919  v.............................................................................
ENSTNIP00000010298  a.............................................................................
ENSTNIP00000019340  qc............................................................................
ENSTNIP00000019537  il............................................................................
ENSTNIP00000012849  qcreg.........................................................................
ENSTNIP00000021203  ledel.........................................................................
ENSTNIP00000016430  llvhslsihqlaaqgemvflasrieqenv.................................................
ENSTNIP00000021749  llefv.........................................................................
ENSTNIP00000003121  qli...........................................................................
ENSTNIP00000018281  qli...........................................................................
ENSTNIP00000002757  k.............................................................................
ENSTNIP00000017905  k.............................................................................
ENSTNIP00000016177  vifadgsl......................................................................
ENSTNIP00000004254  ..............................................................................
ENSTNIP00000004505  hrsvsel.......................................................................
ENSTNIP00000007098  qsswd.........................................................................
ENSTNIP00000018860  a.............................................................................
ENSTNIP00000018861  a.............................................................................
ENSTNIP00000011013  ts............................................................................
ENSTNIP00000004254  l.............................................................................
ENSTNIP00000018753  lr............................................................................
ENSTNIP00000003344  ..............................................................................
ENSTNIP00000011405  q.............................................................................
ENSTNIP00000017191  li............................................................................
ENSTNIP00000020431  rw............................................................................
ENSTNIP00000011744  leqddmr.......................................................................
ENSTNIP00000014438  gi............................................................................
ENSTNIP00000022060  qtn...........................................................................
ENSTNIP00000005333  sa............................................................................
ENSTNIP00000014824  ..............................................................................
ENSTNIP00000009879  fncleevesni...................................................................
ENSTNIP00000001972  ..............................................................................
ENSTNIP00000008197  q.............................................................................
ENSTNIP00000008859  f.............................................................................
ENSTNIP00000001888  na............................................................................
ENSTNIP00000008457  f.............................................................................
ENSTNIP00000019974  na............................................................................
ENSTNIP00000016215  infkhph.......................................................................
ENSTNIP00000012669  ..............................................................................
ENSTNIP00000014343  dhn...........................................................................
ENSTNIP00000009374  ptplhthptrqippevrrlivnk.......................................................
ENSTNIP00000013843  v.............................................................................
ENSTNIP00000019152  itr...........................................................................
ENSTNIP00000019800  ..............................................................................
ENSTNIP00000011128  wws...........................................................................
ENSTNIP00000016214  th............................................................................
ENSTNIP00000003581  tplhthptrqippevrrlivnk........................................................
ENSTNIP00000009375  tplhthptrqippevrrlivnk........................................................
ENSTNIP00000019856  nleli.........................................................................
ENSTNIP00000017493  ..............................................................................
ENSTNIP00000004637  is............................................................................
ENSTNIP00000000199  nq............................................................................
ENSTNIP00000014598  lldviat.......................................................................
ENSTNIP00000022443  ns............................................................................
ENSTNIP00000021145  tr............................................................................
ENSTNIP00000016530  p.............................................................................
ENSTNIP00000001856  lldssle.......................................................................
ENSTNIP00000003340  lldssle.......................................................................
ENSTNIP00000003075  lldssle.......................................................................
ENSTNIP00000011507  lldssle.......................................................................
ENSTNIP00000021687  nnnslcpyhlskmsaffnpmshllslqfwyiisit...........................................
ENSTNIP00000004278  lywasfarsl....................................................................
ENSTNIP00000018637  lywasfarsl....................................................................
ENSTNIP00000011193  s.............................................................................
ENSTNIP00000015635  c.............................................................................
ENSTNIP00000006573  l.............................................................................
ENSTNIP00000005633  lll...........................................................................
ENSTNIP00000005157  hrql..........................................................................
ENSTNIP00000019463  ll............................................................................
ENSTNIP00000015383  l.............................................................................
ENSTNIP00000017006  grgalpwaefthrlevspfllrrndgsrmlkhasfrewlmwreegqddrflcdprsghtlmafwlcrqegklnrqqvl
ENSTNIP00000004078  lll...........................................................................
ENSTNIP00000007396  lll...........................................................................
ENSTNIP00000018125  k.............................................................................
ENSTNIP00000013051  lly...........................................................................
ENSTNIP00000002932  lly...........................................................................
ENSTNIP00000005133  l.............................................................................
ENSTNIP00000018052  regg..........................................................................
ENSTNIP00000002528  vrrgdmeqigrfmr................................................................
ENSTNIP00000017494  q.............................................................................
ENSTNIP00000020678  gsdlqytnrvdkviinpyfglgapdytkiqipkrdkwqhnpncvnedkdrqw..........................
ENSTNIP00000002762  lnlack........................................................................
ENSTNIP00000017148  yvrhgelerigrfir...............................................................
ENSTNIP00000022679  ..............................................................................
ENSTNIP00000016402  ya............................................................................
ENSTNIP00000014119  l.............................................................................
ENSTNIP00000005520  e.............................................................................
ENSTNIP00000009225  elapg.........................................................................
ENSTNIP00000000650  elapg.........................................................................
ENSTNIP00000016194  vfq...........................................................................
ENSTNIP00000023095  p.............................................................................
ENSTNIP00000019373  al............................................................................
ENSTNIP00000007443  hisivkhlrhsgwppallqmvqtlasngansiwehslldpaqvqsgrrkpnpqnkvhptksefirakyqmlafvhklp
ENSTNIP00000012036  k.............................................................................
ENSTNIP00000002856  eq............................................................................
ENSTNIP00000011373  ysitrl........................................................................
ENSTNIP00000017385  allrt.........................................................................
ENSTNIP00000016007  ..............................................................................
ENSTNIP00000018968  asdlsrq.......................................................................
ENSTNIP00000016756  yaelincik.....................................................................
ENSTNIP00000022850  k.............................................................................
ENSTNIP00000011921  skq...........................................................................
ENSTNIP00000015620  p.............................................................................
ENSTNIP00000015621  p.............................................................................
ENSTNIP00000018971  lntpfrdvy.....................................................................
ENSTNIP00000019525  m.............................................................................
ENSTNIP00000017519  eqivnflkenggkvtnmdlierfktalpdeperkaaarlhfktcvnsvafvrpedgvkyvclrkkyakerenspesge
ENSTNIP00000002927  mlcasdgewsslqrllgaepslil......................................................
ENSTNIP00000007442  rypvh.........................................................................
ENSTNIP00000018523  ..............................................................................
ENSTNIP00000018573  ifdy..........................................................................
ENSTNIP00000018967  rakf..........................................................................
ENSTNIP00000009206  ltspeftd......................................................................
ENSTNIP00000011337  ll............................................................................
ENSTNIP00000011338  ll............................................................................
ENSTNIP00000013404  p.............................................................................
ENSTNIP00000020298  ..............................................................................
ENSTNIP00000011339  ll............................................................................
ENSTNIP00000022519  dt............................................................................
ENSTNIP00000012880  le............................................................................
ENSTNIP00000011355  df............................................................................
ENSTNIP00000015560  lvn...........................................................................
ENSTNIP00000019851  e.............................................................................
ENSTNIP00000018795  n.............................................................................
ENSTNIP00000002487  kaflrrhrd.....................................................................
ENSTNIP00000015606  lqerl.........................................................................
ENSTNIP00000004513  f.............................................................................
ENSTNIP00000011764  igh...........................................................................
ENSTNIP00000022664  hn............................................................................
ENSTNIP00000005233  l.............................................................................
ENSTNIP00000004058  llnrkdf.......................................................................
ENSTNIP00000005705  llnrkdf.......................................................................
ENSTNIP00000021608  ak............................................................................
ENSTNIP00000005234  l.............................................................................
ENSTNIP00000015738  dek...........................................................................
ENSTNIP00000014183  ta............................................................................
ENSTNIP00000016122  f.............................................................................
ENSTNIP00000017007  slrnlytpn.....................................................................
ENSTNIP00000009570  ln............................................................................
ENSTNIP00000000064  d.............................................................................
ENSTNIP00000008592  d.............................................................................
ENSTNIP00000003464  ld............................................................................
ENSTNIP00000009671  avtrgse.......................................................................
ENSTNIP00000022235  d.............................................................................
ENSTNIP00000015515  ih............................................................................
ENSTNIP00000009474  aayedkq.......................................................................
ENSTNIP00000012823  eaeiyf........................................................................
ENSTNIP00000005275  rhr...........................................................................
ENSTNIP00000021054  lf............................................................................
ENSTNIP00000006242  aeed..........................................................................
ENSTNIP00000007859  aeed..........................................................................
ENSTNIP00000005228  snlftf........................................................................
ENSTNIP00000003152  sl............................................................................
ENSTNIP00000021405  lavmernlpklllllahctkedingplsralsarslfa........................................
ENSTNIP00000004004  lavmernlpklllllahctkedingplsralsarslfa........................................
ENSTNIP00000017490  cci...........................................................................
ENSTNIP00000003748  edkqvevar.....................................................................
ENSTNIP00000019574  yslrds........................................................................
ENSTNIP00000019868  tnpr..........................................................................
ENSTNIP00000019867  tnpr..........................................................................
ENSTNIP00000020790  pp............................................................................
ENSTNIP00000009879  ni............................................................................
ENSTNIP00000000101  ni............................................................................
ENSTNIP00000005477  slp...........................................................................
ENSTNIP00000007556  ytpse.........................................................................
ENSTNIP00000014109  strttssa......................................................................
ENSTNIP00000017432  k.............................................................................
ENSTNIP00000009570  iqr...........................................................................
ENSTNIP00000006306  qlf...........................................................................
ENSTNIP00000006163  vlv...........................................................................
ENSTNIP00000015769  qsnet.........................................................................
ENSTNIP00000015422  e.............................................................................
ENSTNIP00000019364  ..............................................................................
ENSTNIP00000014874  dlhpq.........................................................................
ENSTNIP00000001049  l.............................................................................
ENSTNIP00000014843  vs............................................................................
ENSTNIP00000016727  kmwsdselrya...................................................................
ENSTNIP00000006578  qrqvekvsqllergldpnyqdsetgaiplrlpprsgvsvsdsrklnsqqlvvelktvfvftcvrgacvvehfvgdlcs
ENSTNIP00000007406  qrqvekvsqllergldpnyqdsetgaiplrlpprsgvsvsdsrklnsqqlvvelktvfvftcvrgacvvehfvgdlcs


                                                                                                    
                                                                                                    
d1s70b_               ..............................................................................
ENSTNIP00000018931  ..............................................................................
ENSTNIP00000004671  ..............................................................................
ENSTNIP00000008004  ..............................................................................
ENSTNIP00000017432  ..............................................................................
ENSTNIP00000020962  ..............................................................................
ENSTNIP00000020961  ..............................................................................
ENSTNIP00000020964  ..............................................................................
ENSTNIP00000020160  ..............................................................................
ENSTNIP00000022654  ..............................................................................
ENSTNIP00000007965  ..............................................................................
ENSTNIP00000020160  ..............................................................................
ENSTNIP00000022654  ..............................................................................
ENSTNIP00000004254  ..............................................................................
ENSTNIP00000015489  ..............................................................................
ENSTNIP00000009879  ..............................................................................
ENSTNIP00000007449  ..............................................................................
ENSTNIP00000005052  ..............................................................................
ENSTNIP00000001326  ..............................................................................
ENSTNIP00000020926  ..............................................................................
ENSTNIP00000022840  ..............................................................................
ENSTNIP00000004030  ..............................................................................
ENSTNIP00000020447  ..............................................................................
ENSTNIP00000002067  ..............................................................................
ENSTNIP00000003481  ..............................................................................
ENSTNIP00000001972  ..............................................................................
ENSTNIP00000001668  ..............................................................................
ENSTNIP00000000101  ..............................................................................
ENSTNIP00000000847  ..............................................................................
ENSTNIP00000021608  ..............................................................................
ENSTNIP00000011850  ..............................................................................
ENSTNIP00000011850  ..............................................................................
ENSTNIP00000010597  ..............................................................................
ENSTNIP00000018931  ..............................................................................
ENSTNIP00000021608  ..............................................................................
ENSTNIP00000021608  ..............................................................................
ENSTNIP00000004671  ..............................................................................
ENSTNIP00000008004  ..............................................................................
ENSTNIP00000000651  ..............................................................................
ENSTNIP00000017452  ..............................................................................
ENSTNIP00000020962  ..............................................................................
ENSTNIP00000020961  ..............................................................................
ENSTNIP00000019592  ..............................................................................
ENSTNIP00000007965  ..............................................................................
ENSTNIP00000018708  ..............................................................................
ENSTNIP00000011422  ..............................................................................
ENSTNIP00000017008  ..............................................................................
ENSTNIP00000020964  ..............................................................................
ENSTNIP00000012589  ..............................................................................
ENSTNIP00000007468  ..............................................................................
ENSTNIP00000015489  ..............................................................................
ENSTNIP00000020926  ..............................................................................
ENSTNIP00000016214  ..............................................................................
ENSTNIP00000016215  ..............................................................................
ENSTNIP00000020449  ..............................................................................
ENSTNIP00000000938  ..............................................................................
ENSTNIP00000000106  ..............................................................................
ENSTNIP00000011013  ..............................................................................
ENSTNIP00000022975  ..............................................................................
ENSTNIP00000001836  ..............................................................................
ENSTNIP00000005054  ..............................................................................
ENSTNIP00000000636  ..............................................................................
ENSTNIP00000022060  ..............................................................................
ENSTNIP00000017877  ..............................................................................
ENSTNIP00000013825  ..............................................................................
ENSTNIP00000007887  ..............................................................................
ENSTNIP00000006529  ..............................................................................
ENSTNIP00000013614  ..............................................................................
ENSTNIP00000012342  ..............................................................................
ENSTNIP00000010055  ..............................................................................
ENSTNIP00000002777  ..............................................................................
ENSTNIP00000015489  ..............................................................................
ENSTNIP00000001972  ..............................................................................
ENSTNIP00000004254  ..............................................................................
ENSTNIP00000020780  ..............................................................................
ENSTNIP00000020505  ..............................................................................
ENSTNIP00000019489  ..............................................................................
ENSTNIP00000001972  ..............................................................................
ENSTNIP00000022060  ..............................................................................
ENSTNIP00000020274  ..............................................................................
ENSTNIP00000011600  ..............................................................................
ENSTNIP00000020643  ..............................................................................
ENSTNIP00000008767  ..............................................................................
ENSTNIP00000008004  ..............................................................................
ENSTNIP00000020403  ..............................................................................
ENSTNIP00000005775  ..............................................................................
ENSTNIP00000016350  ..............................................................................
ENSTNIP00000006475  ..............................................................................
ENSTNIP00000004288  ..............................................................................
ENSTNIP00000007797  ..............................................................................
ENSTNIP00000010973  ..............................................................................
ENSTNIP00000009851  ..............................................................................
ENSTNIP00000003355  ..............................................................................
ENSTNIP00000013324  ..............................................................................
ENSTNIP00000002256  ..............................................................................
ENSTNIP00000015625  ..............................................................................
ENSTNIP00000001122  ..............................................................................
ENSTNIP00000016215  ..............................................................................
ENSTNIP00000000847  ..............................................................................
ENSTNIP00000000101  ..............................................................................
ENSTNIP00000019171  ..............................................................................
ENSTNIP00000003589  ..............................................................................
ENSTNIP00000021546  ..............................................................................
ENSTNIP00000016214  ..............................................................................
ENSTNIP00000008096  ..............................................................................
ENSTNIP00000021658  ..............................................................................
ENSTNIP00000009879  ..............................................................................
ENSTNIP00000009476  ..............................................................................
ENSTNIP00000020961  ..............................................................................
ENSTNIP00000014947  ..............................................................................
ENSTNIP00000020962  ..............................................................................
ENSTNIP00000003486  ..............................................................................
ENSTNIP00000002157  ..............................................................................
ENSTNIP00000022028  ..............................................................................
ENSTNIP00000009270  ..............................................................................
ENSTNIP00000009271  ..............................................................................
ENSTNIP00000005251  ..............................................................................
ENSTNIP00000005250  ..............................................................................
ENSTNIP00000002767  ..............................................................................
ENSTNIP00000005249  ..............................................................................
ENSTNIP00000017214  ..............................................................................
ENSTNIP00000018491  ..............................................................................
ENSTNIP00000001443  ..............................................................................
ENSTNIP00000012425  ..............................................................................
ENSTNIP00000000418  ..............................................................................
ENSTNIP00000011989  ..............................................................................
ENSTNIP00000019096  ..............................................................................
ENSTNIP00000022908  ..............................................................................
ENSTNIP00000021546  ..............................................................................
ENSTNIP00000001350  ..............................................................................
ENSTNIP00000022034  ..............................................................................
ENSTNIP00000003225  ..............................................................................
ENSTNIP00000004105  ..............................................................................
ENSTNIP00000010006  ..............................................................................
ENSTNIP00000014371  ..............................................................................
ENSTNIP00000017023  ..............................................................................
ENSTNIP00000015550  ..............................................................................
ENSTNIP00000004821  ..............................................................................
ENSTNIP00000018664  ..............................................................................
ENSTNIP00000020926  ..............................................................................
ENSTNIP00000011335  ..............................................................................
ENSTNIP00000004556  ..............................................................................
ENSTNIP00000013317  ..............................................................................
ENSTNIP00000009417  ..............................................................................
ENSTNIP00000021733  ..............................................................................
ENSTNIP00000003914  ..............................................................................
ENSTNIP00000022373  ..............................................................................
ENSTNIP00000011405  ..............................................................................
ENSTNIP00000016960  ..............................................................................
ENSTNIP00000007293  ..............................................................................
ENSTNIP00000008146  ..............................................................................
ENSTNIP00000016915  ..............................................................................
ENSTNIP00000020652  ..............................................................................
ENSTNIP00000020964  ..............................................................................
ENSTNIP00000015802  ..............................................................................
ENSTNIP00000011405  ..............................................................................
ENSTNIP00000002262  ..............................................................................
ENSTNIP00000019154  ..............................................................................
ENSTNIP00000015812  ..............................................................................
ENSTNIP00000018163  ..............................................................................
ENSTNIP00000006897  ..............................................................................
ENSTNIP00000011305  ..............................................................................
ENSTNIP00000016930  ..............................................................................
ENSTNIP00000019629  ..............................................................................
ENSTNIP00000000664  ..............................................................................
ENSTNIP00000005820  ..............................................................................
ENSTNIP00000005228  ..............................................................................
ENSTNIP00000007470  ..............................................................................
ENSTNIP00000011306  ..............................................................................
ENSTNIP00000004387  ..............................................................................
ENSTNIP00000000847  ..............................................................................
ENSTNIP00000001107  ..............................................................................
ENSTNIP00000021112  ..............................................................................
ENSTNIP00000017960  ..............................................................................
ENSTNIP00000005432  ..............................................................................
ENSTNIP00000000101  ..............................................................................
ENSTNIP00000013166  ..............................................................................
ENSTNIP00000002306  ..............................................................................
ENSTNIP00000018558  ..............................................................................
ENSTNIP00000001438  ..............................................................................
ENSTNIP00000021633  ..............................................................................
ENSTNIP00000022373  ..............................................................................
ENSTNIP00000011850  ..............................................................................
ENSTNIP00000008855  ..............................................................................
ENSTNIP00000007188  ..............................................................................
ENSTNIP00000004671  ..............................................................................
ENSTNIP00000004034  ..............................................................................
ENSTNIP00000018931  ..............................................................................
ENSTNIP00000010671  ..............................................................................
ENSTNIP00000013098  ..............................................................................
ENSTNIP00000016922  ..............................................................................
ENSTNIP00000021111  ..............................................................................
ENSTNIP00000003381  ..............................................................................
ENSTNIP00000020505  ..............................................................................
ENSTNIP00000018712  ..............................................................................
ENSTNIP00000021261  ..............................................................................
ENSTNIP00000022919  ..............................................................................
ENSTNIP00000010298  ..............................................................................
ENSTNIP00000019340  ..............................................................................
ENSTNIP00000019537  ..............................................................................
ENSTNIP00000012849  ..............................................................................
ENSTNIP00000021203  ..............................................................................
ENSTNIP00000016430  ..............................................................................
ENSTNIP00000021749  ..............................................................................
ENSTNIP00000003121  ..............................................................................
ENSTNIP00000018281  ..............................................................................
ENSTNIP00000002757  ..............................................................................
ENSTNIP00000017905  ..............................................................................
ENSTNIP00000016177  ..............................................................................
ENSTNIP00000004254  ..............................................................................
ENSTNIP00000004505  ..............................................................................
ENSTNIP00000007098  ..............................................................................
ENSTNIP00000018860  ..............................................................................
ENSTNIP00000018861  ..............................................................................
ENSTNIP00000011013  ..............................................................................
ENSTNIP00000004254  ..............................................................................
ENSTNIP00000018753  ..............................................................................
ENSTNIP00000003344  ..............................................................................
ENSTNIP00000011405  ..............................................................................
ENSTNIP00000017191  ..............................................................................
ENSTNIP00000020431  ..............................................................................
ENSTNIP00000011744  ..............................................................................
ENSTNIP00000014438  ..............................................................................
ENSTNIP00000022060  ..............................................................................
ENSTNIP00000005333  ..............................................................................
ENSTNIP00000014824  ..............................................................................
ENSTNIP00000009879  ..............................................................................
ENSTNIP00000001972  ..............................................................................
ENSTNIP00000008197  ..............................................................................
ENSTNIP00000008859  ..............................................................................
ENSTNIP00000001888  ..............................................................................
ENSTNIP00000008457  ..............................................................................
ENSTNIP00000019974  ..............................................................................
ENSTNIP00000016215  ..............................................................................
ENSTNIP00000012669  ..............................................................................
ENSTNIP00000014343  ..............................................................................
ENSTNIP00000009374  ..............................................................................
ENSTNIP00000013843  ..............................................................................
ENSTNIP00000019152  ..............................................................................
ENSTNIP00000019800  ..............................................................................
ENSTNIP00000011128  ..............................................................................
ENSTNIP00000016214  ..............................................................................
ENSTNIP00000003581  ..............................................................................
ENSTNIP00000009375  ..............................................................................
ENSTNIP00000019856  ..............................................................................
ENSTNIP00000017493  ..............................................................................
ENSTNIP00000004637  ..............................................................................
ENSTNIP00000000199  ..............................................................................
ENSTNIP00000014598  ..............................................................................
ENSTNIP00000022443  ..............................................................................
ENSTNIP00000021145  ..............................................................................
ENSTNIP00000016530  ..............................................................................
ENSTNIP00000001856  ..............................................................................
ENSTNIP00000003340  ..............................................................................
ENSTNIP00000003075  ..............................................................................
ENSTNIP00000011507  ..............................................................................
ENSTNIP00000021687  ..............................................................................
ENSTNIP00000004278  ..............................................................................
ENSTNIP00000018637  ..............................................................................
ENSTNIP00000011193  ..............................................................................
ENSTNIP00000015635  ..............................................................................
ENSTNIP00000006573  ..............................................................................
ENSTNIP00000005633  ..............................................................................
ENSTNIP00000005157  ..............................................................................
ENSTNIP00000019463  ..............................................................................
ENSTNIP00000015383  ..............................................................................
ENSTNIP00000017006  dlghhilkahiykglskklgvsssvlqglwlaystqslspalsslrnl..............................
ENSTNIP00000004078  ..............................................................................
ENSTNIP00000007396  ..............................................................................
ENSTNIP00000018125  ..............................................................................
ENSTNIP00000013051  ..............................................................................
ENSTNIP00000002932  ..............................................................................
ENSTNIP00000005133  ..............................................................................
ENSTNIP00000018052  ..............................................................................
ENSTNIP00000002528  ..............................................................................
ENSTNIP00000017494  ..............................................................................
ENSTNIP00000020678  ..............................................................................
ENSTNIP00000002762  ..............................................................................
ENSTNIP00000017148  ..............................................................................
ENSTNIP00000022679  ..............................................................................
ENSTNIP00000016402  ..............................................................................
ENSTNIP00000014119  ..............................................................................
ENSTNIP00000005520  ..............................................................................
ENSTNIP00000009225  ..............................................................................
ENSTNIP00000000650  ..............................................................................
ENSTNIP00000016194  ..............................................................................
ENSTNIP00000023095  ..............................................................................
ENSTNIP00000019373  ..............................................................................
ENSTNIP00000007443  ..............................................................................
ENSTNIP00000012036  ..............................................................................
ENSTNIP00000002856  ..............................................................................
ENSTNIP00000011373  ..............................................................................
ENSTNIP00000017385  ..............................................................................
ENSTNIP00000016007  ..............................................................................
ENSTNIP00000018968  ..............................................................................
ENSTNIP00000016756  ..............................................................................
ENSTNIP00000022850  ..............................................................................
ENSTNIP00000011921  ..............................................................................
ENSTNIP00000015620  ..............................................................................
ENSTNIP00000015621  ..............................................................................
ENSTNIP00000018971  ..............................................................................
ENSTNIP00000019525  ..............................................................................
ENSTNIP00000017519  maatrsrysagvcgsgeadggapgsgygnmgnrigfqkerqrvreapavpkitvteasplpaegpvftlektkqpdee
ENSTNIP00000002927  ..............................................................................
ENSTNIP00000007442  ..............................................................................
ENSTNIP00000018523  ..............................................................................
ENSTNIP00000018573  ..............................................................................
ENSTNIP00000018967  ..............................................................................
ENSTNIP00000009206  ..............................................................................
ENSTNIP00000011337  ..............................................................................
ENSTNIP00000011338  ..............................................................................
ENSTNIP00000013404  ..............................................................................
ENSTNIP00000020298  ..............................................................................
ENSTNIP00000011339  ..............................................................................
ENSTNIP00000022519  ..............................................................................
ENSTNIP00000012880  ..............................................................................
ENSTNIP00000011355  ..............................................................................
ENSTNIP00000015560  ..............................................................................
ENSTNIP00000019851  ..............................................................................
ENSTNIP00000018795  ..............................................................................
ENSTNIP00000002487  ..............................................................................
ENSTNIP00000015606  ..............................................................................
ENSTNIP00000004513  ..............................................................................
ENSTNIP00000011764  ..............................................................................
ENSTNIP00000022664  ..............................................................................
ENSTNIP00000005233  ..............................................................................
ENSTNIP00000004058  ..............................................................................
ENSTNIP00000005705  ..............................................................................
ENSTNIP00000021608  ..............................................................................
ENSTNIP00000005234  ..............................................................................
ENSTNIP00000015738  ..............................................................................
ENSTNIP00000014183  ..............................................................................
ENSTNIP00000016122  ..............................................................................
ENSTNIP00000017007  ..............................................................................
ENSTNIP00000009570  ..............................................................................
ENSTNIP00000000064  ..............................................................................
ENSTNIP00000008592  ..............................................................................
ENSTNIP00000003464  ..............................................................................
ENSTNIP00000009671  ..............................................................................
ENSTNIP00000022235  ..............................................................................
ENSTNIP00000015515  ..............................................................................
ENSTNIP00000009474  ..............................................................................
ENSTNIP00000012823  ..............................................................................
ENSTNIP00000005275  ..............................................................................
ENSTNIP00000021054  ..............................................................................
ENSTNIP00000006242  ..............................................................................
ENSTNIP00000007859  ..............................................................................
ENSTNIP00000005228  ..............................................................................
ENSTNIP00000003152  ..............................................................................
ENSTNIP00000021405  ..............................................................................
ENSTNIP00000004004  ..............................................................................
ENSTNIP00000017490  ..............................................................................
ENSTNIP00000003748  ..............................................................................
ENSTNIP00000019574  ..............................................................................
ENSTNIP00000019868  ..............................................................................
ENSTNIP00000019867  ..............................................................................
ENSTNIP00000020790  ..............................................................................
ENSTNIP00000009879  ..............................................................................
ENSTNIP00000000101  ..............................................................................
ENSTNIP00000005477  ..............................................................................
ENSTNIP00000007556  ..............................................................................
ENSTNIP00000014109  ..............................................................................
ENSTNIP00000017432  ..............................................................................
ENSTNIP00000009570  ..............................................................................
ENSTNIP00000006306  ..............................................................................
ENSTNIP00000006163  ..............................................................................
ENSTNIP00000015769  ..............................................................................
ENSTNIP00000015422  ..............................................................................
ENSTNIP00000019364  ..............................................................................
ENSTNIP00000014874  ..............................................................................
ENSTNIP00000001049  ..............................................................................
ENSTNIP00000014843  ..............................................................................
ENSTNIP00000016727  ..............................................................................
ENSTNIP00000006578  rlkplstlpedqilrqalfltrvlelgplappawhlllltpasgrsfwrerssppfrggalrsfrtlpsaclspflll
ENSTNIP00000007406  rlkplstlpedqilrqalfltrvlelgplappawhlllltpasgrsfwrerssppfrggalrsfrtlpsaclspflll


                                                                                               10   
                                                                                                |   
d1s70b_               .................................................................------KQKRNEQ
ENSTNIP00000018931  .................................................................PLHCAARMGHKEL
ENSTNIP00000004671  .................................................................PLHCAARMGHKEL
ENSTNIP00000008004  .................................................................PLHCAARMGHKEL
ENSTNIP00000017432  .................................................................PIHVAAFMGHDNI
ENSTNIP00000020962  .................................................................-------------
ENSTNIP00000020961  .................................................................-------------
ENSTNIP00000020964  .................................................................-------------
ENSTNIP00000020160  .................................................................PIHVAAFMGHENI
ENSTNIP00000022654  .................................................................PIHVAAFMGHENI
ENSTNIP00000007965  .................................................................PLHIASRLGKTEI
ENSTNIP00000020160  .................................................................ALHIASLAGQSEV
ENSTNIP00000022654  .................................................................ALHIASLAGQSEV
ENSTNIP00000004254  .................................................................PLHRAVASRSEEA
ENSTNIP00000015489  .................................................................PLHAAACVGDVHV
ENSTNIP00000009879  .................................................................PIHWAAYHGHLEV
ENSTNIP00000007449  .................................................................PLMLAAEQGSLEI
ENSTNIP00000005052  .................................................................PLMLAAEQGSLEI
ENSTNIP00000001326  .................................................................PLMLAAEQGSLEI
ENSTNIP00000020926  .................................................................PLHRAVASCSEDA
ENSTNIP00000022840  .................................................................PLMLAAEQGSLEI
ENSTNIP00000004030  .................................................................PLMVAAEQGNLEI
ENSTNIP00000020447  .................................................................PLMVAAEQGNLEI
ENSTNIP00000002067  .................................................................PLMVAAEQGNLEI
ENSTNIP00000003481  .................................................................PLMVAAEQGNLEI
ENSTNIP00000001972  .................................................................PLHWAAFMGHLNV
ENSTNIP00000001668  .................................................................PLMVAAEQGNLEI
ENSTNIP00000000101  .................................................................PLDHTAKSGHEKM
ENSTNIP00000000847  .................................................................PLHMAAAHGRFSC
ENSTNIP00000021608  .................................................................PLHAAAYLGDAEI
ENSTNIP00000011850  .................................................................-LTLACYKGHLDM
ENSTNIP00000011850  .................................................................ALTLACAGGHEEL
ENSTNIP00000010597  .................................................................-LHYTITSKDTAS
ENSTNIP00000018931  .................................................................ALHIAARNDDTRT
ENSTNIP00000021608  .................................................................PLHMTAIHGRFSR
ENSTNIP00000021608  .................................................................PLHLAAYHGHHHA
ENSTNIP00000004671  .................................................................ALHIAARNDDTRT
ENSTNIP00000008004  .................................................................ALHIAARNDDTRT
ENSTNIP00000000651  .................................................................------HLGYMEM
ENSTNIP00000017452  .................................................................------HLGYMEM
ENSTNIP00000020962  .................................................................ALHIAARKDDTKS
ENSTNIP00000020961  .................................................................ALHIAARKDDTKS
ENSTNIP00000019592  .................................................................-LCVQCHLGHQEI
ENSTNIP00000007965  .................................................................-------------
ENSTNIP00000018708  .................................................................PLLIAAGCGNIQI
ENSTNIP00000011422  .................................................................-LHHAVTLANEEA
ENSTNIP00000017008  .................................................................-------------
ENSTNIP00000020964  .................................................................ALHIAARKDDTKS
ENSTNIP00000012589  .................................................................-------------
ENSTNIP00000007468  .................................................................ALMLAVGQEQVRC
ENSTNIP00000015489  .................................................................-------------
ENSTNIP00000020926  .................................................................AMHAAAMNGHQEC
ENSTNIP00000016214  .................................................................-LLEAAKAGDLDT
ENSTNIP00000016215  .................................................................-LLEAAKAGDLDT
ENSTNIP00000020449  .................................................................-------------
ENSTNIP00000000938  .................................................................-------------
ENSTNIP00000000106  .................................................................-------------
ENSTNIP00000011013  .................................................................PLHLAVRGGNIEA
ENSTNIP00000022975  .................................................................-----AYHGHAQA
ENSTNIP00000001836  .................................................................-------------
ENSTNIP00000005054  .................................................................-------------
ENSTNIP00000000636  .................................................................-------------
ENSTNIP00000022060  .................................................................--LEAAKAGDLDT
ENSTNIP00000017877  .................................................................-LVKAAANGDLAK
ENSTNIP00000013825  .................................................................-----AAHGSATK
ENSTNIP00000007887  .................................................................-LYHSAKQGELKK
ENSTNIP00000006529  .................................................................-------------
ENSTNIP00000013614  .................................................................-----VCEGSKAH
ENSTNIP00000012342  .................................................................-----AHLGHVEM
ENSTNIP00000010055  .................................................................-LLIASHKGQADN
ENSTNIP00000002777  .................................................................-------------
ENSTNIP00000015489  .................................................................PIHVAAANGHSEC
ENSTNIP00000001972  .................................................................PLMLAVVGGHVDA
ENSTNIP00000004254  .................................................................PLMLAVVGGHVDA
ENSTNIP00000020780  .................................................................-------------
ENSTNIP00000020505  .................................................................PLVFAIRQGDLKA
ENSTNIP00000019489  .................................................................-------------
ENSTNIP00000001972  .................................................................-------------
ENSTNIP00000022060  .................................................................-LFEACRNGDVSR
ENSTNIP00000020274  .................................................................-------------
ENSTNIP00000011600  .................................................................ALQLAAASGHETL
ENSTNIP00000020643  .................................................................PLHEAAVQTNHNV
ENSTNIP00000008767  .................................................................-------------
ENSTNIP00000008004  .................................................................--LRAARSGNLEK
ENSTNIP00000020403  .................................................................-------------
ENSTNIP00000005775  .................................................................PLLMASRNGHLDL
ENSTNIP00000016350  .................................................................-------------
ENSTNIP00000006475  .................................................................-LYPAAKQGETQR
ENSTNIP00000004288  .................................................................-------------
ENSTNIP00000007797  .................................................................-------------
ENSTNIP00000010973  .................................................................-------------
ENSTNIP00000009851  .................................................................-------------
ENSTNIP00000003355  .................................................................--VKLVQDGKLQT
ENSTNIP00000013324  .................................................................-LFEHIAKGNKEA
ENSTNIP00000002256  .................................................................PLHEAAAQENKKI
ENSTNIP00000015625  .................................................................----------NEQ
ENSTNIP00000001122  .................................................................-------------
ENSTNIP00000016215  .................................................................-LFEACRNGDVSR
ENSTNIP00000000847  .................................................................-LLRAIFNVDPDE
ENSTNIP00000000101  .................................................................-VHYAAAYGNKQH
ENSTNIP00000019171  .................................................................-------------
ENSTNIP00000003589  .................................................................-------------
ENSTNIP00000021546  .................................................................--HAAAVNGDRSS
ENSTNIP00000016214  .................................................................-LFEACRNGDVSR
ENSTNIP00000008096  .................................................................-------------
ENSTNIP00000021658  .................................................................PLHVAALRPQTDV
ENSTNIP00000009879  .................................................................-------------
ENSTNIP00000009476  .................................................................--QAAVAAGDVYT
ENSTNIP00000020961  .................................................................--LRAARAGNIDK
ENSTNIP00000014947  .................................................................PVHHAARAGKLTC
ENSTNIP00000020962  .................................................................--LRAARAGNIDK
ENSTNIP00000003486  .................................................................-------------
ENSTNIP00000002157  .................................................................-------------
ENSTNIP00000022028  .................................................................-------------
ENSTNIP00000009270  .................................................................-LLQAVKSADLQT
ENSTNIP00000009271  .................................................................-LLQAVKSADLQT
ENSTNIP00000005251  .................................................................-------------
ENSTNIP00000005250  .................................................................-------------
ENSTNIP00000002767  .................................................................-------------
ENSTNIP00000005249  .................................................................-------------
ENSTNIP00000017214  .................................................................----MVMADQHRS
ENSTNIP00000018491  .................................................................PIHLAAWFGSLDI
ENSTNIP00000001443  .................................................................-------------
ENSTNIP00000012425  .................................................................-------------
ENSTNIP00000000418  .................................................................-------------
ENSTNIP00000011989  .................................................................-------------
ENSTNIP00000019096  .................................................................-------------
ENSTNIP00000022908  .................................................................-------------
ENSTNIP00000021546  .................................................................PLHYGAQSNNAET
ENSTNIP00000001350  .................................................................-------------
ENSTNIP00000022034  .................................................................-------------
ENSTNIP00000003225  .................................................................-------------
ENSTNIP00000004105  .................................................................-------------
ENSTNIP00000010006  .................................................................-------------
ENSTNIP00000014371  .................................................................-------------
ENSTNIP00000017023  .................................................................-------------
ENSTNIP00000015550  .................................................................-------------
ENSTNIP00000004821  .................................................................-------------
ENSTNIP00000018664  .................................................................-------------
ENSTNIP00000020926  .................................................................-------------
ENSTNIP00000011335  .................................................................----ALYTGNLEV
ENSTNIP00000004556  .................................................................-------------
ENSTNIP00000013317  .................................................................ALTLALKAGRAHN
ENSTNIP00000009417  .................................................................-------------
ENSTNIP00000021733  .................................................................-------------
ENSTNIP00000003914  .................................................................-------------
ENSTNIP00000022373  .................................................................-------------
ENSTNIP00000011405  .................................................................-------------
ENSTNIP00000016960  .................................................................-------------
ENSTNIP00000007293  .................................................................-LLQAVKTEDLLT
ENSTNIP00000008146  .................................................................-LLQAVKTEDLLT
ENSTNIP00000016915  .................................................................-------------
ENSTNIP00000020652  .................................................................-------------
ENSTNIP00000020964  .................................................................-------------
ENSTNIP00000015802  .................................................................-------------
ENSTNIP00000011405  .................................................................PLHKAIKVEREDV
ENSTNIP00000002262  .................................................................-------------
ENSTNIP00000019154  .................................................................-------------
ENSTNIP00000015812  .................................................................-------------
ENSTNIP00000018163  .................................................................-------------
ENSTNIP00000006897  .................................................................-------------
ENSTNIP00000011305  .................................................................-------------
ENSTNIP00000016930  .................................................................-------------
ENSTNIP00000019629  .................................................................--------GNVEE
ENSTNIP00000000664  .................................................................-------------
ENSTNIP00000005820  .................................................................-------------
ENSTNIP00000005228  .................................................................---NAASEGRVLT
ENSTNIP00000007470  .................................................................-------------
ENSTNIP00000011306  .................................................................-------------
ENSTNIP00000004387  .................................................................-------------
ENSTNIP00000000847  .................................................................-------------
ENSTNIP00000001107  .................................................................-------------
ENSTNIP00000021112  .................................................................-------------
ENSTNIP00000017960  .................................................................-------------
ENSTNIP00000005432  .................................................................-------------
ENSTNIP00000000101  .................................................................-------------
ENSTNIP00000013166  .................................................................-------------
ENSTNIP00000002306  .................................................................--YTAIMDEDLGR
ENSTNIP00000018558  .................................................................-------------
ENSTNIP00000001438  .................................................................-------------
ENSTNIP00000021633  .................................................................-------------
ENSTNIP00000022373  .................................................................-------------
ENSTNIP00000011850  .................................................................-------------
ENSTNIP00000008855  .................................................................-------------
ENSTNIP00000007188  .................................................................-------------
ENSTNIP00000004671  .................................................................-------------
ENSTNIP00000004034  .................................................................-------------
ENSTNIP00000018931  .................................................................-------------
ENSTNIP00000010671  .................................................................-------------
ENSTNIP00000013098  .................................................................-------------
ENSTNIP00000016922  .................................................................-------------
ENSTNIP00000021111  .................................................................-------------
ENSTNIP00000003381  .................................................................-------------
ENSTNIP00000020505  .................................................................-------------
ENSTNIP00000018712  .................................................................-------------
ENSTNIP00000021261  .................................................................-------------
ENSTNIP00000022919  .................................................................-------------
ENSTNIP00000010298  .................................................................-------------
ENSTNIP00000019340  .................................................................-------------
ENSTNIP00000019537  .................................................................-------------
ENSTNIP00000012849  .................................................................-------------
ENSTNIP00000021203  .................................................................-------------
ENSTNIP00000016430  .................................................................-------------
ENSTNIP00000021749  .................................................................-------------
ENSTNIP00000003121  .................................................................-------------
ENSTNIP00000018281  .................................................................-------------
ENSTNIP00000002757  .................................................................-------------
ENSTNIP00000017905  .................................................................-------------
ENSTNIP00000016177  .................................................................-------------
ENSTNIP00000004254  .................................................................-------------
ENSTNIP00000004505  .................................................................-------------
ENSTNIP00000007098  .................................................................-------------
ENSTNIP00000018860  .................................................................-LNAAVSADDVVL
ENSTNIP00000018861  .................................................................-LNAAVSADDVVL
ENSTNIP00000011013  .................................................................-------KGDLSL
ENSTNIP00000004254  .................................................................-------------
ENSTNIP00000018753  .................................................................-------------
ENSTNIP00000003344  .................................................................PIHRACRDGDVGA
ENSTNIP00000011405  .................................................................-------------
ENSTNIP00000017191  .................................................................-------------
ENSTNIP00000020431  .................................................................-------------
ENSTNIP00000011744  .................................................................-------------
ENSTNIP00000014438  .................................................................-------------
ENSTNIP00000022060  .................................................................-------------
ENSTNIP00000005333  .................................................................-------------
ENSTNIP00000014824  .................................................................-------------
ENSTNIP00000009879  .................................................................-------------
ENSTNIP00000001972  .................................................................-------------
ENSTNIP00000008197  .................................................................-------------
ENSTNIP00000008859  .................................................................--FRACCANNAAV
ENSTNIP00000001888  .................................................................-------------
ENSTNIP00000008457  .................................................................--FRACCANNAAV
ENSTNIP00000019974  .................................................................-------------
ENSTNIP00000016215  .................................................................-------------
ENSTNIP00000012669  .................................................................-------------
ENSTNIP00000014343  .................................................................-------------
ENSTNIP00000009374  .................................................................-------------
ENSTNIP00000013843  .................................................................-------------
ENSTNIP00000019152  .................................................................-------------
ENSTNIP00000019800  .................................................................-------------
ENSTNIP00000011128  .................................................................------------Q
ENSTNIP00000016214  .................................................................-------------
ENSTNIP00000003581  .................................................................-------------
ENSTNIP00000009375  .................................................................-------------
ENSTNIP00000019856  .................................................................-------------
ENSTNIP00000017493  .................................................................PIHRACRDGDVGA
ENSTNIP00000004637  .................................................................-FFKACCNNNAII
ENSTNIP00000000199  .................................................................-------------
ENSTNIP00000014598  .................................................................-------------
ENSTNIP00000022443  .................................................................-------------
ENSTNIP00000021145  .................................................................-------------
ENSTNIP00000016530  .................................................................-------------
ENSTNIP00000001856  .................................................................-------------
ENSTNIP00000003340  .................................................................-------------
ENSTNIP00000003075  .................................................................-------------
ENSTNIP00000011507  .................................................................-------------
ENSTNIP00000021687  .................................................................-------------
ENSTNIP00000004278  .................................................................-------------
ENSTNIP00000018637  .................................................................-------------
ENSTNIP00000011193  .................................................................-------------
ENSTNIP00000015635  .................................................................-------------
ENSTNIP00000006573  .................................................................-------------
ENSTNIP00000005633  .................................................................-------------
ENSTNIP00000005157  .................................................................--IDCIRSKDTDA
ENSTNIP00000019463  .................................................................-------------
ENSTNIP00000015383  .................................................................-------------
ENSTNIP00000017006  .................................................................-------------
ENSTNIP00000004078  .................................................................-------------
ENSTNIP00000007396  .................................................................-------------
ENSTNIP00000018125  .................................................................TLYEACIRNDPTA
ENSTNIP00000013051  .................................................................-------------
ENSTNIP00000002932  .................................................................-------------
ENSTNIP00000005133  .................................................................-------------
ENSTNIP00000018052  .................................................................-------------
ENSTNIP00000002528  .................................................................-------------
ENSTNIP00000017494  .................................................................-------------
ENSTNIP00000020678  .................................................................-------------
ENSTNIP00000002762  .................................................................-------------
ENSTNIP00000017148  .................................................................-------------
ENSTNIP00000022679  .................................................................-------------
ENSTNIP00000016402  .................................................................-------------
ENSTNIP00000014119  .................................................................-------------
ENSTNIP00000005520  .................................................................-------------
ENSTNIP00000009225  .................................................................-------------
ENSTNIP00000000650  .................................................................-------------
ENSTNIP00000016194  .................................................................---EAVKKGNTKE
ENSTNIP00000023095  .................................................................-------------
ENSTNIP00000019373  .................................................................-------------
ENSTNIP00000007443  .................................................................-------------
ENSTNIP00000012036  .................................................................----ALVGGDEGL
ENSTNIP00000002856  .................................................................-------------
ENSTNIP00000011373  .................................................................--FEAVARRDTDS
ENSTNIP00000017385  .................................................................-------------
ENSTNIP00000016007  .................................................................-------------
ENSTNIP00000018968  .................................................................-------------
ENSTNIP00000016756  .................................................................-------------
ENSTNIP00000022850  .................................................................-------------
ENSTNIP00000011921  .................................................................-------------
ENSTNIP00000015620  .................................................................-------------
ENSTNIP00000015621  .................................................................-------------
ENSTNIP00000018971  .................................................................-------------
ENSTNIP00000019525  .................................................................-------------
ENSTNIP00000017519  dgdgqslscseggvspkssrhhflqlmrssspqvrrslvlrsdgdaalldddrsavtldplehew-------------
ENSTNIP00000002927  .................................................................-------------
ENSTNIP00000007442  .................................................................-------------
ENSTNIP00000018523  .................................................................-------------
ENSTNIP00000018573  .................................................................-------------
ENSTNIP00000018967  .................................................................PLHSAVWENDYRK
ENSTNIP00000009206  .................................................................-------------
ENSTNIP00000011337  .................................................................---RAVVEDDLRL
ENSTNIP00000011338  .................................................................---RAVVEDDLRL
ENSTNIP00000013404  .................................................................-------------
ENSTNIP00000020298  .................................................................-------------
ENSTNIP00000011339  .................................................................---RAVVEDDLRL
ENSTNIP00000022519  .................................................................-------------
ENSTNIP00000012880  .................................................................-------------
ENSTNIP00000011355  .................................................................-------------
ENSTNIP00000015560  .................................................................-------------
ENSTNIP00000019851  .................................................................-------------
ENSTNIP00000018795  .................................................................-------------
ENSTNIP00000002487  .................................................................-------------
ENSTNIP00000015606  .................................................................-------------
ENSTNIP00000004513  .................................................................-------------
ENSTNIP00000011764  .................................................................-------------
ENSTNIP00000022664  .................................................................-------------
ENSTNIP00000005233  .................................................................-------------
ENSTNIP00000004058  .................................................................-------------
ENSTNIP00000005705  .................................................................-------------
ENSTNIP00000021608  .................................................................-------------
ENSTNIP00000005234  .................................................................-------------
ENSTNIP00000015738  .................................................................-------------
ENSTNIP00000014183  .................................................................-----VEKGDYAG
ENSTNIP00000016122  .................................................................-------------
ENSTNIP00000017007  .................................................................-------------
ENSTNIP00000009570  .................................................................-------------
ENSTNIP00000000064  .................................................................-------------
ENSTNIP00000008592  .................................................................-------------
ENSTNIP00000003464  .................................................................-------------
ENSTNIP00000009671  .................................................................-------------
ENSTNIP00000022235  .................................................................-------------
ENSTNIP00000015515  .................................................................-------------
ENSTNIP00000009474  .................................................................----------VEV
ENSTNIP00000012823  .................................................................-------------
ENSTNIP00000005275  .................................................................-------------
ENSTNIP00000021054  .................................................................-------------
ENSTNIP00000006242  .................................................................-------------
ENSTNIP00000007859  .................................................................-------------
ENSTNIP00000005228  .................................................................-------------
ENSTNIP00000003152  .................................................................-------------
ENSTNIP00000021405  .................................................................-------------
ENSTNIP00000004004  .................................................................-------------
ENSTNIP00000017490  .................................................................-------------
ENSTNIP00000003748  .................................................................-------------
ENSTNIP00000019574  .................................................................-------------
ENSTNIP00000019868  .................................................................-------------
ENSTNIP00000019867  .................................................................-------------
ENSTNIP00000020790  .................................................................-------------
ENSTNIP00000009879  .................................................................-------------
ENSTNIP00000000101  .................................................................-------------
ENSTNIP00000005477  .................................................................-------------
ENSTNIP00000007556  .................................................................-------------
ENSTNIP00000014109  .................................................................-------------
ENSTNIP00000017432  .................................................................-------------
ENSTNIP00000009570  .................................................................-------------
ENSTNIP00000006306  .................................................................-------------
ENSTNIP00000006163  .................................................................-------------
ENSTNIP00000015769  .................................................................-------------
ENSTNIP00000015422  .................................................................-------------
ENSTNIP00000019364  .................................................................-------------
ENSTNIP00000014874  .................................................................-------------
ENSTNIP00000001049  .................................................................--LYALIHDHQDY
ENSTNIP00000014843  .................................................................-------------
ENSTNIP00000016727  .................................................................-------------
ENSTNIP00000006578  ...............................................................lq-------------
ENSTNIP00000007406  ...............................................................lq-------------


                           20                                                                 30    
                            |                                                                  |    
d1s70b_               LKRWIGSETDLEPPV.........................................................VKRKKT
ENSTNIP00000018931  VKLLLDHKANPNA--.........................................................------
ENSTNIP00000004671  VKLLLDHRANPDS--.........................................................------
ENSTNIP00000008004  VKLLLDHRANPDS--.........................................................------
ENSTNIP00000017432  VHQLISHGASPNT--.........................................................------
ENSTNIP00000020962  ---------------.........................................................------
ENSTNIP00000020961  ---------------.........................................................------
ENSTNIP00000020964  ---------------.........................................................------
ENSTNIP00000020160  VHALTHHGASPNT--.........................................................------
ENSTNIP00000022654  VHALTHHGASPNT--.........................................................------
ENSTNIP00000007965  VQLLLQHMAHPDA--.........................................................------
ENSTNIP00000020160  VKELVNNGANVNA--.........................................................------
ENSTNIP00000022654  VKELVNNGANVNA--.........................................................------
ENSTNIP00000004254  VRVLIHHSADVNARDknwqtplhvaaannalrcaeviip.................................LLSSVN
ENSTNIP00000015489  MDLLIESGATVNAKDhvwltplhraaasrneravglllrrgaeasardkfwqtplhvaaanratrcaeallaHLSNLN
ENSTNIP00000009879  VKLLTSQGANVKC--.........................................................------
ENSTNIP00000007449  LQELIRRGANVNL--.........................................................------
ENSTNIP00000005052  LQELIRRGANVNL--.........................................................------
ENSTNIP00000001326  LQELIRRGANVNL--.........................................................------
ENSTNIP00000020926  VAALLKHSADVNA--.........................................................------
ENSTNIP00000022840  LQELIRRGANVNL--.........................................................------
ENSTNIP00000004030  TQELIRRGANVNL--.........................................................------
ENSTNIP00000020447  TQELIRRGANVNL--.........................................................------
ENSTNIP00000002067  TQELIRRGANVNL--.........................................................------
ENSTNIP00000003481  TQELIRRGANVNL--.........................................................------
ENSTNIP00000001972  VRLLVTQGAEVSC--.........................................................------
ENSTNIP00000001668  TQELIRRGANVNL--.........................................................------
ENSTNIP00000000101  VSLLLSKGANVNA--.........................................................------
ENSTNIP00000000847  SQALIQNGADIDC--.........................................................------
ENSTNIP00000021608  IELLILSGARVNA--.........................................................------
ENSTNIP00000011850  VRFLLEAGADQEH--.........................................................------
ENSTNIP00000011850  VSVLIARGANIEH--.........................................................------
ENSTNIP00000010597  VEHVLNLGADVNA--.........................................................------
ENSTNIP00000018931  AAVLLQNDPNPDV--.........................................................------
ENSTNIP00000021608  SQAIIENEGAEIDC-.........................................................------
ENSTNIP00000021608  VEVLVQSLLDLDV--.........................................................------
ENSTNIP00000004671  AAVLLQNDPNADV--.........................................................------
ENSTNIP00000008004  AAVLLQNDPNADV--.........................................................------
ENSTNIP00000000651  VSLLLEFGASVDA--.........................................................------
ENSTNIP00000017452  VSLLLEFGASVDA--.........................................................------
ENSTNIP00000020962  AALLLQNDHNADV--.........................................................------
ENSTNIP00000020961  AALLLQNDHNADV--.........................................................------
ENSTNIP00000019592  ASLLLEFGASVDV--.........................................................------
ENSTNIP00000007965  ---------------.........................................................------
ENSTNIP00000018708  IEVLMRKGAEIQA--.........................................................----GD
ENSTNIP00000011422  VKFLLLNNANPNL--.........................................................------
ENSTNIP00000017008  VALLLDQGAQVDA--.........................................................------
ENSTNIP00000020964  AALLLQNDHNADVQ-.........................................................SKMMVN
ENSTNIP00000012589  ---------------.........................................................------
ENSTNIP00000007468  LQVLLENGADPDV--.........................................................------
ENSTNIP00000015489  -----SAGFDINT--.........................................................------
ENSTNIP00000020926  LRLLLSHSQHLDV--.........................................................-----D
ENSTNIP00000016214  VKSLCTPQNVNCRD-.........................................................------
ENSTNIP00000016215  VKSLCTPQNVNCRD-.........................................................------
ENSTNIP00000020449  ---------------.........................................................------
ENSTNIP00000000938  ---------------.........................................................------
ENSTNIP00000000106  ---------------.........................................................------
ENSTNIP00000011013  IYFCIANGAKIDQ--.........................................................------
ENSTNIP00000022975  LEVLLQGETDVDQ--.........................................................------
ENSTNIP00000001836  ---------------.........................................................------
ENSTNIP00000005054  ---------------.........................................................------
ENSTNIP00000000636  ---------------.........................................................------
ENSTNIP00000022060  VQQLCSPQNVNCRD-.........................................................------
ENSTNIP00000017877  VEDILKRPDVDVN--.........................................................------
ENSTNIP00000013825  VRELVQKYPDKVD--.........................................................------
ENSTNIP00000007887  VFLMLVDGIDPNF--.........................................................-----K
ENSTNIP00000006529  ---------------.........................................................------
ENSTNIP00000013614  IRTLILKGLRPSR--.........................................................------
ENSTNIP00000012342  VGLLLEMGAPVEG--.........................................................------
ENSTNIP00000010055  VVQLINKGAKVAV--.........................................................------
ENSTNIP00000002777  ---------------.........................................................------
ENSTNIP00000015489  LHMMFDYGEEGDL--.........................................................----TN
ENSTNIP00000001972  VSLLLEREASVNV--.........................................................------
ENSTNIP00000004254  VSLLLEREASVNV--.........................................................------
ENSTNIP00000020780  ---------------.........................................................------
ENSTNIP00000020505  FNDVATSAAHCLLR-.........................................................------
ENSTNIP00000019489  ---------------.........................................................------
ENSTNIP00000001972  ---------------.........................................................------
ENSTNIP00000022060  VKRLVDSVNVNAKD-.........................................................------
ENSTNIP00000020274  ---------------.........................................................------
ENSTNIP00000011600  VRFLLRKGASVDS--.........................................................------
ENSTNIP00000020643  LELVFTASGPESV--.........................................................-----Q
ENSTNIP00000008767  ---------------.........................................................------
ENSTNIP00000008004  ALDHIRNGIDINT--.........................................................------
ENSTNIP00000020403  ---------------.........................................................------
ENSTNIP00000005775  VEYLLECCSAPIEVG.........................................................GSVNFD
ENSTNIP00000016350  ---------------.........................................................------
ENSTNIP00000006475  VLLMLMESIDPSY--.........................................................-----Q
ENSTNIP00000004288  ---------------.........................................................------
ENSTNIP00000007797  ---------------.........................................................------
ENSTNIP00000010973  ---------------.........................................................------
ENSTNIP00000009851  ---------------.........................................................------
ENSTNIP00000003355  LEQLITLDGSVALQ-.........................................................-TIRNK
ENSTNIP00000013324  VEELLSEAERDEELRlchplcscdlcdlqlsgrwndp...................................SVVTPS
ENSTNIP00000002256  LEIVFSASPPGTAQ-.........................................................------
ENSTNIP00000015625  LKRWIGSETDLEPPV.........................................................LKKKKT
ENSTNIP00000001122  ---------------.........................................................------
ENSTNIP00000016215  VKKLVDGVSVNAKD-.........................................................------
ENSTNIP00000000847  VRSLILKKEDVNV--.........................................................------
ENSTNIP00000000101  LELLLEISFNCLE--.........................................................-----E
ENSTNIP00000019171  ---------------.........................................................------
ENSTNIP00000003589  ---------------.........................................................------
ENSTNIP00000021546  LLKLIAAEPSLRDH-.........................................................------
ENSTNIP00000016214  VKKLVDGVSVNAKD-.........................................................------
ENSTNIP00000008096  ---------------.........................................................------
ENSTNIP00000021658  LRVVLQATASTDL--.........................................................---TLE
ENSTNIP00000009879  ---------------.........................................................------
ENSTNIP00000009476  VRRMLEQGYSPKI--.........................................................------
ENSTNIP00000020961  VLDFLKNGIDIST--.........................................................------
ENSTNIP00000014947  LRFLVEEAGLSGNC-.........................................................------
ENSTNIP00000020962  VLDFLKNGIDIST--.........................................................------
ENSTNIP00000003486  ---------------.........................................................---QIN
ENSTNIP00000002157  ---------------.........................................................---QIN
ENSTNIP00000022028  ---------------.........................................................---QIN
ENSTNIP00000009270  TTKLLSKLRTSRSKLlgst.....................................................KRLNIN
ENSTNIP00000009271  TTKLLSKLRTSRSKLlgst.....................................................KRLNIN
ENSTNIP00000005251  ---------------.........................................................------
ENSTNIP00000005250  ---------------.........................................................------
ENSTNIP00000002767  ---------------.........................................................---QIN
ENSTNIP00000005249  ---------------.........................................................------
ENSTNIP00000017214  V--------------.........................................................------
ENSTNIP00000018491  LKLLVQAGAEQKV--.........................................................------
ENSTNIP00000001443  ---------------.........................................................------
ENSTNIP00000012425  ---------------.........................................................------
ENSTNIP00000000418  ---------------.........................................................------
ENSTNIP00000011989  ---------------.........................................................------
ENSTNIP00000019096  ---------------.........................................................------
ENSTNIP00000022908  ---------------.........................................................------
ENSTNIP00000021546  VRVFLSHPSVKDE--.........................................................------
ENSTNIP00000001350  ---------------.........................................................------
ENSTNIP00000022034  ---------------.........................................................-----N
ENSTNIP00000003225  ---------------.........................................................------
ENSTNIP00000004105  ---------------.........................................................------
ENSTNIP00000010006  ---------------.........................................................------
ENSTNIP00000014371  ---------------.........................................................-----N
ENSTNIP00000017023  ---------------.........................................................----VN
ENSTNIP00000015550  ------RGPNVNC--.........................................................------
ENSTNIP00000004821  ------RGPNVNC--.........................................................------
ENSTNIP00000018664  ---------------.........................................................------
ENSTNIP00000020926  ---------------.........................................................------
ENSTNIP00000011335  LQELFPRGSRVRLIIeprggdmrwvatg............................................EGLWSL
ENSTNIP00000004556  ---------------.........................................................------
ENSTNIP00000013317  VSALLEAGASPHA--.........................................................------
ENSTNIP00000009417  ---------------.........................................................------
ENSTNIP00000021733  ---------------.........................................................------
ENSTNIP00000003914  ---------------.........................................................------
ENSTNIP00000022373  ---------------.........................................................------
ENSTNIP00000011405  ---------------.........................................................------
ENSTNIP00000016960  ---------------.........................................................------
ENSTNIP00000007293  AQRLLQRPRPGKAKLlgaa.....................................................KRVNVN
ENSTNIP00000008146  AQRLLQRPRPGKAKLlgaa.....................................................KRVNVN
ENSTNIP00000016915  ---------------.........................................................------
ENSTNIP00000020652  ---------------.........................................................------
ENSTNIP00000020964  ---------------.........................................................------
ENSTNIP00000015802  ---------------.........................................................------
ENSTNIP00000011405  VFLYLIEMDSQLP--.........................................................--AKLN
ENSTNIP00000002262  ---------------.........................................................------
ENSTNIP00000019154  ---------------.........................................................------
ENSTNIP00000015812  ---------------.........................................................------
ENSTNIP00000018163  ---------------.........................................................------
ENSTNIP00000006897  ---------------.........................................................PGRWTL
ENSTNIP00000011305  ---------------.........................................................------
ENSTNIP00000016930  ---------------.........................................................------
ENSTNIP00000019629  CLQFIQNDRSVLK--.........................................................------
ENSTNIP00000000664  ---------------.........................................................------
ENSTNIP00000005820  ---------------.........................................................------
ENSTNIP00000005228  LAALLLNHTEAETQY.........................................................LLSYVT
ENSTNIP00000007470  ---------------.........................................................------
ENSTNIP00000011306  ---------------.........................................................------
ENSTNIP00000004387  ---------------.........................................................------
ENSTNIP00000000847  ---------------.........................................................------
ENSTNIP00000001107  ---------------.........................................................------
ENSTNIP00000021112  ---------------.........................................................------
ENSTNIP00000017960  ---------------.........................................................------
ENSTNIP00000005432  ---------------.........................................................------
ENSTNIP00000000101  ---------------.........................................................------
ENSTNIP00000013166  ---------------.........................................................------
ENSTNIP00000002306  IKELTKKHGSNFSILvkd......................................................TAHGNL
ENSTNIP00000018558  ---------------.........................................................------
ENSTNIP00000001438  ---------------.........................................................------
ENSTNIP00000021633  ---------------.........................................................------
ENSTNIP00000022373  ---------------.........................................................------
ENSTNIP00000011850  ---------------.........................................................------
ENSTNIP00000008855  ---------------.........................................................------
ENSTNIP00000007188  ---------------.........................................................------
ENSTNIP00000004671  ---------------.........................................................------
ENSTNIP00000004034  ---------------.........................................................------
ENSTNIP00000018931  ---------------.........................................................------
ENSTNIP00000010671  ---------------.........................................................------
ENSTNIP00000013098  ---------------.........................................................------
ENSTNIP00000016922  ---------------.........................................................------
ENSTNIP00000021111  ---------------.........................................................------
ENSTNIP00000003381  ---------------.........................................................------
ENSTNIP00000020505  ---------------.........................................................------
ENSTNIP00000018712  ---------------.........................................................------
ENSTNIP00000021261  ---------------.........................................................------
ENSTNIP00000022919  ---------------.........................................................------
ENSTNIP00000010298  ---------------.........................................................------
ENSTNIP00000019340  ---------------.........................................................------
ENSTNIP00000019537  ---------------.........................................................------
ENSTNIP00000012849  ---------------.........................................................------
ENSTNIP00000021203  ---------------.........................................................------
ENSTNIP00000016430  ---------------.........................................................------
ENSTNIP00000021749  ---------------.........................................................------
ENSTNIP00000003121  ---------------.........................................................------
ENSTNIP00000018281  ---------------.........................................................------
ENSTNIP00000002757  ---------------.........................................................------
ENSTNIP00000017905  ---------------.........................................................------
ENSTNIP00000016177  ---------------.........................................................------
ENSTNIP00000004254  ---------------.........................................................------
ENSTNIP00000004505  ---------------.........................................................------
ENSTNIP00000007098  ---------------.........................................................------
ENSTNIP00000018860  LSDLLSQESYRKA--.........................................................------
ENSTNIP00000018861  LSDLLSQESYRKA--.........................................................------
ENSTNIP00000011013  LENLVKKNPEVLTE-.........................................................------
ENSTNIP00000004254  ---------------.........................................................------
ENSTNIP00000018753  ---------------.........................................................------
ENSTNIP00000003344  LVSMLGSLSNRTH--.........................................................---LTV
ENSTNIP00000011405  ---------------.........................................................------
ENSTNIP00000017191  ---------------.........................................................------
ENSTNIP00000020431  ---------------.........................................................------
ENSTNIP00000011744  ---------------.........................................................------
ENSTNIP00000014438  ---------------.........................................................------
ENSTNIP00000022060  ---------------.........................................................------
ENSTNIP00000005333  ---------------.........................................................------
ENSTNIP00000014824  ---------------.........................................................------
ENSTNIP00000009879  ---------------.........................................................------
ENSTNIP00000001972  ---------------.........................................................------
ENSTNIP00000008197  ---------------.........................................................------
ENSTNIP00000008859  VRLMIRRGVTLEE--.........................................................----VT
ENSTNIP00000001888  ---------------.........................................................------
ENSTNIP00000008457  VRLMIRRGVTLEE--.........................................................----VT
ENSTNIP00000019974  ---------------.........................................................------
ENSTNIP00000016215  ---------------.........................................................------
ENSTNIP00000012669  ---------------.........................................................------
ENSTNIP00000014343  ---------------.........................................................------
ENSTNIP00000009374  ---------------.........................................................------
ENSTNIP00000013843  ---------------.........................................................------
ENSTNIP00000019152  ---------------.........................................................------
ENSTNIP00000019800  ---------------.........................................................------
ENSTNIP00000011128  LRFRLQNKKGWNEML.........................................................DETFLL
ENSTNIP00000016214  ---------------.........................................................------
ENSTNIP00000003581  ---------------.........................................................------
ENSTNIP00000009375  ---------------.........................................................------
ENSTNIP00000019856  ---------------.........................................................------
ENSTNIP00000017493  LVSMLGSLSNRTH--.........................................................---LTV
ENSTNIP00000004637  VKIMIRQGVTEEE--.........................................................----VR
ENSTNIP00000000199  ---------------.........................................................------
ENSTNIP00000014598  ---------------.........................................................------
ENSTNIP00000022443  ---------------.........................................................------
ENSTNIP00000021145  ---------------.........................................................------
ENSTNIP00000016530  ---------------.........................................................------
ENSTNIP00000001856  ---------------.........................................................------
ENSTNIP00000003340  ---------------.........................................................------
ENSTNIP00000003075  ---------------.........................................................------
ENSTNIP00000011507  ---------------.........................................................------
ENSTNIP00000021687  ------------KQN.........................................................LQFFVC
ENSTNIP00000004278  ---------------.........................................................------
ENSTNIP00000018637  ---------------.........................................................------
ENSTNIP00000011193  ---------------.........................................................------
ENSTNIP00000015635  ---------------.........................................................------
ENSTNIP00000006573  ---------------.........................................................------
ENSTNIP00000005633  ---------------.........................................................------
ENSTNIP00000005157  LIDAIDTGAFEVN--.........................................................------
ENSTNIP00000019463  ---------------.........................................................------
ENSTNIP00000015383  ---------------.........................................................------
ENSTNIP00000017006  ---------------.........................................................------
ENSTNIP00000004078  ---------------.........................................................------
ENSTNIP00000007396  ---------------.........................................................------
ENSTNIP00000018125  LCRILERGITKEE--.........................................................----AM
ENSTNIP00000013051  ---------------.........................................................------
ENSTNIP00000002932  ---------------.........................................................------
ENSTNIP00000005133  ---------------.........................................................------
ENSTNIP00000018052  ---------------.........................................................------
ENSTNIP00000002528  ---------------.........................................................------
ENSTNIP00000017494  ---------------.........................................................------
ENSTNIP00000020678  ---------------.........................................................------
ENSTNIP00000002762  ---------------.........................................................------
ENSTNIP00000017148  ---------------.........................................................------
ENSTNIP00000022679  ---------------.........................................................------
ENSTNIP00000016402  ---------------.........................................................------
ENSTNIP00000014119  ---------------.........................................................------
ENSTNIP00000005520  ---------------.........................................................------
ENSTNIP00000009225  ---------------.........................................................------
ENSTNIP00000000650  ---------------.........................................................------
ENSTNIP00000016194  LHSLLQNMTNCEF--.........................................................------
ENSTNIP00000023095  ---------------.........................................................------
ENSTNIP00000019373  ---------------.........................................................------
ENSTNIP00000007443  ---------------.........................................................------
ENSTNIP00000012036  AWQLYEGNPQFREGL.........................................................DPNASY
ENSTNIP00000002856  ---------------.........................................................------
ENSTNIP00000011373  LANLHRYLHQNMK-K.........................................................LSDPLS
ENSTNIP00000017385  ---------------.........................................................------
ENSTNIP00000016007  ---------------.........................................................------
ENSTNIP00000018968  ---------------.........................................................------
ENSTNIP00000016756  ---------------.........................................................------
ENSTNIP00000022850  ---------------.........................................................------
ENSTNIP00000011921  ---------------.........................................................------
ENSTNIP00000015620  ---------------.........................................................------
ENSTNIP00000015621  ---------------.........................................................------
ENSTNIP00000018971  ---------------.........................................................------
ENSTNIP00000019525  ---------------.........................................................------
ENSTNIP00000017519  ---------------.........................................................------
ENSTNIP00000002927  ---------------.........................................................------
ENSTNIP00000007442  ---------------.........................................................------
ENSTNIP00000018523  ---------------.........................................................------
ENSTNIP00000018573  ---------------.........................................................------
ENSTNIP00000018967  LEEQIQIPQND----.........................................................------
ENSTNIP00000009206  ---------------.........................................................------
ENSTNIP00000011337  VVLLLAHGTKEEV--.........................................................------
ENSTNIP00000011338  VVLLLAHGTKEEV--.........................................................------
ENSTNIP00000013404  ---------------.........................................................------
ENSTNIP00000020298  ---------------.........................................................------
ENSTNIP00000011339  VVLLLAHGTKEEV--.........................................................------
ENSTNIP00000022519  ---------------.........................................................------
ENSTNIP00000012880  ---------------.........................................................------
ENSTNIP00000011355  ---------------.........................................................------
ENSTNIP00000015560  ---------------.........................................................------
ENSTNIP00000019851  ---------------.........................................................------
ENSTNIP00000018795  ---------------.........................................................------
ENSTNIP00000002487  ---------------.........................................................------
ENSTNIP00000015606  ---------------.........................................................------
ENSTNIP00000004513  ---------------.........................................................------
ENSTNIP00000011764  ---------------.........................................................------
ENSTNIP00000022664  ---------------.........................................................------
ENSTNIP00000005233  ---------------.........................................................------
ENSTNIP00000004058  ---------------.........................................................------
ENSTNIP00000005705  ---------------.........................................................------
ENSTNIP00000021608  ---------------.........................................................------
ENSTNIP00000005234  ---------------.........................................................------
ENSTNIP00000015738  ---------------.........................................................------
ENSTNIP00000014183  VKHALREAEVYY---.........................................................------
ENSTNIP00000016122  ---------------.........................................................------
ENSTNIP00000017007  ---------------.........................................................------
ENSTNIP00000009570  ---------------.........................................................------
ENSTNIP00000000064  ---------------.........................................................------
ENSTNIP00000008592  ---------------.........................................................------
ENSTNIP00000003464  ---------------.........................................................------
ENSTNIP00000009671  ---------------.........................................................------
ENSTNIP00000022235  ---------------.........................................................------
ENSTNIP00000015515  ---------------.........................................................------
ENSTNIP00000009474  ARELIQQACCVEC--.........................................................---SAG
ENSTNIP00000012823  ---------------.........................................................------
ENSTNIP00000005275  ---------------.........................................................------
ENSTNIP00000021054  ---------------.........................................................------
ENSTNIP00000006242  ---------------.........................................................------
ENSTNIP00000007859  ---------------.........................................................------
ENSTNIP00000005228  ---------------.........................................................------
ENSTNIP00000003152  ---------------.........................................................------
ENSTNIP00000021405  ---------------.........................................................------
ENSTNIP00000004004  ---------------.........................................................------
ENSTNIP00000017490  ---------------.........................................................------
ENSTNIP00000003748  --ELIQQACCVEC--.........................................................---SAG
ENSTNIP00000019574  ---------------.........................................................------
ENSTNIP00000019868  ---------------.........................................................------
ENSTNIP00000019867  ---------------.........................................................------
ENSTNIP00000020790  ---------------.........................................................------
ENSTNIP00000009879  ---------------.........................................................------
ENSTNIP00000000101  ---------------.........................................................------
ENSTNIP00000005477  ---------------.........................................................------
ENSTNIP00000007556  ---------------.........................................................------
ENSTNIP00000014109  ---------------.........................................................------
ENSTNIP00000017432  ---------------.........................................................------
ENSTNIP00000009570  ---------------.........................................................------
ENSTNIP00000006306  ---------------.........................................................------
ENSTNIP00000006163  ---------------.........................................................------
ENSTNIP00000015769  ---------------.........................................................------
ENSTNIP00000015422  ---------------.........................................................------
ENSTNIP00000019364  ---------------.........................................................------
ENSTNIP00000014874  ---------------.........................................................------
ENSTNIP00000001049  ARYLLDRYSVGALKE.........................................................PHCSFC
ENSTNIP00000014843  ---------------.........................................................------
ENSTNIP00000016727  ---------------.........................................................------
ENSTNIP00000006578  ---------------.........................................................------
ENSTNIP00000007406  ---------------.........................................................------


                          40        50                                                              
                           |         |                                                              
d1s70b_               KVKFDDGAVFLAACSS...G..DTEEV.LRL...............................................
ENSTNIP00000018931  -TTTAGQTPLHIAARE...G..HVQTV.RIL...............................................
ENSTNIP00000004671  -ATTAGHTPLHICARE...G..HMHII.RIL...............................................
ENSTNIP00000008004  -ATTAGHTPLHICARE...G..HMHII.RIL...............................................
ENSTNIP00000017432  -SNVRGETALHMAARA...G..QSNVV.RYLiqngarvdarakddqtplhissrlgkqdivqqllangaspdattssg
ENSTNIP00000020962  ----------------...-..-----.---...............................................
ENSTNIP00000020961  ----------------...-..-----.---...............................................
ENSTNIP00000020964  ----------------...-..-----.---...............................................
ENSTNIP00000020160  -TNVRGETALHMAARA...G..QAEVV.RYL...............................................
ENSTNIP00000022654  -TNVRGETALHMAARA...G..QAEVV.RYL...............................................
ENSTNIP00000007965  -ATTNGYTPLHISARE...G..QLETA.SVL...............................................
ENSTNIP00000020160  -QSQNGFTPLYMAAQE...N..HLEVV.RFL...............................................
ENSTNIP00000022654  -QSQNGFTPLYMAAQE...N..HLEVV.RFL...............................................
ENSTNIP00000004254  VSDRGGRTALHHAALN...G..HTEMV.NLL...............................................
ENSTNIP00000015489  MADRTGRTALHHAAQS...G..FQEMV.KLL...............................................
ENSTNIP00000009879  -KDKQGYTPLHAAAVS...G..QLDVI.KYL...............................................
ENSTNIP00000007449  -DDVDCWSALISAAKE...G..HVDVV.KEL...............................................
ENSTNIP00000005052  -DDVDCWSALISAAKE...G..HVDVV.KEL...............................................
ENSTNIP00000001326  -DDVDCWSALISAAKE...G..HVDVV.KEL...............................................
ENSTNIP00000020926  -RDKNWQTPLHVAASN...K..AVRCA.EAL...............................................
ENSTNIP00000022840  -DDVDCWSALISAAKE...G..HVDVV.KEL...............................................
ENSTNIP00000004030  -DDVDCWTALISAAKE...G..HIEVV.KEL...............................................
ENSTNIP00000020447  -DDVDCWTALISAAKE...G..HIEVV.KEL...............................................
ENSTNIP00000002067  -DDVDCWTALISAAKE...G..HIEVV.KEL...............................................
ENSTNIP00000003481  -DDVDCWTALISAAKE...G..HIEVV.KEL...............................................
ENSTNIP00000001972  -KDKRGYTPLHTAASS...G..QIAVI.KHL...............................................
ENSTNIP00000001668  -DDVDCWTALISAAKE...G..HIEVV.KEL...............................................
ENSTNIP00000000101  -NDKKERKPIHWAAYH...G..HLEVV.KLL...............................................
ENSTNIP00000000847  -EDKDRNTALHVAARQ...G..HELII.TAL...............................................
ENSTNIP00000021608  -KDNKWLTPLHRAVAS...C..SEEAV.QVL...............................................
ENSTNIP00000011850  -KTDEMHTALMEACMD...G..HVEVA.RLL...............................................
ENSTNIP00000011850  -RDKKGFTPLILAATA...G..HVGVV.EVL...............................................
ENSTNIP00000010597  -TTVRGYTALIIAVLH...R..LYDII.SLL...............................................
ENSTNIP00000018931  -LSKTGFTPLHIAAHY...E..NLNVA.QLL...............................................
ENSTNIP00000021608  -EDKNGNTPLHIAARY...G..HELLI.NTL...............................................
ENSTNIP00000021608  -RNSQGCTPLDLAAFK...G..HVECV.DVL...............................................
ENSTNIP00000004671  -LSKTGFTPLHIAAHY...E..NMSVA.QLL...............................................
ENSTNIP00000008004  -LSKTGFTPLHIAAHY...E..NMSVA.QLL...............................................
ENSTNIP00000000651  -PSESGLTPLCYAAAG...G..HMAIV.SAL...............................................
ENSTNIP00000017452  -PSESGLTPLCYAAAG...G..HMAIV.SAL...............................................
ENSTNIP00000020962  -QSKSGFTPLHIAAHY...G..NVNVS.TLL...............................................
ENSTNIP00000020961  -QSKSGFTPLHIAAHY...G..NVNVS.TLL...............................................
ENSTNIP00000019592  -VSENGMSPLCFSAAA...G..HLGLV.MLL...............................................
ENSTNIP00000007965  -----GFTPLHIAAHY...G..NVNVA.TLL...............................................
ENSTNIP00000018708  KNHQSGANAIYYAARH...G..HVDTL.KFL...............................................
ENSTNIP00000011422  -ANARGSTVLHVATER...H..LKPTV.ELL...............................................
ENSTNIP00000017008  -QSHDGVSALGFAAAA...G..HLDIV.TML...............................................
ENSTNIP00000020964  RTTESGFTPLHIAAHY...G..NVNVS.TLL...............................................
ENSTNIP00000012589  ----------------...-..-----.---...............................................
ENSTNIP00000007468  -SNRDKETPLYKACER...N..SAAMV.AAL...............................................
ENSTNIP00000015489  -PDNFGRTCLHAAASG...G..NVECL.NLL...............................................
ENSTNIP00000020926  AQDINGQTPLMLAVLN...G..HTECV.YSL...............................................
ENSTNIP00000016214  -LEGRHSTPLHFAAGY...N..RVSVV.EYL...............................................
ENSTNIP00000016215  -LEGRHSTPLHFAAGY...N..RVSVV.EYL...............................................
ENSTNIP00000020449  ----------------...-..-----.---...............................................
ENSTNIP00000000938  ----------------...-..-----.---...............................................
ENSTNIP00000000106  ----------------...-..-----.---...............................................
ENSTNIP00000011013  -QQNDKSTPLHLACTQ...G..AFEVV.KMM...............................................
ENSTNIP00000022975  -RDEAGRTSLALAALR...G..HIECV.HTL...............................................
ENSTNIP00000001836  -VDNDGRIPLILAAQE...G..HYDCV.HIL...............................................
ENSTNIP00000005054  ----------------...-..-----.---...............................................
ENSTNIP00000000636  ----------------...-..-----.---...............................................
ENSTNIP00000022060  -LEGRHSTPLHFAAGY...N..RVAVV.EYL...............................................
ENSTNIP00000017877  -GQCAGHTAMQAASQN...G..HVDVL.KLL...............................................
ENSTNIP00000013825  -IKNQGKTALQVAAHQ...G..HMEVV.KAL...............................................
ENSTNIP00000007887  MESQNKRTPLHAAAEG...G..HSEVC.HML...............................................
ENSTNIP00000006529  -----GDTLLHLAIIH...E..ASNHI.KPM...............................................
ENSTNIP00000013614  -LSRNGFTALHLAAYK...D..NAELV.TAL...............................................
ENSTNIP00000012342  -TTDSGMTPLCLAAAA...G..HADIV.SLL...............................................
ENSTNIP00000010055  --TKYGRSPLHLAAHK...G..HLEVV.HIL...............................................
ENSTNIP00000002777  --------------YT...G..QFDKL.KQS...............................................
ENSTNIP00000015489  VADKYGQTPLMLAVLG...G..HTDCV.HFL...............................................
ENSTNIP00000001972  -SNKHGFTALHLGLLF...G..QEECI.QCL...............................................
ENSTNIP00000004254  -SNKHGFTALHLGLLF...G..QEECI.QCL...............................................
ENSTNIP00000020780  ---------VFWAVRK...G..NLALL.QLL...............................................
ENSTNIP00000020505  -EDQDGWMPLHDAAFC...G..QTECA.KTI...............................................
ENSTNIP00000019489  ----DGDTILHLAIIH...E..EELFA.QQL...............................................
ENSTNIP00000001972  --------PLIQAIFS...G..DPEGD.TLL...............................................
ENSTNIP00000022060  -MAGRKSTPLHFAAGF...G..RKDVV.EHL...............................................
ENSTNIP00000020274  ----------------...-..-----.---...............................................
ENSTNIP00000011600  -RNNYGWTPLMHAARF...G..HLTVA.HIL...............................................
ENSTNIP00000020643  GRTRLGQTPLFLAAER...G..LMENV.SFL...............................................
ENSTNIP00000008767  ----------------...-..-----.---...............................................
ENSTNIP00000008004  -ANQNGLNGLHLASKE...G..HVKMV.LEL...............................................
ENSTNIP00000020403  ----------------...-..-----.---...............................................
ENSTNIP00000005775  GETIEGAPPLWAASAA...G..HLKVV.QSL...............................................
ENSTNIP00000016350  ----NGDTPLHLAVIH...Q..QTAVV.HQL...............................................
ENSTNIP00000006475  PDAQNRRCALHAAAQR...G..LLEIC.YML...............................................
ENSTNIP00000004288  ---------LLEATAR...N..DLDEV.RQL...............................................
ENSTNIP00000007797  -------WDIVKATQY...G..IFERC.REL...............................................
ENSTNIP00000010973  ---------LLEATAR...N..DLDEV.RQL...............................................
ENSTNIP00000009851  -----ASVALLEASAR...N..DPDEV.RYL...............................................
ENSTNIP00000003355  HFGRSGDTLLHYAARL...G..HLDIM.AYL...............................................
ENSTNIP00000013324  SRDDRGYTPLHLAAACa..G..QSQLI.DLL...............................................
ENSTNIP00000002256  CRTLNGETPLFLAVVH...G..LRENA.TFL...............................................
ENSTNIP00000015625  KVKFDDGAVFLAACSS...G..DTEEV.LRM...............................................
ENSTNIP00000001122  ---------FMAACSA...G..DREEV.AAL...............................................
ENSTNIP00000016215  -LAGRRSTPLHFAAGF...G..RKDVV.DHL...............................................
ENSTNIP00000000847  -QDNEKRTPLHAAAYL...G..DAEII.ELV...............................................
ENSTNIP00000000101  VESNIPVSPLHLAAYY...G..HCEAL.RLL...............................................
ENSTNIP00000019171  ---------FMAACSA...G..DREEV.AAL...............................................
ENSTNIP00000003589  ---------FMAACSA...G..DREEV.AAL...............................................
ENSTNIP00000021546  -EDQFGRTPLMYCVLA...D..RLDCA.EIL...............................................
ENSTNIP00000016214  -LAGRRSTPLHFAAGF...G..RKDVV.DHL...............................................
ENSTNIP00000008096  ------RTDVHKAASQ...G..QTTLL.QHL...............................................
ENSTNIP00000021658  ERTGEGDTPLTLAAAA...G..LVDNV.RIL...............................................
ENSTNIP00000009879  -PDTKGQTALMLAALG...G..HIDCV.HIL...............................................
ENSTNIP00000009476  -RDANGWTLLHFSAAK...G..KERCV.RVF...............................................
ENSTNIP00000020961  -CNQNGLNALHLAAKE...G..HKDLV.EEL...............................................
ENSTNIP00000014947  -VANNGASPAHDAAAT...G..NLACL.QWL...............................................
ENSTNIP00000020962  -CNQNGLNALHLAAKE...G..HKDLV.EEL...............................................
ENSTNIP00000003486  SRDAAGQTPLHLACER...G..DPVCV.KEL...............................................
ENSTNIP00000002157  SRDAAGQTPLHLACER...G..DPVCV.KEL...............................................
ENSTNIP00000022028  SRDAAGQTPLHLACER...G..DPVCV.KEL...............................................
ENSTNIP00000009270  YQDSDGFSALHHAALT...G..TTELL.SAL...............................................
ENSTNIP00000009271  YQDSDGFSALHHAALT...G..TTELL.SAL...............................................
ENSTNIP00000005251  ----DGDSVLHLAVLH...H..QQEVL.KSL...............................................
ENSTNIP00000005250  ----DGDSVLHLAVLH...H..QQEVL.KSL...............................................
ENSTNIP00000002767  SRDAAGQTPLHLACER...G..DPVCV.KEL...............................................
ENSTNIP00000005249  ----DGDSVLHLAVLH...H..QQEVL.KSL...............................................
ENSTNIP00000017214  ----------------...-..----S.ELL...............................................
ENSTNIP00000018491  -ENQEGQNIMHCAAIN...N..HTDII.EYI...............................................
ENSTNIP00000001443  ---------LMKAVER...G..EVDKV.AAV...............................................
ENSTNIP00000012425  ---------LMKAVER...G..EVDKV.AAV...............................................
ENSTNIP00000000418  ---------LMKAVER...G..EVDKV.AAV...............................................
ENSTNIP00000011989  --------RLLAAVEH...G..EAEKL.ASL...............................................
ENSTNIP00000019096  -----DRSAVHEAAAE...G..RVVQL.QRL...............................................
ENSTNIP00000022908  ------------AVER...G..EVDKV.AAV...............................................
ENSTNIP00000021546  -PDLEGRTAFMWAAGK...G..SDDVI.RTM...............................................
ENSTNIP00000001350  ----------------...-..-----.---...............................................
ENSTNIP00000022034  CTDSSGYTPLHHASLN...G..HRDVV.LKL...............................................
ENSTNIP00000003225  ----------------...-..-----.---...............................................
ENSTNIP00000004105  ----------------...-..-----.---...............................................
ENSTNIP00000010006  ----------------...-..-----.---...............................................
ENSTNIP00000014371  CTDSSGYTPLHHASLN...G..HRDVV.LKL...............................................
ENSTNIP00000017023  FQDTDGFSPLHHAALN...G..NLELI.TLL...............................................
ENSTNIP00000015550  -VDSTGYTPLHHAALN...G..HSEVV.EAL...............................................
ENSTNIP00000004821  -VDSTGYTPLHHAALN...G..HSEVV.EAL...............................................
ENSTNIP00000018664  ----------------...-..-----.---...............................................
ENSTNIP00000020926  TPDDFGRTCLHAAAAG...G..NLECL.NLL...............................................
ENSTNIP00000011335  SYEQELTTPLHITASR...G..FTECL.RLL...............................................
ENSTNIP00000004556  ----------VKASQF...G..ILERC.KEL...............................................
ENSTNIP00000013317  -ANGSNETPLAAAVKA...G..SYEMT.HAL...............................................
ENSTNIP00000009417  ----------------...-..-----.---...............................................
ENSTNIP00000021733  ----------------...-..-----.---...............................................
ENSTNIP00000003914  ----------------...-..-----.---...............................................
ENSTNIP00000022373  ----HSIGALHAATLT...N..NLEMV.SLL...............................................
ENSTNIP00000011405  ----------------...-..-----.---...............................................
ENSTNIP00000016960  ---ESDWSPLHDAAFN...G..RVLAL.QSL...............................................
ENSTNIP00000007293  IQDADGLAPLHHAALS...G..NKELI.SLL...............................................
ENSTNIP00000008146  IQDADGLAPLHHAALS...G..NKELI.SLL...............................................
ENSTNIP00000016915  -DSWSDRTPLHDAAYQ...G..RLLTL.RTL...............................................
ENSTNIP00000020652  -----------AACAS...G..DREEA.ELM...............................................
ENSTNIP00000020964  -----SNTSFLRAARA...G..NIDKV.LDF...............................................
ENSTNIP00000015802  ----------------...-..-----.---...............................................
ENSTNIP00000011405  ELDNNGDLALDLALSR...K..LESIA.TTL...............................................
ENSTNIP00000002262  ------RPLLSQAASQ...G..NVTLL.SKL...............................................
ENSTNIP00000019154  ------RPLLSQAASQ...G..NVTLL.SKL...............................................
ENSTNIP00000015812  -------------IQT...G..SVEKI.AKV...............................................
ENSTNIP00000018163  ----------------...-..-----.---...............................................
ENSTNIP00000006897  SSRVKQTSPLRLAASR...G..HSGCV.EEL...............................................
ENSTNIP00000011305  ----------HKAAAV...G..DVGKL.KEL...............................................
ENSTNIP00000016930  ------------AIVR...H..DDKEV.LRL...............................................
ENSTNIP00000019629  ----------------...-..-----.---...............................................
ENSTNIP00000000664  ------------AIVR...H..DDKEV.LRL...............................................
ENSTNIP00000005820  --SWADRSPLHEAASQ...G..RLLAL.RTL...............................................
ENSTNIP00000005228  QVGGQKSTPLIIAARN...G..HDKVV.RLL...............................................
ENSTNIP00000007470  ----------------...-..-----.---...............................................
ENSTNIP00000011306  ----------HKAAAV...G..DVGKL.KEL...............................................
ENSTNIP00000004387  --------AVHVCVMY...N..AVETA.LLL...............................................
ENSTNIP00000000847  -TDNQGYTPLHWACYN...GagYDSCV.EVL...............................................
ENSTNIP00000001107  ----------------...-..-----.---...............................................
ENSTNIP00000021112  ---------------T...S..AVDKM.VKF...............................................
ENSTNIP00000017960  ---------------T...S..AVDKM.VKF...............................................
ENSTNIP00000005432  ----------MEHVHQ...K..NVEKV.SKW...............................................
ENSTNIP00000000101  --DYRGYMPVHWAAYH...G..HEDCL.CIL...............................................
ENSTNIP00000013166  ----DGDTVLHIAVAQ...G..KRALT.YVL...............................................
ENSTNIP00000002306  MPLTNVICPLHLAASN...T..RVKSI.QSL...............................................
ENSTNIP00000018558  ----------------...-..-----.---...............................................
ENSTNIP00000001438  ----------------...-..-----.---...............................................
ENSTNIP00000021633  ----DGDTILHIYVAK...G..LREYA.FAA...............................................
ENSTNIP00000022373  ----------------...-..-----.---...............................................
ENSTNIP00000011850  ---------LAEACSD...G..DVNAV.RKL...............................................
ENSTNIP00000008855  ----------------...-..-----.---...............................................
ENSTNIP00000007188  --------ALAAAAAK...G..RTAEV.RRI...............................................
ENSTNIP00000004671  ----------------...-..-----.---...............................................
ENSTNIP00000004034  ----------------...-..-----.---...............................................
ENSTNIP00000018931  ----------------...-..-----.---...............................................
ENSTNIP00000010671  ----------------...-..-----.---...............................................
ENSTNIP00000013098  ----------------...-..-----.---...............................................
ENSTNIP00000016922  ----------------...-..-----.---...............................................
ENSTNIP00000021111  -----------EHVQQ...R..NIEKV.SRF...............................................
ENSTNIP00000003381  ----------------...-..-----.---...............................................
ENSTNIP00000020505  ----------------...-..-----.---...............................................
ENSTNIP00000018712  ----------------...-..-----.---...............................................
ENSTNIP00000021261  ----------------...-..-----.---...............................................
ENSTNIP00000022919  ----------------...-..-----.---...............................................
ENSTNIP00000010298  ----------------...-..-----.---...............................................
ENSTNIP00000019340  --------------RE...G..NAVAV.RLW...............................................
ENSTNIP00000019537  ----------------...-..-----.---...............................................
ENSTNIP00000012849  ----------------...-..-----.---...............................................
ENSTNIP00000021203  ----------------...-..-----.---...............................................
ENSTNIP00000016430  ----------------...-..-----.---...............................................
ENSTNIP00000021749  ----------------...-..-----.---...............................................
ENSTNIP00000003121  -----------FHAEV...G..NVAEI.QTL...............................................
ENSTNIP00000018281  -----------FHAEV...G..NVAEI.QTL...............................................
ENSTNIP00000002757  ----------------...-..-----.---...............................................
ENSTNIP00000017905  ----------------...-..-----.---...............................................
ENSTNIP00000016177  ----------------...-..-----.---...............................................
ENSTNIP00000004254  ----------------...-..-----.---...............................................
ENSTNIP00000004505  ----------------...-..-----.---...............................................
ENSTNIP00000007098  ------ISQLRQAVLE...N..NDRLL.DEM...............................................
ENSTNIP00000018860  ----------------...-..-----.---...............................................
ENSTNIP00000018861  ----------------...-..-----.---...............................................
ENSTNIP00000011013  -RDENGATPLHHAAAG...G..CVALI.QFI...............................................
ENSTNIP00000004254  ----------------...-..-----.---...............................................
ENSTNIP00000018753  ----------------...-..-----.---...............................................
ENSTNIP00000003344  EDAFFGWTPLHWAAHN...G..QLECL.MRL...............................................
ENSTNIP00000011405  -------TPLHMAIAH...N..HPDVV.SVI...............................................
ENSTNIP00000017191  ----------------...-..-----.---...............................................
ENSTNIP00000020431  ----------------...-..-----.---...............................................
ENSTNIP00000011744  ---------LHNSAYV...G..DLDTL.RNL...............................................
ENSTNIP00000014438  ----------WSAALH...G..DLQRV.RSL...............................................
ENSTNIP00000022060  ----------------...-..-----.---...............................................
ENSTNIP00000005333  --------------YA...G..DVQGL.FAV...............................................
ENSTNIP00000014824  ----------------...-..-----.---...............................................
ENSTNIP00000009879  -----PVS--------...-..-----.---...............................................
ENSTNIP00000001972  ----------------...-..-----.---...............................................
ENSTNIP00000008197  ------------ACID...G..DLPFA.KRL...............................................
ENSTNIP00000008859  ETDQNNRIGLLVACYQ...G..YVDVV.IAL...............................................
ENSTNIP00000001888  -----GETLLQRAARL...G..YQDVV.LYC...............................................
ENSTNIP00000008457  ETDQNNRIGLLVACYQ...G..YVDVV.IAL...............................................
ENSTNIP00000019974  -----GETLLQRAARL...G..YQDVV.LYC...............................................
ENSTNIP00000016215  ----TH----------...-..-----.---...............................................
ENSTNIP00000012669  ----------------...-..-----.---...............................................
ENSTNIP00000014343  ----------------...-..-----.---...............................................
ENSTNIP00000009374  ----------------...-..-----.---...............................................
ENSTNIP00000013843  ----------------...-..-----.---...............................................
ENSTNIP00000019152  ----------------...-..-----.---...............................................
ENSTNIP00000019800  ----------------...-..-----.---...............................................
ENSTNIP00000011128  YTKHINNIPLFYAAQK...N..NAGCI.KKL...............................................
ENSTNIP00000016214  ----------------...-..-----.---...............................................
ENSTNIP00000003581  ----------------...-..-----.---...............................................
ENSTNIP00000009375  ----------------...-..-----.---...............................................
ENSTNIP00000019856  -RDEDANNLLHISASQ...G..HADCL.QHL...............................................
ENSTNIP00000017493  EDAFFGWTPLHWAAHN...G..QLECL.MRL...............................................
ENSTNIP00000004637  ETDRNRRTGLIVACYH...G..YVDVV.MAL...............................................
ENSTNIP00000000199  ----------------...-..-----.---...............................................
ENSTNIP00000014598  ----------------...-..-----.---...............................................
ENSTNIP00000022443  ---------LLKAVWL...R..RLRLT.RLL...............................................
ENSTNIP00000021145  ----------------...-..-----.---...............................................
ENSTNIP00000016530  ---------LLRAVFL...R..RLRLT.RLL...............................................
ENSTNIP00000001856  ----------------...G..EFDLV.QRI...............................................
ENSTNIP00000003340  ----------------...G..EFDLV.QRI...............................................
ENSTNIP00000003075  ----------------...G..EFDLV.QRI...............................................
ENSTNIP00000011507  ----------------...G..EFDLV.QRI...............................................
ENSTNIP00000021687  IFDSAAMKRLREAANC...N..DIDTV.RKL...............................................
ENSTNIP00000004278  ----------------...-..-----.---...............................................
ENSTNIP00000018637  ----------------...-..-----.---...............................................
ENSTNIP00000011193  ---------------C...G..RTDLV.KQA...............................................
ENSTNIP00000015635  ----------------...G..RTDLV.KQA...............................................
ENSTNIP00000006573  ----------------...-..-----.---...............................................
ENSTNIP00000005633  -----------D----...-..-----.---...............................................
ENSTNIP00000005157  ----------------...-..-----.---...............................................
ENSTNIP00000019463  ----------LDASLE...G..EFDLV.QRI...............................................
ENSTNIP00000015383  ----------------...-..-----.---...............................................
ENSTNIP00000017006  --------------YT...P..NIKVS.RLL...............................................
ENSTNIP00000004078  -----------DASLE...G..EYDLV.QRV...............................................
ENSTNIP00000007396  -----------DASLE...G..EYDLV.QRV...............................................
ENSTNIP00000018125  ELDINGRNGLMVAVSK...G..FIDIV.TTL...............................................
ENSTNIP00000013051  ----------------...-..-----.---...............................................
ENSTNIP00000002932  ----------------...-..-----.---...............................................
ENSTNIP00000005133  ----------------...-..-----.---...............................................
ENSTNIP00000018052  ----------------...-..-REVV.LYC...............................................
ENSTNIP00000002528  ----------------...-..-----.---...............................................
ENSTNIP00000017494  ----------------...-..-----.---...............................................
ENSTNIP00000020678  ----------------...-..-----.---...............................................
ENSTNIP00000002762  ----------------...-..--EVV.LYC...............................................
ENSTNIP00000017148  ----------------...-..-----.---...............................................
ENSTNIP00000022679  ----------------...-..-----.---...............................................
ENSTNIP00000016402  ----------------...-..-----.---...............................................
ENSTNIP00000014119  ----------------...-..-----.---...............................................
ENSTNIP00000005520  ----------------...-..-----.---...............................................
ENSTNIP00000009225  ----------------...-..-----.---...............................................
ENSTNIP00000000650  ----------------...-..-----.---...............................................
ENSTNIP00000016194  ----------------...-..-----.---...............................................
ENSTNIP00000023095  ----------------...-..-----.---...............................................
ENSTNIP00000019373  ---------------V...G..ELETV.KKA...............................................
ENSTNIP00000007443  ----------------...-..-----.---...............................................
ENSTNIP00000012036  GEQYQHNTPLHYVCRH...A..MTRLL.RSF...............................................
ENSTNIP00000002856  ----------------...-..-----.---...............................................
ENSTNIP00000011373  ADQSHGKSALMKALLHlkdG..KNETV.ELL...............................................
ENSTNIP00000017385  --DGRGRTYLHQVACV...G..KRALG.YCI...............................................
ENSTNIP00000016007  ----------------...-..-----.---...............................................
ENSTNIP00000018968  ----------------...-..-----.---...............................................
ENSTNIP00000016756  ----------------...-..-----.---...............................................
ENSTNIP00000022850  ----------------...-..-----.---...............................................
ENSTNIP00000011921  ----------------...-..-----.---...............................................
ENSTNIP00000015620  ----------------...-..-----.---...............................................
ENSTNIP00000015621  ----------------...-..-----.---...............................................
ENSTNIP00000018971  ----------------...-..-----.---...............................................
ENSTNIP00000019525  -----------LCASD...G..LWDSL.QPL...............................................
ENSTNIP00000017519  ----------MLCASD...G..EWSSL.QRL...............................................
ENSTNIP00000002927  ----------------...-..-----.---...............................................
ENSTNIP00000007442  -----------HLVWH...N..QARQLeKEL...............................................
ENSTNIP00000018523  ----------------...-..-----.---...............................................
ENSTNIP00000018573  ----------------...-..-----.---...............................................
ENSTNIP00000018967  ----------------...-..-----.---...............................................
ENSTNIP00000009206  ----------------...-..-----.---...............................................
ENSTNIP00000011337  ----------------...-..-----.---...............................................
ENSTNIP00000011338  ----------------...-..-----.---...............................................
ENSTNIP00000013404  ---------VHQCVFQ...G..DVRRL.SSL...............................................
ENSTNIP00000020298  ----------------...-..-----.---...............................................
ENSTNIP00000011339  ----------------...-..-----.---...............................................
ENSTNIP00000022519  ----------------...-..-----.---...............................................
ENSTNIP00000012880  ------------AAEY...G..NIPEV.RRM...............................................
ENSTNIP00000011355  --------PVHECVFK...G..DVRRL.SSL...............................................
ENSTNIP00000015560  ----------------...-..-----.---...............................................
ENSTNIP00000019851  ----------------...-..-----.---...............................................
ENSTNIP00000018795  ----------------...-..-----.---...............................................
ENSTNIP00000002487  ----------------...-..-----.---...............................................
ENSTNIP00000015606  ----------------...-..-----.---...............................................
ENSTNIP00000004513  ----------------...-..-----.---...............................................
ENSTNIP00000011764  ----------------...-..-----.---...............................................
ENSTNIP00000022664  ----------------...-..-----.---...............................................
ENSTNIP00000005233  ----------------...-..-----.---...............................................
ENSTNIP00000004058  ----------------...-..-----.---...............................................
ENSTNIP00000005705  ----------------...-..-----.---...............................................
ENSTNIP00000021608  ----------------...-..-----.---...............................................
ENSTNIP00000005234  ----------------...-..-----.---...............................................
ENSTNIP00000015738  --------LFLLACEK...G..DYYMV.KKL...............................................
ENSTNIP00000014183  ----------------...-..-----.---...............................................
ENSTNIP00000016122  ----------------...-..-----.---...............................................
ENSTNIP00000017007  ----------------...-..-IKVS.RLL...............................................
ENSTNIP00000009570  ----------------...-..-----.---...............................................
ENSTNIP00000000064  ------------AAEY...G..NIPVV.RKM...............................................
ENSTNIP00000008592  ------------AAEY...G..NIPVV.RKM...............................................
ENSTNIP00000003464  ------------AAEN...G..NAPKV.ALM...............................................
ENSTNIP00000009671  ----------------...-..-----.---...............................................
ENSTNIP00000022235  ------------AAEN...G..NAPKV.ALM...............................................
ENSTNIP00000015515  ----------------...-..-----.---...............................................
ENSTNIP00000009474  VPRVGGVNLLCLAVEN...G..DQQSV.RYL...............................................
ENSTNIP00000012823  ----------------...-..-----.---...............................................
ENSTNIP00000005275  ----------------...-..-----.---...............................................
ENSTNIP00000021054  -----------SSCKK...G..DICRV.RHL...............................................
ENSTNIP00000006242  ----------------...-..-----.---...............................................
ENSTNIP00000007859  ----------------...-..-----.---...............................................
ENSTNIP00000005228  ----------------...-..-----.---...............................................
ENSTNIP00000003152  ----------------...-..-----.---...............................................
ENSTNIP00000021405  ----------------...-..-----.---...............................................
ENSTNIP00000004004  ----------------...-..-----.---...............................................
ENSTNIP00000017490  ----------------...-..-----.---...............................................
ENSTNIP00000003748  VPRVGGVNLLCLAVEN...G..DQQSV.RYL...............................................
ENSTNIP00000019574  ---------LFTACKV...G..DIDSL.HTL...............................................
ENSTNIP00000019868  ----------------...-..-----.---...............................................
ENSTNIP00000019867  ----------------...-..-----.---...............................................
ENSTNIP00000020790  ----------------...-..-----.---...............................................
ENSTNIP00000009879  ----------------...-..-----.---...............................................
ENSTNIP00000000101  ----------------...-..-----.---...............................................
ENSTNIP00000005477  ----------------...-..-----.---...............................................
ENSTNIP00000007556  ----------------...-..-----.---...............................................
ENSTNIP00000014109  ----------------...-..-----.---...............................................
ENSTNIP00000017432  ----------------...-..-----.---...............................................
ENSTNIP00000009570  ----------------...-..-----.---...............................................
ENSTNIP00000006306  ----------------...-..-----.---...............................................
ENSTNIP00000006163  ----------------...-..-----.---...............................................
ENSTNIP00000015769  ----------------...-..-----.---...............................................
ENSTNIP00000015422  ----------------...-..-----.---...............................................
ENSTNIP00000019364  ----------------...-..-----.---...............................................
ENSTNIP00000014874  ------ETLLHFAARR...G..LCQVT.RFL...............................................
ENSTNIP00000001049  RCRGGGSSLLTMAVRY...E..RVSIL.GMM...............................................
ENSTNIP00000014843  ----------------...-..-----.---...............................................
ENSTNIP00000016727  --------MLEKACQD...G..DATMA.ECL...............................................
ENSTNIP00000006578  ----------------...-..-----.---...............................................
ENSTNIP00000007406  ----------------...-..-----.---...............................................


                                       60                                                       70  
                                        |                                                        |  
d1s70b_               ..................LER.....GAD...........INY..............................A.NVD
ENSTNIP00000018931  ..................LDM.....EAQ...........QAK..............................M.TKK
ENSTNIP00000004671  ..................LDA.....GAQ...........QTR..............................M.TKK
ENSTNIP00000008004  ..................LDA.....GAQ...........QTR..............................M.TKK
ENSTNIP00000017432  ytplhlaareghrdvaavLDN.....GAD...........LSV..............................V.TKK
ENSTNIP00000020962  ..................---.....---...........---..............................-.---
ENSTNIP00000020961  ..................---.....---...........---..............................-.---
ENSTNIP00000020964  ..................---.....---...........---..............................-.---
ENSTNIP00000020160  ..................LKN.....GAK...........VET..............................K.SKD
ENSTNIP00000022654  ..................LKN.....GAK...........VET..............................K.SKD
ENSTNIP00000007965  ..................LEA.....GAS...........HSL..............................A.TKK
ENSTNIP00000020160  ..................LEN.....GAS...........QSI..............................A.TED
ENSTNIP00000022654  ..................LEN.....GAS...........QSI..............................A.TED
ENSTNIP00000004254  ..................LSK.....GAN...........INA..............................F.DKK
ENSTNIP00000015489  ..................LNK.....GAN...........LSA..............................M.DKK
ENSTNIP00000009879  ..................LRV.....VSE...........IDD..............................S.NAY
ENSTNIP00000007449  ..................LEN.....SAY...........IEH..............................R.DMG
ENSTNIP00000005052  ..................LEN.....SAY...........IEH..............................R.DMG
ENSTNIP00000001326  ..................LEN.....SAY...........IEH..............................R.DMG
ENSTNIP00000020926  ..................VPL.....LSN...........VNV..............................S.DRA
ENSTNIP00000022840  ..................LEN.....SAY...........IEH..............................R.DMG
ENSTNIP00000004030  ..................LEN.....SAN...........LEH..............................R.DMG
ENSTNIP00000020447  ..................LEN.....SAN...........LEH..............................R.DMG
ENSTNIP00000002067  ..................LEN.....SAN...........LEH..............................R.DMG
ENSTNIP00000003481  ..................LEN.....SAN...........LEH..............................R.DMG
ENSTNIP00000001972  ..................LNL.....AVE...........IDE..............................S.NAF
ENSTNIP00000001668  ..................LEN.....SAN...........LEH..............................R.DMG
ENSTNIP00000000101  ..................TSQ.....GAN...........VKC..............................K.DKQ
ENSTNIP00000000847  ..................VKH.....GAN...........TAR..............................R.GVY
ENSTNIP00000021608  ..................LKH.....SAD...........VNA..............................R.DKN
ENSTNIP00000011850  ..................LDS.....GAQ...........VNM..............................P.ADS
ENSTNIP00000011850  ..................LDK.....GGD...........IEA..............................Q.SER
ENSTNIP00000010597  ..................LEH.....GAL...........VGH..............................G.DED
ENSTNIP00000018931  ..................LNR.....GAN...........VNF..............................T.PKN
ENSTNIP00000021608  ..................ITN.....CAD...........TAK..............................R.GVH
ENSTNIP00000021608  ..................INQ.....GAS...........ILV..............................K.DFN
ENSTNIP00000004671  ..................LNR.....GAN...........VNF..............................T.PKN
ENSTNIP00000008004  ..................LNR.....GAN...........VNF..............................T.PKN
ENSTNIP00000000651  ..................CRR.....RAK...........VDH..............................L.DKN
ENSTNIP00000017452  ..................CRR.....RAK...........VDH..............................L.DKN
ENSTNIP00000020962  ..................LNR.....GAA...........VDF..............................T.ARN
ENSTNIP00000020961  ..................LNR.....GAA...........VDF..............................T.ARN
ENSTNIP00000019592  ..................CKR.....GAK...........VDH..............................T.DKS
ENSTNIP00000007965  ..................LNR.....GAA...........VDF..............................T.ARN
ENSTNIP00000018708  ..................HEK.....NCP...........LDI..............................Q.DKS
ENSTNIP00000011422  ..................LGRr....STN...........VNA..............................K.DED
ENSTNIP00000017008  ..................SQN.....AAK...........VGH..............................V.DNS
ENSTNIP00000020964  ..................LNR.....GAA...........VDF..............................T.ARN
ENSTNIP00000012589  ..................---.....---...........---..............................-.--D
ENSTNIP00000007468  ..................LNH.....GAA...........VNT..............................H.CIL
ENSTNIP00000015489  ..................LSS.....GTD...........LNK..............................R.DIM
ENSTNIP00000020926  ..................LSQ.....GAS...........VEN..............................Q.DRW
ENSTNIP00000016214  ..................LHH.....GAD...........VHA..............................K.DKG
ENSTNIP00000016215  ..................LHH.....GAD...........VHA..............................K.DKG
ENSTNIP00000020449  ..................---.....---...........---..............................-.---
ENSTNIP00000000938  ..................---.....---...........---..............................-.---
ENSTNIP00000000106  ..................---.....---...........---..............................-.---
ENSTNIP00000011013  ..................LSSyg...PVEdv.........INL..............................A.DGA
ENSTNIP00000022975  ..................LSQ.....GAS...........PHT..............................A.DSQ
ENSTNIP00000001836  ..................LEN.....KSC...........IDQ..............................R.GYD
ENSTNIP00000005054  ..................---.....---...........---..............................-.---
ENSTNIP00000000636  ..................---.....---...........---..............................-.---
ENSTNIP00000022060  ..................LHH.....GAD...........VHA..............................K.DKG
ENSTNIP00000017877  ..................LKH.....NVD...........LES..............................E.DKD
ENSTNIP00000013825  ..................LQA.....NGS...........IEI..............................K.DED
ENSTNIP00000007887  ..................VQA.....GAN...........LDI..............................C.DDD
ENSTNIP00000006529  ..................IAL.....SRN...........TDF..............................-.---
ENSTNIP00000013614  ..................LHG.....GSD...........VQQ..............................V.GYG
ENSTNIP00000012342  ..................CKK.....GAK...........VGH..............................T.DKN
ENSTNIP00000010055  ..................LKA.....GCD...........LDI..............................Q.DDG
ENSTNIP00000002777  ..................ILSd....KSL...........ASK..............................T.DQD
ENSTNIP00000015489  ..................LEK.....GAL...........PDT..............................K.DKR
ENSTNIP00000001972  ..................LEQ.....EAS...........VLL..............................G.DSQ
ENSTNIP00000004254  ..................LEQ.....EAS...........VLL..............................G.DSQ
ENSTNIP00000020780  ..................LNSg....RVD...........ADC..............................R.DSC
ENSTNIP00000020505  ..................LKAh....PSL...........VDK..............................R.TLQ
ENSTNIP00000019489  ..................IQLf....PKNv..........LDI..............................Q.NNL
ENSTNIP00000001972  ..................WCN.....PDD...........VSV..............................K.DAE
ENSTNIP00000022060  ..................QT-.....GAN...........VHA..............................R.DDG
ENSTNIP00000020274  ..................---.....---...........---..............................-.---
ENSTNIP00000011600  ..................LEN.....GAD...........ING..............................R.NRL
ENSTNIP00000020643  ..................LQH.....GAD...........PDS..............................L.DQV
ENSTNIP00000008767  ..................---.....---...........---..............................-.---
ENSTNIP00000008004  ..................LHA.....GIE...........LEA..............................T.TKK
ENSTNIP00000020403  ..................---.....---...........---..............................-.---
ENSTNIP00000005775  ..................LGH.....GAS...........VNS..............................T.TLT
ENSTNIP00000016350  ..................VQTll...S-Srqpgv......LNT..............................A.NHL
ENSTNIP00000006475  ..................VQA.....GAN...........VDA..............................Q.DKD
ENSTNIP00000004288  ..................LNS.....GVS...........PDL..............................V.NED
ENSTNIP00000007797  ..................VEA.....GFD...........VRQ..............................P.DKE
ENSTNIP00000010973  ..................LNS.....GVS...........PDL..............................V.NED
ENSTNIP00000009851  ..................LTN.....NVS...........ADL..............................C.NED
ENSTNIP00000003355  ..................IQVv....GMD...........VEL..............................Y.NND
ENSTNIP00000013324  ..................VCK.....GAS...........VNA..............................T.DYH
ENSTNIP00000002256  ..................LQN.....GCS...........PEL..............................Q.NDE
ENSTNIP00000015625  ..................LDH.....GAD...........INY..............................A.NVD
ENSTNIP00000001122  ..................LRQ.....GAD...........INH..............................A.NID
ENSTNIP00000016215  ..................LCT.....GAN...........VHA..............................R.DDG
ENSTNIP00000000847  ..................VLS.....GAR...........VNA..............................K.DNK
ENSTNIP00000000101  ..................CET.....LVS...........LDV..............................R.DIE
ENSTNIP00000019171  ..................LRQ.....GAD...........INH..............................A.NID
ENSTNIP00000003589  ..................LRQ.....GAD...........INH..............................A.NID
ENSTNIP00000021546  ..................LKA.....GAS...........VNK..............................T.DHS
ENSTNIP00000016214  ..................LCT.....GAN...........VHA..............................R.DDG
ENSTNIP00000008096  ..................IQS.....GAS...........VNV..............................V.AVD
ENSTNIP00000021658  ..................LGH.....GAS...........PHN..............................T.NSC
ENSTNIP00000009879  ..................LEK.....GAK...........ADA..............................A.DTK
ENSTNIP00000009476  ..................LEH.....GAD...........PTV..............................K.DFI
ENSTNIP00000020961  ..................LDR.....GAP...........VDS..............................S.TKK
ENSTNIP00000014947  ..................LTQg....GCR...........PEH..............................K.DSS
ENSTNIP00000020962  ..................LDR.....GAP...........VDS..............................S.TKK
ENSTNIP00000003486  ..................LEEs....QAQ...........TDI..............................K.DRS
ENSTNIP00000002157  ..................LEEs....QAQ...........TDI..............................K.DRS
ENSTNIP00000022028  ..................LEEs....QAQ...........TDI..............................K.DRS
ENSTNIP00000009270  ..................LEA.....QAT...........VDI..............................K.DSN
ENSTNIP00000009271  ..................LEA.....QAT...........VDI..............................K.DSN
ENSTNIP00000005251  ..................VQVlsllpGQDv..........LNA..............................R.NHL
ENSTNIP00000005250  ..................VQVlsllpGQDv..........LNA..............................R.NHL
ENSTNIP00000002767  ..................LEEs....QAQ...........TDI..............................K.DRS
ENSTNIP00000005249  ..................VQVlsllpGQDv..........LNA..............................R.NHL
ENSTNIP00000017214  ..................LNS.....KFD...........VNY..............................AfGRV
ENSTNIP00000018491  ..................INDlq...MKE...........LDK..............................E.DNS
ENSTNIP00000001443  ..................LSKk....GVV...........PTK..............................L.DVE
ENSTNIP00000012425  ..................LSKk....GVV...........PTK..............................L.DVE
ENSTNIP00000000418  ..................LSKk....GVV...........PTK..............................L.DVE
ENSTNIP00000011989  ..................LSKk....GSS...........AAK..............................L.DND
ENSTNIP00000019096  ..................IED.....GAA...........VNM..............................V.AVD
ENSTNIP00000022908  ..................LSKk....GVV...........PTK..............................L.DVE
ENSTNIP00000021546  ..................LGLtp...HID...........INM..............................A.DKY
ENSTNIP00000001350  ..................---.....-MD...........VNV..............................R.GPD
ENSTNIP00000022034  ..................LQY.....EAS...........TNV..............................E.DNK
ENSTNIP00000003225  ..................---.....-MD...........VNV..............................R.GPD
ENSTNIP00000004105  ..................---.....-MD...........VNV..............................R.GPD
ENSTNIP00000010006  ..................---.....-MD...........VNV..............................R.GPD
ENSTNIP00000014371  ..................LQY.....EAS...........TNV..............................E.DNK
ENSTNIP00000017023  ..................LES.....QAA...........VDI..............................R.DQK
ENSTNIP00000015550  ..................LRN.....EAL...........TNM..............................A.DNK
ENSTNIP00000004821  ..................LRN.....EAL...........TNM..............................A.DNK
ENSTNIP00000018664  ..................---.....--D...........VNV..............................R.GPD
ENSTNIP00000020926  ..................LKV.....GAD...........LNR..............................K.DHF
ENSTNIP00000011335  ..................LQR.....GAD...........VEL..............................A.-PG
ENSTNIP00000004556  ..................VEA.....GYD...........VRQ..............................P.DKE
ENSTNIP00000013317  ..................ISC.....GAW...........AEQ..............................V.CWR
ENSTNIP00000009417  ..................--D.....GLD...........VNV..............................K.GPG
ENSTNIP00000021733  ..................---.....--D...........VNV..............................R.GPD
ENSTNIP00000003914  ..................---.....GLD...........VNV..............................K.GPD
ENSTNIP00000022373  ..................LSK.....GAD...........VNV..............................Q.DKL
ENSTNIP00000011405  ..................---.....---...........---..............................-.-RD
ENSTNIP00000016960  ..................LGQ.....GTC...........VNL..............................S.TLD
ENSTNIP00000007293  ..................LEA.....QAT...........VDI..............................K.DHK
ENSTNIP00000008146  ..................LEA.....QAT...........VDI..............................K.DHK
ENSTNIP00000016915  ..................ISQ.....GFH...........VDT..............................L.TMD
ENSTNIP00000020652  ..................LKE.....SQDgetepqehveiINC..............................T.NAD
ENSTNIP00000020964  ..................LKN.....GID...........IST..............................C.NQN
ENSTNIP00000015802  ..................---.....---...........---..............................-.---
ENSTNIP00000011405  ..................VNN.....KAD...........VDM..............................V.DQS
ENSTNIP00000002262  ..................LNQ.....PDP...........TTTststastsvntssatavenkpdrldrnhhhY.NHN
ENSTNIP00000019154  ..................LNQ.....PDP...........TTTststastsvntssatavenkpdrldrnhhhY.NHN
ENSTNIP00000015812  ..................LEK.....GLD...........PNF..............................H.DPD
ENSTNIP00000018163  ..................---.....---...........---..............................-.---
ENSTNIP00000006897  ..................LFR.....GAE...........VN-..............................-.DDP
ENSTNIP00000011305  ..................AEK.....-HD...........INQ..............................L.DKE
ENSTNIP00000016930  ..................LKE.....GAD...........PNT..............................L.IPS
ENSTNIP00000019629  ..................---.....---...........--Q..............................K.GWG
ENSTNIP00000000664  ..................LKE.....GAD...........PNT..............................L.IPS
ENSTNIP00000005820  ..................LAQ.....GYP...........ANI..............................V.TID
ENSTNIP00000005228  ..................LDHy....QVD...........TEQvgtvrfdg......................Y.VID
ENSTNIP00000007470  ..................---.....---...........---..............................-.---
ENSTNIP00000011306  ..................AEK.....-HD...........INQ..............................L.DKE
ENSTNIP00000004387  ..................LERr....TVN...........--A..............................M.-PN
ENSTNIP00000000847  ..................LDQ.....EVF...........KQV..............................K.-GN
ENSTNIP00000001107  ..................---.....---...........---..............................-.---
ENSTNIP00000021112  ..................MDK.....GLD...........PNF..............................Q.DSD
ENSTNIP00000017960  ..................MDK.....GLD...........PNF..............................Q.DSD
ENSTNIP00000005432  ..................LEK.....GLD...........PNF..............................H.DSD
ENSTNIP00000000101  ..................LEK.....K-L...........FNY..............................K.EGN
ENSTNIP00000013166  ..................ALKmaa..GGE...........LDL..............................K.EHN
ENSTNIP00000002306  ..................LSA.....GAD...........PEI..............................R.DLL
ENSTNIP00000018558  ..................---.....---...........---..............................-.---
ENSTNIP00000001438  ..................---.....---...........---..............................-.---
ENSTNIP00000021633  ..................AEKlr...SLDk..........LDA..............................K.EHK
ENSTNIP00000022373  ..................---.....---...........---..............................-.---
ENSTNIP00000011850  ..................LDE.....GRS...........VNE..............................H.TEE
ENSTNIP00000008855  ..................---.....---...........---..............................-.---
ENSTNIP00000007188  ..................LEEc....RVP...........PDT..............................P.NEF
ENSTNIP00000004671  ..................---.....---...........---..............................-.---
ENSTNIP00000004034  ..................---.....---...........---..............................-.---
ENSTNIP00000018931  ..................---.....---...........---..............................-.---
ENSTNIP00000010671  ..................---.....---...........---..............................-.---
ENSTNIP00000013098  ..................---.....---...........---..............................-.---
ENSTNIP00000016922  ..................---.....---...........---..............................-.---
ENSTNIP00000021111  ..................LDK.....GLD...........PNF..............................H.DPD
ENSTNIP00000003381  ..................---.....---...........---..............................-.---
ENSTNIP00000020505  ..................---.....GAD...........VNM..............................Q.TCD
ENSTNIP00000018712  ..................---.....---...........---..............................-.---
ENSTNIP00000021261  ..................---.....---...........---..............................-.---
ENSTNIP00000022919  ..................---.....---...........---..............................-.---
ENSTNIP00000010298  ..................---.....---...........---..............................-.---
ENSTNIP00000019340  ..................LDNt....E--...........---..............................-.---
ENSTNIP00000019537  ..................---.....---...........---..............................-.---
ENSTNIP00000012849  ..................---.....---...........---..............................-.---
ENSTNIP00000021203  ..................---.....---...........---..............................-.---
ENSTNIP00000016430  ..................---.....---...........---..............................-.---
ENSTNIP00000021749  ..................---.....---...........---..............................-.---
ENSTNIP00000003121  ..................LQL.....RVEqsisln.....INC..............................R.SRS
ENSTNIP00000018281  ..................LQL.....RVEqsisln.....INC..............................R.SRS
ENSTNIP00000002757  ..................---.....---...........---..............................-.---
ENSTNIP00000017905  ..................---.....---...........---..............................-.---
ENSTNIP00000016177  ..................---.....---...........---..............................-.---
ENSTNIP00000004254  ..................---.....---...........---..............................-.---
ENSTNIP00000004505  ..................---.....---...........---..............................-.---
ENSTNIP00000007098  ..................LCQ.....EIYrkv........INL..............................R.GGW
ENSTNIP00000018860  ..................---.....---...........VNA..............................R.SGW
ENSTNIP00000018861  ..................---.....---...........VNA..............................R.SGW
ENSTNIP00000011013  ..................TTVve...QEG...........LNS..............................C.DDQ
ENSTNIP00000004254  ..................-SA.....GFQ...........IDT..............................P.DTL
ENSTNIP00000018753  ..................---.....---...........---..............................-.---
ENSTNIP00000003344  ..................VQM.....GCE...........VNT..............................A.TSH
ENSTNIP00000011405  ..................LEQ.....KAN...........ALHatnnfqiipdfsl.................K.DSM
ENSTNIP00000017191  ..................---.....---...........---..............................-.---
ENSTNIP00000020431  ..................---.....---...........---..............................-.---
ENSTNIP00000011744  ..................LQEedf..KRR...........INE..............................K.SVW
ENSTNIP00000014438  ..................VQK.....GTQ...........PNL..............................K.DTA
ENSTNIP00000022060  ..................---.....---...........---..............................-.---
ENSTNIP00000005333  ..................LSEd....PSQ...........LNA..............................P.DGH
ENSTNIP00000014824  ..................---.....---...........---..............................-.---
ENSTNIP00000009879  ..................---.....---...........---..............................-.---
ENSTNIP00000001972  ..................---.....---...........---..............................-.---
ENSTNIP00000008197  ..................LET.....GCD...........PNI..............................R.DYR
ENSTNIP00000008859  ..................SQCp....HLD...........VNW..............................Q.DSE
ENSTNIP00000001888  ..................LEKd....VSE...........VNR..............................R.DNA
ENSTNIP00000008457  ..................SQCp....HLD...........VNW..............................Q.DSE
ENSTNIP00000019974  ..................LEKd....VSE...........VNR..............................R.DNA
ENSTNIP00000016215  ..................---.....---...........---..............................-.---
ENSTNIP00000012669  ..................---.....---...........---..............................-.---
ENSTNIP00000014343  ..................---.....---...........---..............................-.---
ENSTNIP00000009374  ..................---.....---...........---..............................-.---
ENSTNIP00000013843  ..................---.....---...........---..............................-.---
ENSTNIP00000019152  ..................---.....---...........---..............................-.---
ENSTNIP00000019800  ..................---.....---...........---..............................-.---
ENSTNIP00000011128  ..................LGCs....STN...........IFE..............................R.GAL
ENSTNIP00000016214  ..................---.....---...........---..............................-.---
ENSTNIP00000003581  ..................---.....---...........---..............................-.---
ENSTNIP00000009375  ..................---.....---...........---..............................-.---
ENSTNIP00000019856  ..................TSLm....GEDg..........LNE..............................R.NNQ
ENSTNIP00000017493  ..................VQM.....GCE...........VNT..............................A.TSH
ENSTNIP00000004637  ..................SQCp....YLD...........VNW..............................Q.DNE
ENSTNIP00000000199  ..................---.....---...........---..............................-.---
ENSTNIP00000014598  ..................---.....---...........---..............................-.---
ENSTNIP00000022443  ..................LEG.....GAY...........INE..............................S.NER
ENSTNIP00000021145  ..................---.....---...........---..............................-.---
ENSTNIP00000016530  ..................LEG.....GAY...........INE..............................S.DGQ
ENSTNIP00000001856  ..................IYE.....VED...........PSQ..............................P.NDE
ENSTNIP00000003340  ..................IYE.....VED...........PSQ..............................P.NDE
ENSTNIP00000003075  ..................IYE.....VED...........PSQ..............................P.NDE
ENSTNIP00000011507  ..................IYE.....VED...........PSQ..............................P.NDE
ENSTNIP00000021687  ..................LQD.....DVD...........PCS..............................A.DDK
ENSTNIP00000004278  ..................---.....---...........---..............................-.---
ENSTNIP00000018637  ..................---.....---...........---..............................-.---
ENSTNIP00000011193  ..................VNLl....GPDg..........INS..............................M.SEQ
ENSTNIP00000015635  ..................VNLl....GPDg..........INS..............................M.SEQ
ENSTNIP00000006573  ..................---.....---...........---..............................-.---
ENSTNIP00000005633  ..................---.....---...........---..............................-.---
ENSTNIP00000005157  ..................---.....---...........--F..............................M.DDV
ENSTNIP00000019463  ..................IYE.....VDN...........PST..............................P.NDE
ENSTNIP00000015383  ..................---.....---...........---..............................-.---
ENSTNIP00000017006  ..................IMG.....GAD...........VDH..............................R.TDV
ENSTNIP00000004078  ..................IYD.....VDD...........PSA..............................P.NDE
ENSTNIP00000007396  ..................IYD.....VDD...........PSA..............................P.NDE
ENSTNIP00000018125  ..................HVCp....LIE...........INH..............................Q.DND
ENSTNIP00000013051  ..................---.....---...........---..............................-.---
ENSTNIP00000002932  ..................---.....---...........---..............................-.---
ENSTNIP00000005133  ..................---.....---...........---..............................-.---
ENSTNIP00000018052  ..................LENr....VCD...........VNH..............................R.DYA
ENSTNIP00000002528  ..................---.....---...........---..............................-.---
ENSTNIP00000017494  ..................---.....---...........---..............................-.---
ENSTNIP00000020678  ..................---.....---...........---..............................-.---
ENSTNIP00000002762  ..................LENr....VCD...........VNH..............................R.DYA
ENSTNIP00000017148  ..................---.....---...........---..............................-.---
ENSTNIP00000022679  ..................---.....---...........---..............................-.---
ENSTNIP00000016402  ..................---.....---...........---..............................-.---
ENSTNIP00000014119  ..................---.....---...........---..............................-.---
ENSTNIP00000005520  ..................---.....---...........---..............................-.---
ENSTNIP00000009225  ..................---.....---...........---..............................-.---
ENSTNIP00000000650  ..................---.....---...........---..............................-.---
ENSTNIP00000016194  ..................---.....--N...........VNS..............................F.GPE
ENSTNIP00000023095  ..................---.....---...........---..............................-.---
ENSTNIP00000019373  ..................VQE.....MVD...........PSL..............................P.NDE
ENSTNIP00000007443  ..................---.....---...........---..............................-.---
ENSTNIP00000012036  ..................LFSk....EGN...........PNK..............................R.NVH
ENSTNIP00000002856  ..................---.....---...........---..............................-.---
ENSTNIP00000011373  ..................IRI.....SEQ...........MGD..............................L.DTF
ENSTNIP00000017385  ..................AKRm....A-Alhg........LDL..............................R.DSA
ENSTNIP00000016007  ..................---.....---...........---..............................-.---
ENSTNIP00000018968  ..................---.....---...........---..............................-.---
ENSTNIP00000016756  ..................---.....---...........---..............................-.---
ENSTNIP00000022850  ..................---.....---...........---..............................-.---
ENSTNIP00000011921  ..................---.....---...........---..............................-.---
ENSTNIP00000015620  ..................---.....---...........---..............................-.---
ENSTNIP00000015621  ..................---.....---...........---..............................-.---
ENSTNIP00000018971  ..................---.....---...........---..............................-.-YR
ENSTNIP00000019525  ..................LAVe....PAL...........VTK..............................R.DFV
ENSTNIP00000017519  ..................LGAe....PSL...........ILR..............................K.DFI
ENSTNIP00000002927  ..................---.....---...........--R..............................K.DF-
ENSTNIP00000007442  ..................ASKa....QMD...........LES..............................L.---
ENSTNIP00000018523  ..................---.....---...........---..............................-.---
ENSTNIP00000018573  ..................---.....---...........---..............................-.---
ENSTNIP00000018967  ..................---.....---...........---..............................-.---
ENSTNIP00000009206  ..................---.....---...........---..............................-.DLN
ENSTNIP00000011337  ..................---.....--N...........ETY..............................G.DGD
ENSTNIP00000011338  ..................---.....--N...........ETY..............................G.DGD
ENSTNIP00000013404  ..................IRT.....-QN...........IAQ..............................K.DVH
ENSTNIP00000020298  ..................---.....---...........---..............................-.---
ENSTNIP00000011339  ..................---.....--N...........ETY..............................G.DGD
ENSTNIP00000022519  ..................---.....---...........---..............................-.---
ENSTNIP00000012880  ..................LLHvp...NLN...........INA..............................V.DYM
ENSTNIP00000011355  ..................IRT.....---...........---..............................-.---
ENSTNIP00000015560  ..................---.....---...........---..............................-.---
ENSTNIP00000019851  ..................---.....---...........---..............................-.---
ENSTNIP00000018795  ..................---.....---...........---..............................-.---
ENSTNIP00000002487  ..................---.....---...........---..............................-.---
ENSTNIP00000015606  ..................---.....---...........---..............................-.---
ENSTNIP00000004513  ..................---.....---...........---..............................-.---
ENSTNIP00000011764  ..................---.....---...........---..............................-.---
ENSTNIP00000022664  ..................---.....---...........---..............................-.---
ENSTNIP00000005233  ..................---.....---...........---..............................-.---
ENSTNIP00000004058  ..................---.....---...........---..............................-.---
ENSTNIP00000005705  ..................---.....---...........---..............................-.---
ENSTNIP00000021608  ..................---.....-AD...........FTL..............................Q.DAA
ENSTNIP00000005234  ..................---.....---...........---..............................-.---
ENSTNIP00000015738  ..................LEEnrng.ELN...........INC..............................V.DVL
ENSTNIP00000014183  ..................---.....NID...........VNC..............................L.DPL
ENSTNIP00000016122  ..................---.....---...........---..............................-.---
ENSTNIP00000017007  ..................IM-.....---...........---..............................-.---
ENSTNIP00000009570  ..................---.....---...........---..............................-.---
ENSTNIP00000000064  ..................LEEsk...TLN...........FNC..............................V.DYM
ENSTNIP00000008592  ..................LEEsk...TLN...........FNC..............................V.DYM
ENSTNIP00000003464  ..................LEEvp...DLN...........VNY..............................V.NYK
ENSTNIP00000009671  ..................---.....---...........---..............................-.---
ENSTNIP00000022235  ..................LEEvp...DLN...........VNY..............................V.NYK
ENSTNIP00000015515  ..................---.....---...........---..............................-.---
ENSTNIP00000009474  ..................LKE.....ARV...........PVP..............................Q.ELC
ENSTNIP00000012823  ..................---.....KIN...........INC..............................I.DPL
ENSTNIP00000005275  ..................---.....---...........---..............................-.---
ENSTNIP00000021054  ..................IEQr....DVD...........LNV..............................R.DKW
ENSTNIP00000006242  ..................---.....---...........---..............................-.---
ENSTNIP00000007859  ..................---.....---...........---..............................-.---
ENSTNIP00000005228  ..................---.....---...........---..............................-.---
ENSTNIP00000003152  ..................---.....---...........---..............................-.---
ENSTNIP00000021405  ..................---.....---...........---..............................-.---
ENSTNIP00000004004  ..................---.....---...........---..............................-.---
ENSTNIP00000017490  ..................---.....---...........---..............................-.---
ENSTNIP00000003748  ..................LKE.....ARV...........PVP..............................Q.ELC
ENSTNIP00000019574  ..................LQLptq..RAD...........IHQ..............................Q.SVS
ENSTNIP00000019868  ..................---.....---...........---..............................-.---
ENSTNIP00000019867  ..................---.....---...........---..............................-.---
ENSTNIP00000020790  ..................---.....---...........---..............................-.---
ENSTNIP00000009879  ..................---.....---...........---..............................-.---
ENSTNIP00000000101  ..................---.....---...........---..............................-.---
ENSTNIP00000005477  ..................---.....---...........---..............................-.---
ENSTNIP00000007556  ..................---.....---...........---..............................-.---
ENSTNIP00000014109  ..................---.....---...........---..............................-.---
ENSTNIP00000017432  ..................---.....---...........---..............................-.---
ENSTNIP00000009570  ..................---.....---...........---..............................-.---
ENSTNIP00000006306  ..................---.....---...........---..............................-.---
ENSTNIP00000006163  ..................---.....---...........---..............................-.---
ENSTNIP00000015769  ..................---.....---...........---..............................-.---
ENSTNIP00000015422  ..................---.....---...........---..............................-.---
ENSTNIP00000019364  ..................---.....---...........---..............................-.---
ENSTNIP00000014874  ..................LQQs....GARea.........LRL..............................A.NRE
ENSTNIP00000001049  ..................MDA.....LKE...........---..............................-.---
ENSTNIP00000014843  ..................---.....---...........---..............................-.---
ENSTNIP00000016727  ..................IEL.....GAD...........VNA..............................K.TKS
ENSTNIP00000006578  ..................---.....---...........---..............................-.---
ENSTNIP00000007406  ..................---.....---...........---..............................-.---


                                                                                                   8
                                                                                                    
d1s70b_               .....GL..T..A..............................................................LHQ
ENSTNIP00000018931  .....GF..T..P..............................................................LHV
ENSTNIP00000004671  .....GF..T..S..............................................................LHV
ENSTNIP00000008004  .....GF..T..S..............................................................LHV
ENSTNIP00000017432  .....GF..T..P..............................................................LHV
ENSTNIP00000020962  .....--..-..P..............................................................LHI
ENSTNIP00000020961  .....--..-..P..............................................................LHI
ENSTNIP00000020964  .....--..-..P..............................................................LHI
ENSTNIP00000020160  .....DQ..T..A..............................................................LHI
ENSTNIP00000022654  .....DQ..T..A..............................................................LHI
ENSTNIP00000007965  .....GF..T..P..............................................................LHV
ENSTNIP00000020160  .....GF..T..PlavalqqghdqvvslllendtkgkvrlpalhiaarkddtkaaalllqndhnadvesksgftpLHI
ENSTNIP00000022654  .....GF..T..PlavalqqghdqvvslllendtkgkvrlpalhiaarkddtkaaalllqndhnadvesksgftpLHI
ENSTNIP00000004254  .....DG..R..P..............................................................LHW
ENSTNIP00000015489  .....ER..Q..P..............................................................VHC
ENSTNIP00000009879  .....GN..T..A..............................................................LHM
ENSTNIP00000007449  .....GW..T..A..............................................................LMW
ENSTNIP00000005052  .....GW..T..A..............................................................LMW
ENSTNIP00000001326  .....GW..T..A..............................................................LMW
ENSTNIP00000020926  .....GR..T..A..............................................................LHH
ENSTNIP00000022840  .....GW..T..A..............................................................LMW
ENSTNIP00000004030  .....GW..T..-..............................................................LMW
ENSTNIP00000020447  .....GW..T..-..............................................................LMW
ENSTNIP00000002067  .....GW..T..Alwaaykgrtdvadllldkganpnitgqqysvyp.............................IIW
ENSTNIP00000003481  .....GW..T..Alwaaykgrtdvadllldkganpnitgqqysvyp.............................IIW
ENSTNIP00000001972  .....GN..T..A..............................................................LHL
ENSTNIP00000001668  .....GW..T..-..............................................................LMW
ENSTNIP00000000101  .....GY..T..P..............................................................LHA
ENSTNIP00000000847  .....GM..F..P..............................................................FHL
ENSTNIP00000021608  .....WQ..T..P..............................................................LHI
ENSTNIP00000011850  .....FE..S..P..............................................................LTL
ENSTNIP00000011850  ....tKD..T..P..............................................................LSL
ENSTNIP00000010597  .....QW..T..A..............................................................LHF
ENSTNIP00000018931  .....GI..T..P..............................................................LHI
ENSTNIP00000021608  .....GM..F..P..............................................................LHL
ENSTNIP00000021608  ....lNL..T..P..............................................................IHA
ENSTNIP00000004671  .....GI..T..P..............................................................LHI
ENSTNIP00000008004  .....GI..T..P..............................................................LHI
ENSTNIP00000000651  .....RQ..C..A..............................................................LVH
ENSTNIP00000017452  .....RQ..C..A..............................................................LVH
ENSTNIP00000020962  .....GI..T..P..............................................................LHV
ENSTNIP00000020961  .....GI..T..P..............................................................LHV
ENSTNIP00000019592  .....GQ..S..G..............................................................LVH
ENSTNIP00000007965  .....GI..T..P..............................................................LHV
ENSTNIP00000018708  .....GE..T..A..............................................................LHV
ENSTNIP00000011422  .....QY..T..A..............................................................LHW
ENSTNIP00000017008  .....GR..C..V..............................................................LVH
ENSTNIP00000020964  .....GI..T..P..............................................................LHV
ENSTNIP00000012589  .....GD..T..L..............................................................LHL
ENSTNIP00000007468  .....GW..T..A..............................................................LQE
ENSTNIP00000015489  .....GR..T..P..............................................................LHY
ENSTNIP00000020926  .....GR..T..A..............................................................LHR
ENSTNIP00000016214  .....GL..V..P..............................................................LHN
ENSTNIP00000016215  .....GL..V..P..............................................................LHN
ENSTNIP00000020449  .....--..-..-..............................................................---
ENSTNIP00000000938  .....--..-..-..............................................................---
ENSTNIP00000000106  .....--..-..-..............................................................---
ENSTNIP00000011013  .....HQ..T..P..............................................................LHR
ENSTNIP00000022975  ....hGR..T..P..............................................................VHL
ENSTNIP00000001836  .....GR..N..G..............................................................LRV
ENSTNIP00000005054  .....--..-..-..............................................................---
ENSTNIP00000000636  .....--..-..-..............................................................---
ENSTNIP00000022060  .....GL..V..P..............................................................LHN
ENSTNIP00000017877  .....GD..R..A..............................................................VHH
ENSTNIP00000013825  .....GD..T..A..............................................................LHY
ENSTNIP00000007887  .....HR..T..P..............................................................LME
ENSTNIP00000006529  .....--..-..-..............................................................---
ENSTNIP00000013614  .....AL..T..A..............................................................LHV
ENSTNIP00000012342  .....GQ..C..A..............................................................LVH
ENSTNIP00000010055  .....DQ..T..A..............................................................VHR
ENSTNIP00000002777  .....RR..T..A..............................................................LHW
ENSTNIP00000015489  .....GR..S..A..............................................................LHR
ENSTNIP00000001972  .....GR..T..A..............................................................IHL
ENSTNIP00000004254  .....GR..T..A..............................................................IHL
ENSTNIP00000020780  .....GT..T..A..............................................................LMV
ENSTNIP00000020505  .....EQ..T..A..............................................................LLL
ENSTNIP00000019489  .....YQ..S..P..............................................................LHL
ENSTNIP00000001972  .....KR..T..P..............................................................LHA
ENSTNIP00000022060  .....GL..I..P..............................................................LHN
ENSTNIP00000020274  .....--..-..-..............................................................---
ENSTNIP00000011600  .....GA..S..V..............................................................LTM
ENSTNIP00000020643  .....QD..S..P..............................................................LIA
ENSTNIP00000008767  .....--..-..-..............................................................---
ENSTNIP00000008004  .....GN..T..A..............................................................LHI
ENSTNIP00000020403  .....--..-..-..............................................................---
ENSTNIP00000005775  .....NS..T..P..............................................................LRA
ENSTNIP00000016350  .....LQ..T..P..............................................................LHL
ENSTNIP00000006475  .....LR..T..P..............................................................LVE
ENSTNIP00000004288  .....GL..T..A..............................................................LHQ
ENSTNIP00000007797  .....NV..T..L..............................................................LHW
ENSTNIP00000010973  .....GL..T..A..............................................................LHQ
ENSTNIP00000009851  .....GL..T..A..............................................................LHQ
ENSTNIP00000003355  .....YK..R..P..............................................................LHE
ENSTNIP00000013324  .....GL..T..P..............................................................LHL
ENSTNIP00000002256  .....QD..S..P..............................................................LVA
ENSTNIP00000015625  .....GL..T..A..............................................................LHQ
ENSTNIP00000001122  .....GL..T..A..............................................................LHQ
ENSTNIP00000016215  .....GL..I..P..............................................................LHN
ENSTNIP00000000847  .....WL..T..P..............................................................LHR
ENSTNIP00000000101  .....GR..S..A..............................................................LHL
ENSTNIP00000019171  .....GL..T..A..............................................................LHQ
ENSTNIP00000003589  .....GL..T..A..............................................................LHQ
ENSTNIP00000021546  .....RR..A..A..............................................................LHL
ENSTNIP00000016214  .....GL..I..P..............................................................LHN
ENSTNIP00000008096  .....SI..T..P..............................................................LHE
ENSTNIP00000021658  .....NE..S..P..............................................................LLI
ENSTNIP00000009879  .....GF..T..A..............................................................LHR
ENSTNIP00000009476  ....gGF..T..A..............................................................LHY
ENSTNIP00000020961  .....GN..S..A..............................................................LHI
ENSTNIP00000014947  .....GA..T..V..............................................................LHL
ENSTNIP00000020962  .....GN..S..A..............................................................LHI
ENSTNIP00000003486  .....GQ..T..P..............................................................MHM
ENSTNIP00000002157  .....GQ..T..P..............................................................MHM
ENSTNIP00000022028  .....GQ..T..P..............................................................MHM
ENSTNIP00000009270  .....GCm.R..P..............................................................LHY
ENSTNIP00000009271  .....GCm.R..P..............................................................LHY
ENSTNIP00000005251  .....YQ..T..P..............................................................LHL
ENSTNIP00000005250  .....YQ..T..P..............................................................LHL
ENSTNIP00000002767  .....GQ..T..P..............................................................MHM
ENSTNIP00000005249  .....YQ..T..P..............................................................LHL
ENSTNIP00000017214  .....KR..S..L..............................................................LHI
ENSTNIP00000018491  .....GN..R..A..............................................................FAL
ENSTNIP00000001443  .....GR..S..A..............................................................FHL
ENSTNIP00000012425  .....GR..S..A..............................................................FHL
ENSTNIP00000000418  .....GR..S..A..............................................................FHL
ENSTNIP00000011989  .....GK..S..A..............................................................LHV
ENSTNIP00000019096  .....SI..T..P..............................................................LHE
ENSTNIP00000022908  .....GR..S..A..............................................................FHL
ENSTNIP00000021546  .....GG..TapA..............................................................LHA
ENSTNIP00000001350  .....GF..T..P..............................................................LMI
ENSTNIP00000022034  .....GC..F..P..............................................................LHL
ENSTNIP00000003225  .....GF..T..P..............................................................LMI
ENSTNIP00000004105  .....GF..T..P..............................................................LMI
ENSTNIP00000010006  .....GF..T..P..............................................................LMI
ENSTNIP00000014371  .....GC..F..P..............................................................LHL
ENSTNIP00000017023  .....GM..R..P..............................................................LHY
ENSTNIP00000015550  .....GC..Y..P..............................................................LHL
ENSTNIP00000004821  .....GC..Y..P..............................................................LHL
ENSTNIP00000018664  .....GF..T..P..............................................................LMI
ENSTNIP00000020926  .....GR..T..P..............................................................LHY
ENSTNIP00000011335  .....GI..T..A..............................................................LHE
ENSTNIP00000004556  .....NV..T..L..............................................................LHW
ENSTNIP00000013317  .....KW..T..A..............................................................THE
ENSTNIP00000009417  .....RV..Y..P..............................................................LML
ENSTNIP00000021733  .....GF..T..P..............................................................LML
ENSTNIP00000003914  .....GF..P..L..............................................................MLA
ENSTNIP00000022373  .....GR..T..P..............................................................AMM
ENSTNIP00000011405  .....GQ..T..P..............................................................LHL
ENSTNIP00000016960  .....RV..S..P..............................................................LHA
ENSTNIP00000007293  ....vGM..R..P..............................................................LHY
ENSTNIP00000008146  ....vGM..R..P..............................................................LHY
ENSTNIP00000016915  .....LV..S..P..............................................................LHE
ENSTNIP00000020652  .....GI..T..A..............................................................LHQ
ENSTNIP00000020964  .....GL..N..A..............................................................LHL
ENSTNIP00000015802  .....--..-..-..............................................................LYT
ENSTNIP00000011405  .....GW..S..L..............................................................LHK
ENSTNIP00000002262  .....HT..S..A..............................................................LFA
ENSTNIP00000019154  .....HT..S..A..............................................................LFA
ENSTNIP00000015812  ....sGE..T..P..............................................................LTV
ENSTNIP00000018163  .....--..-..-..............................................................---
ENSTNIP00000006897  .....GN..T..A..............................................................LHD
ENSTNIP00000011305  .....NR..T..A..............................................................LHI
ENSTNIP00000016930  .....GG..S..L..............................................................LHL
ENSTNIP00000019629  .....GF..T..P..............................................................LHY
ENSTNIP00000000664  .....GG..S..L..............................................................LHL
ENSTNIP00000005820  .....QV..T..P..............................................................LHE
ENSTNIP00000005228  .....GA..T..A..............................................................LWC
ENSTNIP00000007470  .....--..-..-..............................................................---
ENSTNIP00000011306  .....NR..T..A..............................................................LHI
ENSTNIP00000004387  .....GK..T..P..............................................................LHV
ENSTNIP00000000847  .....AF..S..P..............................................................LHC
ENSTNIP00000001107  .....--..-..-..............................................................LKR
ENSTNIP00000021112  ....tGE..T..P..............................................................LSL
ENSTNIP00000017960  ....tGE..T..P..............................................................LSL
ENSTNIP00000005432  ...sgAE..C..P..............................................................LTL
ENSTNIP00000000101  .....LF..T..P..............................................................LHC
ENSTNIP00000013166  .....GQ..T..A..............................................................LQI
ENSTNIP00000002306  .....GQ..T..A..............................................................LHL
ENSTNIP00000018558  .....--..-..-..............................................................---
ENSTNIP00000001438  .....--..-..-..............................................................LKR
ENSTNIP00000021633  .....GK..T..A..............................................................LLV
ENSTNIP00000022373  .....--..-..-..............................................................---
ENSTNIP00000011850  .....GE..S..L..............................................................LCL
ENSTNIP00000008855  .....--..-..-..............................................................---
ENSTNIP00000007188  .....GK..T..A..............................................................LQV
ENSTNIP00000004671  .....--..-..-..............................................................---
ENSTNIP00000004034  .....--..-..-..............................................................LKR
ENSTNIP00000018931  .....--..-..-..............................................................---
ENSTNIP00000010671  .....--..-..-..............................................................---
ENSTNIP00000013098  .....--..-..-..............................................................---
ENSTNIP00000016922  .....--..-..-..............................................................---
ENSTNIP00000021111  ....tGE..C..P..............................................................LTL
ENSTNIP00000003381  .....--..-..-..............................................................---
ENSTNIP00000020505  .....GL..T..P..............................................................LHE
ENSTNIP00000018712  .....--..-..-..............................................................---
ENSTNIP00000021261  .....--..-..-..............................................................---
ENSTNIP00000022919  .....--..-..-..............................................................---
ENSTNIP00000010298  .....--..-..-..............................................................---
ENSTNIP00000019340  .....--..-..-..............................................................---
ENSTNIP00000019537  .....--..-..-..............................................................---
ENSTNIP00000012849  .....--..-..-..............................................................---
ENSTNIP00000021203  .....--..-..-..............................................................---
ENSTNIP00000016430  .....--..-..-..............................................................---
ENSTNIP00000021749  .....--..-..-..............................................................---
ENSTNIP00000003121  .kaspGW..T..P..............................................................LHL
ENSTNIP00000018281  .kaspGW..T..P..............................................................LHL
ENSTNIP00000002757  .....--..-..-..............................................................---
ENSTNIP00000017905  .....--..-..-..............................................................---
ENSTNIP00000016177  .....--..-..-..............................................................---
ENSTNIP00000004254  .....--..-..-..............................................................---
ENSTNIP00000004505  .....--..-..-..............................................................---
ENSTNIP00000007098  .....GIagT..P..............................................................LHA
ENSTNIP00000018860  .....GIpvT..P..............................................................LRT
ENSTNIP00000018861  .....GIpvT..P..............................................................LRT
ENSTNIP00000011013  .....GN..V..P..............................................................LHC
ENSTNIP00000004254  .....GR..T..C..............................................................LHA
ENSTNIP00000018753  .....--..-..-..............................................................---
ENSTNIP00000003344  ....fKH..T..P..............................................................THS
ENSTNIP00000011405  .....DQ..T..V..............................................................LGL
ENSTNIP00000017191  .....--..-..-..............................................................---
ENSTNIP00000020431  .....--..-..-..............................................................---
ENSTNIP00000011744  ccgclPC..T..P..............................................................LRI
ENSTNIP00000014438  .....GY..T..A..............................................................QHY
ENSTNIP00000022060  .....--..-..-..............................................................---
ENSTNIP00000005333  ....sGD..T..P..............................................................LIA
ENSTNIP00000014824  .....--..-..-..............................................................---
ENSTNIP00000009879  .....--..-..P..............................................................LHL
ENSTNIP00000001972  .....--..-..A..............................................................LHY
ENSTNIP00000008197  .....GR..T..G..............................................................LHL
ENSTNIP00000008859  .....GN..T..A..............................................................LIT
ENSTNIP00000001888  .....GY..T..A..............................................................LHE
ENSTNIP00000008457  .....GN..T..A..............................................................LIT
ENSTNIP00000019974  .....GY..T..A..............................................................LHE
ENSTNIP00000016215  .....-E..T..A..............................................................LHC
ENSTNIP00000012669  .....--..-..-..............................................................---
ENSTNIP00000014343  .....--..-..-..............................................................---
ENSTNIP00000009374  .....--..-..-..............................................................---
ENSTNIP00000013843  .....--..-..-..............................................................---
ENSTNIP00000019152  .....--..-..-..............................................................---
ENSTNIP00000019800  .....--..-..-..............................................................---
ENSTNIP00000011128  .....GE..T..A..............................................................LHI
ENSTNIP00000016214  .....--..-..-..............................................................---
ENSTNIP00000003581  .....--..-..-..............................................................---
ENSTNIP00000009375  .....--..-..-..............................................................---
ENSTNIP00000019856  .....QL..T..P..............................................................AGL
ENSTNIP00000017493  ....fKH..T..P..............................................................THS
ENSTNIP00000004637  .....GN..T..A..............................................................LIT
ENSTNIP00000000199  .....--..-..-..............................................................---
ENSTNIP00000014598  .....--..-..-..............................................................---
ENSTNIP00000022443  .....GE..T..P..............................................................LMV
ENSTNIP00000021145  .....--..-..-..............................................................---
ENSTNIP00000016530  .....GQ..T..P..............................................................LMV
ENSTNIP00000001856  .....GI..T..A..............................................................LHN
ENSTNIP00000003340  .....GI..T..A..............................................................LHN
ENSTNIP00000003075  .....GI..T..A..............................................................LHN
ENSTNIP00000011507  .....GI..T..A..............................................................LHN
ENSTNIP00000021687  .....GR..T..A..............................................................LHF
ENSTNIP00000004278  .....--..-..-..............................................................---
ENSTNIP00000018637  .....--..-..-..............................................................---
ENSTNIP00000011193  .....GM..T..P..............................................................LMY
ENSTNIP00000015635  .....GM..T..P..............................................................LMY
ENSTNIP00000006573  .....--..-..-..............................................................---
ENSTNIP00000005633  .....--..-..-..............................................................---
ENSTNIP00000005157  .....GQ..T..L..............................................................LNW
ENSTNIP00000019463  .....GI..T..P..............................................................LHN
ENSTNIP00000015383  .....--..-..-..............................................................---
ENSTNIP00000017006  ....lSN..A..P..............................................................LLC
ENSTNIP00000004078  .....GI..T..A..............................................................LHN
ENSTNIP00000007396  .....GI..T..A..............................................................LHN
ENSTNIP00000018125  .....GN..T..A..............................................................LMI
ENSTNIP00000013051  .....--..-..-..............................................................---
ENSTNIP00000002932  .....--..-..-..............................................................---
ENSTNIP00000005133  .....--..-..-..............................................................---
ENSTNIP00000018052  .....GY..C..A..............................................................LHE
ENSTNIP00000002528  .....--..-..-..............................................................---
ENSTNIP00000017494  .....--..-..-..............................................................---
ENSTNIP00000020678  .....--..-..-..............................................................---
ENSTNIP00000002762  .....GY..C..A..............................................................LHE
ENSTNIP00000017148  .....--..-..-..............................................................---
ENSTNIP00000022679  .....--..-..-..............................................................---
ENSTNIP00000016402  .....--..-..-..............................................................LFK
ENSTNIP00000014119  .....--..-..-..............................................................---
ENSTNIP00000005520  .....--..-..-..............................................................---
ENSTNIP00000009225  .....--..-..-..............................................................---
ENSTNIP00000000650  .....--..-..-..............................................................---
ENSTNIP00000016194  .....GQ..T..A..............................................................LHQ
ENSTNIP00000023095  .....--..-..-..............................................................---
ENSTNIP00000019373  .....GI..T..S..............................................................LHN
ENSTNIP00000007443  .....--..-..-..............................................................---
ENSTNIP00000012036  .....NE..T..C..............................................................LHV
ENSTNIP00000002856  .....--..-..-..............................................................---
ENSTNIP00000011373  .....--..-..-..............................................................---
ENSTNIP00000017385  .....GM..T..A..............................................................LLY
ENSTNIP00000016007  .....--..-..-..............................................................---
ENSTNIP00000018968  .....--..-..-..............................................................---
ENSTNIP00000016756  .....--..-..-..............................................................---
ENSTNIP00000022850  .....--..-..-..............................................................---
ENSTNIP00000011921  .....--..-..-..............................................................---
ENSTNIP00000015620  .....--..-..-..............................................................---
ENSTNIP00000015621  .....--..-..-..............................................................---
ENSTNIP00000018971  .....GQ..T..A..............................................................LHI
ENSTNIP00000019525  ....tGF..T..C..............................................................LHW
ENSTNIP00000017519  ....tGF..T..C..............................................................LHW
ENSTNIP00000002927  .....--..-..-..............................................................---
ENSTNIP00000007442  .....--..-..-..............................................................---
ENSTNIP00000018523  .....--..-..-..............................................................---
ENSTNIP00000018573  .....--..-..-..............................................................---
ENSTNIP00000018967  .....--..-..-..............................................................---
ENSTNIP00000009206  .....GK..T..A..............................................................LLK
ENSTNIP00000011337  .....GR..T..A..............................................................LHL
ENSTNIP00000011338  .....GR..T..A..............................................................LHL
ENSTNIP00000013404  .....GN..T..P..............................................................LHL
ENSTNIP00000020298  .....--..-..-..............................................................---
ENSTNIP00000011339  .....GR..T..A..............................................................LHL
ENSTNIP00000022519  .....--..-..-..............................................................---
ENSTNIP00000012880  .....GQ..N..A..............................................................LQL
ENSTNIP00000011355  .....--..-..-..............................................................---
ENSTNIP00000015560  .....--..-..-..............................................................---
ENSTNIP00000019851  .....--..-..-..............................................................---
ENSTNIP00000018795  .....--..-..-..............................................................---
ENSTNIP00000002487  .....--..-..-..............................................................---
ENSTNIP00000015606  .....--..-..-..............................................................---
ENSTNIP00000004513  .....--..-..P..............................................................LHF
ENSTNIP00000011764  .....--..-..-..............................................................---
ENSTNIP00000022664  .....--..-..-..............................................................---
ENSTNIP00000005233  .....--..-..-..............................................................---
ENSTNIP00000004058  .....--..-..-..............................................................---
ENSTNIP00000005705  .....--..-..-..............................................................---
ENSTNIP00000021608  .....KN..T..A..............................................................LHL
ENSTNIP00000005234  .....--..-..-..............................................................---
ENSTNIP00000015738  .....GR..D..A..............................................................ITI
ENSTNIP00000014183  .....GR..S..A..............................................................LLI
ENSTNIP00000016122  .....--..-..P..............................................................LHF
ENSTNIP00000017007  .....--..-..-..............................................................---
ENSTNIP00000009570  .....--..-..-..............................................................---
ENSTNIP00000000064  .....GQ..N..A..............................................................LQL
ENSTNIP00000008592  .....GQ..N..A..............................................................LQL
ENSTNIP00000003464  .....GH..N..A..............................................................LQL
ENSTNIP00000009671  .....--..-..-..............................................................---
ENSTNIP00000022235  .....GH..N..A..............................................................LQL
ENSTNIP00000015515  .....--..-..-..............................................................---
ENSTNIP00000009474  .....ET..N..P..............................................................AIL
ENSTNIP00000012823  .....GR..T..A..............................................................LLI
ENSTNIP00000005275  .....GM..T..L..............................................................LHL
ENSTNIP00000021054  .....NS..T..P..............................................................LYY
ENSTNIP00000006242  .....--..-..-..............................................................---
ENSTNIP00000007859  .....--..-..-..............................................................---
ENSTNIP00000005228  .....--..-..-..............................................................---
ENSTNIP00000003152  .....--..-..-..............................................................---
ENSTNIP00000021405  .....--..-..-..............................................................---
ENSTNIP00000004004  .....--..-..-..............................................................---
ENSTNIP00000017490  .....--..-..-..............................................................---
ENSTNIP00000003748  .....ET..N..P..............................................................AIL
ENSTNIP00000019574  .....HP..S..A..............................................................ALG
ENSTNIP00000019868  .....--..-..-..............................................................---
ENSTNIP00000019867  .....--..-..-..............................................................---
ENSTNIP00000020790  .....--..-..-..............................................................---
ENSTNIP00000009879  .....--..-..-..............................................................---
ENSTNIP00000000101  .....--..-..-..............................................................---
ENSTNIP00000005477  .....--..-..-..............................................................---
ENSTNIP00000007556  .....--..-..-..............................................................---
ENSTNIP00000014109  .....--..-..-..............................................................---
ENSTNIP00000017432  .....--..-..-..............................................................---
ENSTNIP00000009570  .....--..-..-..............................................................---
ENSTNIP00000006306  .....--..-..-..............................................................---
ENSTNIP00000006163  .....--..-..-..............................................................---
ENSTNIP00000015769  .....--..-..-..............................................................---
ENSTNIP00000015422  .....--..-..-..............................................................---
ENSTNIP00000019364  .....--..-..-..............................................................---
ENSTNIP00000014874  .....GH..T..P..............................................................SAV
ENSTNIP00000001049  .....--..-..-..............................................................---
ENSTNIP00000014843  .....--..-..-..............................................................---
ENSTNIP00000016727  .....ES..L..L..............................................................YQV
ENSTNIP00000006578  .....--..-..-..............................................................---
ENSTNIP00000007406  .....--..-..-..............................................................---


                      0                                     90                                      
                      |                                      |                                      
d1s70b_               ACID...D..NV........................DMVKFLVE...N......G.A.....................
ENSTNIP00000018931  ASKY...G..KV........................DVAELLLE...R......G.A.....................
ENSTNIP00000004671  ASKY...G..QV........................GVAELLLD...R......G.A.....................
ENSTNIP00000008004  ASKY...G..QV........................GVAELLLD...R......G.A.....................
ENSTNIP00000017432  AAKY...G..NM........................EVANLLLQ...K......N.A.....................
ENSTNIP00000020962  ASRL...G..KT........................DIVQLLLQ...H......M.A.....................
ENSTNIP00000020961  ASRL...G..KT........................DIVQLLLQ...H......M.A.....................
ENSTNIP00000020964  ASRL...G..KT........................DIVQLLLQ...H......M.A.....................
ENSTNIP00000020160  SSRL...G..KV........................DIVQQLLQ...C......G.A.....................
ENSTNIP00000022654  SSRL...G..KV........................DIVQQLLQ...C......G.A.....................
ENSTNIP00000007965  ASKY...G..SL........................EVAQLLLR...R......G.A.....................
ENSTNIP00000020160  AAHY...G..NI........................NVATLLLN...R......G.A.....................
ENSTNIP00000022654  AAHY...G..NI........................NVATLLLN...R......G.A.....................
ENSTNIP00000004254  AAFM...G..HL........................NVVRLLVT...Q......G.A.....................
ENSTNIP00000015489  AAYL...G..HV........................DVVKLLVS...R......S.A.....................
ENSTNIP00000009879  ACYT...G..QD........................TVANELVN...C......G.A.....................
ENSTNIP00000007449  AAYK...G..RV........................EVTELLLQ...H......G.A.....................
ENSTNIP00000005052  AAYK...G..RV........................EVTELLLQ...H......G.A.....................
ENSTNIP00000001326  AAYK...G..RV........................EVTELLLQ...H......G.A.....................
ENSTNIP00000020926  AAFS...G..HV........................EMVKLLLS...R......G.A.....................
ENSTNIP00000022840  AAYK...G..RV........................EVTELLLQ...H......G.A.....................
ENSTNIP00000004030  AAYK...G..RT........................DVADLLLD...K......G.A.....................
ENSTNIP00000020447  AAYK...G..RT........................DVADLLLD...K......G.A.....................
ENSTNIP00000002067  AAGR...G..HA........................EIVHLLLQ...H......G.A.....................
ENSTNIP00000003481  AAGR...G..HA........................EIVHLLLQ...H......G.A.....................
ENSTNIP00000001972  ACFN...G..QD........................MVASELID...C......G.A.....................
ENSTNIP00000001668  AAYK...G..RT........................DVADLLLD...K......G.A.....................
ENSTNIP00000000101  AAVS...G..QL........................DVIKYLLR...V......V.S.....................
ENSTNIP00000000847  AALS...G..FS........................DCCRKLLS...S......G.F.....................
ENSTNIP00000021608  AAAN...K..AV........................RCAEALVP...L......L.S.....................
ENSTNIP00000011850  AACG...G..HV........................ELAALLIE...R......G.A.....................
ENSTNIP00000011850  ACSG...G..RQ........................EVVELLLL...R......G.A.....................
ENSTNIP00000010597  AAQN...G..DD........................RTVRLLLD...K......G.A.....................
ENSTNIP00000018931  ASRR...G..NV........................IMVRLLLD...R......G.A.....................
ENSTNIP00000021608  AALS...G..FS........................DCCRKLLS...S......G.F.....................
ENSTNIP00000021608  AATN...G..HS........................ECLRLLIG...Nsdl...Q.S.....................
ENSTNIP00000004671  ASRR...G..NV........................MMVRLLLD...R......G.A.....................
ENSTNIP00000008004  ASRR...G..NV........................MMVRLLLD...R......G.A.....................
ENSTNIP00000000651  AALR...G..HM........................EVVKFLIQ...C......D.Wapgqqqqqqspqsqqqaaltk
ENSTNIP00000017452  AALR...G..HM........................EVVKFLIQ...C......D.Wapgqqqqqqspqsqqqaaltk
ENSTNIP00000020962  ASKR...G..NT........................NMVALLLD...R......G.A.....................
ENSTNIP00000020961  ASKR...G..NT........................NMVALLLD...R......G.A.....................
ENSTNIP00000019592  AALR...G..HL........................DIIQFLLQ...L......E.Wsseglqqdcalknkalqqafi
ENSTNIP00000007965  ASKR...G..NT........................NMVGLLLD...R......S.S.....................
ENSTNIP00000018708  AARY...G..NV........................DVVGYLCS...I......R.A.....................
ENSTNIP00000011422  AAQN...G..DE........................AIARLLLD...R......G.A.....................
ENSTNIP00000017008  AAQR...G..HI........................EVLCYLLR...N......A.Dwsctpccsqkaaskdqavqqa
ENSTNIP00000020964  ASKR...G..NT........................NMVALLLD...R......G.A.....................
ENSTNIP00000012589  AIIH...E..AT........................DHAHQMIRlshH......H.P.....................
ENSTNIP00000007468  AVSR...N..NV........................EICEMLLK...A......G.A.....................
ENSTNIP00000015489  AAAN...G..RY........................QCTVALVS...A......G.A.....................
ENSTNIP00000020926  GVVT...G..QE........................DCVEALLQ...R......G.A.....................
ENSTNIP00000016214  ACSY...G..HY........................EVAELLVR...H......G.A.....................
ENSTNIP00000016215  ACSY...G..HY........................EVAELLVR...H......G.A.....................
ENSTNIP00000020449  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000000938  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000000106  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000011013  ATIF...D..HT........................ELAEYLIS...L......G.A.....................
ENSTNIP00000022975  AVMN...G..HT........................SCVRLLLD...Dsd....G.A.....................
ENSTNIP00000001836  AALE...G..HR........................DIVELLLS...H......G.A.....................
ENSTNIP00000005054  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000000636  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000022060  ACSY...G..HY........................EVAELLVR...H......G.A.....................
ENSTNIP00000017877  AAFG...D..EG........................SVIEVLQR...G......G.A.....................
ENSTNIP00000013825  TAFG...N..QA........................EIARLLLS...K......G.A.....................
ENSTNIP00000007887  ACEN...N..HM........................ETVLYLLR...A......G.A.....................
ENSTNIP00000006529  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000013614  ATLA...G..HH........................EATDILLQ...H......G.A.....................
ENSTNIP00000012342  AALK...G..HA........................EIISIFLG...Q......D.Wgaemtsdaqqqqpgdqnvtqk
ENSTNIP00000010055  AAMV...G..NA........................AVIRALLR...E......G.C.....................
ENSTNIP00000002777  ACSA...G..HT........................DIVEFLLD...V......G.A.....................
ENSTNIP00000015489  GAVL...G..HD........................DCVTVLLE...H......Q.A.....................
ENSTNIP00000001972  AAAR...G..HA........................SWLSELLN...I......A.C.....................
ENSTNIP00000004254  AAAR...G..HA........................SWLSELLN...I......A.C.....................
ENSTNIP00000020780  ASYN...G..HC........................ECARELIM...Q......G.A.....................
ENSTNIP00000020505  AVSG...Q..HL........................SCARCLLE...G......G.A.....................
ENSTNIP00000019489  ATYL...N..LT........................PVVRELME...K......G.A.....................
ENSTNIP00000001972  AAFL...G..DA........................EIAELLIL...S......G.A.....................
ENSTNIP00000022060  ACSF...G..HA........................EVVSLLLC...H......G.A.....................
ENSTNIP00000020274  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000011600  AARG...G..HT........................HVVKLLLE...N......A.A.....................
ENSTNIP00000020643  AIRS...D..CK........................DLVQLLLL...Q......G.A.....................
ENSTNIP00000008767  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000008004  AALA...G..QE........................KVVAELIN...Y......G.A.....................
ENSTNIP00000020403  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000005775  ACFD...G..HL........................DIVKYLVE...H......K.A.....................
ENSTNIP00000016350  AVIT...R..QV........................KVVELLLR...A......G.V.....................
ENSTNIP00000006475  AIIN...N..HI........................EVARYLIQ...N......G.A.....................
ENSTNIP00000004288  CCID...D..FV........................EVVQCLLD...A......G.A.....................
ENSTNIP00000007797  AAIN...N..RI........................DLVKYYIS...K......G.A.....................
ENSTNIP00000010973  CCID...D..FV........................EVVQCLLD...A......G.A.....................
ENSTNIP00000009851  CCID...N..YE........................EMVKILLD...R......G.A.....................
ENSTNIP00000003355  AASM...S..HQ........................DCVSYLLQ...E......G.A.....................
ENSTNIP00000013324  ACQR...G..HQ........................GVTLLLLH...Y......Q.A.....................
ENSTNIP00000002256  AILN...D..QY........................DLATLLLR...Y......R.A.....................
ENSTNIP00000015625  ACID...D..NV........................DMVTFLVE...H......G.A.....................
ENSTNIP00000001122  ACID...E..NA........................EMVQFLVE...S......G.S.....................
ENSTNIP00000016215  ACSF...G..HS........................EVVSPLLC...K......G.P.....................
ENSTNIP00000000847  AVAS...C..SE........................DAVAALLK...H......S.A.....................
ENSTNIP00000000101  AARR...G..FA........................PCVEVLLK...H......Q.A.....................
ENSTNIP00000019171  ACID...E..NA........................EMVQFLVE...S......G.S.....................
ENSTNIP00000003589  ACID...E..NA........................EMVQFLVE...S......G.S.....................
ENSTNIP00000021546  AAQK...G..NI........................RFLKLLLS...R......R.A.....................
ENSTNIP00000016214  ACSF...G..HS........................EVVSPLLC...K......G.P.....................
ENSTNIP00000008096  ACVR...G..QV........................ECVRLLLE...A......G.A.....................
ENSTNIP00000021658  AVRQ...R..SY........................DMVQSLVL...G......G.A.....................
ENSTNIP00000009879  AAML...G..CE........................GCVSALLE...H......G.A.....................
ENSTNIP00000009476  AAMH...G..RA........................RIARLMLE...S......D.Y.....................
ENSTNIP00000020961  ASLA...G..QK........................EVVRLLVK...R......G.A.....................
ENSTNIP00000014947  ASRF...S..HH........................QITDWLLK...S......GeG.....................
ENSTNIP00000020962  ASLA...G..QK........................EVVRLLVK...R......G.A.....................
ENSTNIP00000003486  AAKH...D..SP........................AVIQVMCS...R......M.C.....................
ENSTNIP00000002157  AAKH...D..SP........................AVIQVMCS...R......M.C.....................
ENSTNIP00000022028  AAKH...D..SP........................AVIQVMCS...R......M.C.....................
ENSTNIP00000009270  AAWQ...G..KA........................ESVLTLLR...A......G.A.....................
ENSTNIP00000009271  AAWQ...G..KA........................ESVLTLLR...A......G.A.....................
ENSTNIP00000005251  AVLT...Q..QR........................EAVQALLL...A......G.A.....................
ENSTNIP00000005250  AVLT...Q..QR........................EAVQALLL...A......G.A.....................
ENSTNIP00000002767  AAKH...D..SP........................AVIQVMCS...R......M.C.....................
ENSTNIP00000005249  AVLT...Q..QR........................EAVQALLL...A......G.A.....................
ENSTNIP00000017214  AANC...G..SV........................ECLVLLLR...R......G.A.....................
ENSTNIP00000018491  AADN...G..CV........................NMLEVLRE...Qy.....N.M.....................
ENSTNIP00000001443  AATR...G..HL........................DCLNLILA...H......N.V.....................
ENSTNIP00000012425  AATR...G..HL........................DCLNLILA...H......N.V.....................
ENSTNIP00000000418  AATR...G..HL........................DCLNLILA...H......N.V.....................
ENSTNIP00000011989  AAAR...G..QS........................DCLAVLLA...H......S.A.....................
ENSTNIP00000019096  ACIR...G..QA........................QCVRLLLG...A......G.A.....................
ENSTNIP00000022908  AATR...G..HL........................DCLNLILA...H......N.V.....................
ENSTNIP00000021546  TSLS...G..HV........................STVKLLLE...R......G.A.....................
ENSTNIP00000001350  ASCS...G..GGletgnseeeedpsa..........EIITDFIY...Q......G.A.....................
ENSTNIP00000022034  AAWR...G..DV........................DIVRILIH...H......G.P.....................
ENSTNIP00000003225  ASCS...G..GGletgnseeeedpsa..........EIITDFIY...Q......G.A.....................
ENSTNIP00000004105  ASCS...G..GGletgnseeeedpsa..........EIITDFIY...Q......G.A.....................
ENSTNIP00000010006  ASCS...G..GGletgnseeeedpsa..........EIITDFIY...Q......G.A.....................
ENSTNIP00000014371  AAWR...G..DV........................DIVRILIH...H......G.P.....................
ENSTNIP00000017023  AAWQ...G..KA........................P-MKMLLK...S......G.S.....................
ENSTNIP00000015550  AAWK...G..DE........................HIVKLLIH...Q......G.Pshpklneqssvdqkefkrcgp
ENSTNIP00000004821  AAWK...G..DE........................HIVKLLIH...Q......G.Pshpklneqssvdqkefkrcgp
ENSTNIP00000018664  ASCS...G..GGletgnseeeedasa..........NVINDFIY...Q......G.A.....................
ENSTNIP00000020926  ASAN...C..NY........................QCVFALGG...S......G.A.....................
ENSTNIP00000011335  SCEN...C..QP........................ECTKLLLS...H......G.A.....................
ENSTNIP00000004556  AAIN...N..RS........................ELVKYYIS...K......G.A.....................
ENSTNIP00000013317  AARL...G..RA........................DILMLLLR...N......G.G.....................
ENSTNIP00000009417  ASLR...N..GGvpdcnlhgdeeeesggdepgs...SVISDLIS...Q......G.A.....................
ENSTNIP00000021733  ASFC...G..GGfepevaedeeneecsa........HIISDLIY...Q......G.A.....................
ENSTNIP00000003914  SLRN...G..GVpdcnlhgdeeeesggdepgs....SVISDLIS...Q......G.A.....................
ENSTNIP00000022373  AAEL...G..ND........................TILGFLIE...N......E.A.....................
ENSTNIP00000011405  ASSW...G..LE........................EVVQCLLE...F......G.A.....................
ENSTNIP00000016960  ACVQ...G..HL........................ACAQLLIQ...N......G.A.....................
ENSTNIP00000007293  AAWQ...G..KT........................E-PKMLLK...A......G.S.....................
ENSTNIP00000008146  AAWQ...G..KT........................E-PKMLLK...A......G.S.....................
ENSTNIP00000016915  ACLG...G..HY........................ACAKFLLE...N......G.A.....................
ENSTNIP00000020652  ACID...G..SM........................EMVTFLLE...R......D.A.....................
ENSTNIP00000020964  AAKE...G..HK........................DLVEELLD...R......G.A.....................
ENSTNIP00000015802  ACSI...G..QY........................DVVAECIQ...Kp.....E.V.....................
ENSTNIP00000011405  AIQR...G..DE........................FASVFLIR...H......S.A.....................
ENSTNIP00000002262  AAQN...G..HT........................ERVKLLLS...S......G.S.....................
ENSTNIP00000019154  AAQN...G..HT........................ERVKLLLS...S......G.S.....................
ENSTNIP00000015812  ATQS...Gl.LM........................EGIKVLVQ...G......G.A.....................
ENSTNIP00000018163  ----...-..--........................DNVEDLIR...K......G.A.....................
ENSTNIP00000006897  ACIG...A..HA........................ACVQLLLA...H......G.A.....................
ENSTNIP00000011305  ACAS...G..HV........................EVVHFLLE...R......K.A.....................
ENSTNIP00000016930  CARH...D..NV........................FAAEVLIE...R......G.V.....................
ENSTNIP00000019629  AALH...G..NR........................ALVILFLS...N......G.A.....................
ENSTNIP00000000664  CARH...D..NV........................FAAEVLIE...R......G.V.....................
ENSTNIP00000005820  -CLS...G..HI........................ACVRALLS...S......G.A.....................
ENSTNIP00000005228  AAGA...G..HF........................EVVRLLVG...H......R.A.....................
ENSTNIP00000007470  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000011306  ACAS...G..HV........................EVVHFLLE...R......K.A.....................
ENSTNIP00000004387  ACEM...S..DA........................DCVALLLA...H......G.A.....................
ENSTNIP00000000847  AVIN...D..NE........................GVAEMLIE...Sm.....G.T.....................
ENSTNIP00000001107  AITN...G..DT........................ETVRQLLD...K......G.L.....................
ENSTNIP00000021112  AVQC...EpsGG........................EAIRVLVE...G......G.A.....................
ENSTNIP00000017960  AVQC...EpsGG........................EAIRVLVE...G......G.A.....................
ENSTNIP00000005432  AVQL...Ee.SS........................ELIKVLRN...G......G.A.....................
ENSTNIP00000000101  ALVN...G..HG........................VSAGLLLK...Av.....G.P.....................
ENSTNIP00000013166  AAAT...N..NH........................LIVRDLLT...H......G.A.....................
ENSTNIP00000002306  VISS...W..PRalpanhkstsnlktikdgecseamDCLQILCV...H......G.I.....................
ENSTNIP00000018558  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000001438  AITN...G..DT........................ETVRQLLD...K......G.L.....................
ENSTNIP00000021633  AVAA...N..QP........................EIVQDLLS...L......E.A.....................
ENSTNIP00000022373  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000011850  ACSA...G..YY........................ELAQVLLA...M......H.A.....................
ENSTNIP00000008855  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000007188  -MML...G..NC........................KIASLLLE...K......G.A.....................
ENSTNIP00000004671  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000004034  AITN...G..DT........................ETVRQLLD...K......G.L.....................
ENSTNIP00000018931  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000010671  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000013098  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000016922  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000021111  AAQLe..G..CA........................ELIKVLKN...G......G.A.....................
ENSTNIP00000003381  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000020505  ASRH...G..HT........................ETVSALLS...K......H.A.....................
ENSTNIP00000018712  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000021261  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000022919  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000010298  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000019340  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000019537  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000012849  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000021203  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000016430  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000021749  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000003121  ACSC...G..HR........................RVVEELLK...V......G.A.....................
ENSTNIP00000018281  ACSC...G..HR........................RVVEELLK...V......G.A.....................
ENSTNIP00000002757  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000017905  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000016177  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000004254  ----...-..--........................-CLEFLLQ...S......G.A.....................
ENSTNIP00000004505  ----...-..--........................-----LLN...S......-.-.....................
ENSTNIP00000007098  AVSK...G..NL........................SCLQVLLA...H......G.A.....................
ENSTNIP00000018860  AAAL...G..HL........................RCLEVLLE...H......G.A.....................
ENSTNIP00000018861  AAAL...G..HL........................RCLEVLLE...H......G.A.....................
ENSTNIP00000011013  AVEK...N..KL........................ESCRALLD...L......G.A.....................
ENSTNIP00000004254  AAAG...G..NV........................ECVKLLLS...S......G.G.....................
ENSTNIP00000018753  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000003344  AAMG...G..HA........................DCLVWLTQ...A......G.A.....................
ENSTNIP00000011405  ALWT...G..MH........................TIAAQLLG...S......G.A.....................
ENSTNIP00000017191  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000020431  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000011744  AATA...-..HA........................VCVAYLIS...Q......G.A.....................
ENSTNIP00000014438  ASGG...G..HV........................AVCAFLLE...V......G.A.....................
ENSTNIP00000022060  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000005333  ACRR...G..NL........................RAVQYLLD...N......G.A.....................
ENSTNIP00000014824  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000009879  AAYY...G..HC........................EALRLLCE...T......L.V.....................
ENSTNIP00000001972  AAAS...Dl.DR........................RCLEFLLQ...S......G.A.....................
ENSTNIP00000008197  AAAR...G..NV........................DICRLLHK...F......G.A.....................
ENSTNIP00000008859  AAQA...G..HI........................TITNYLLN...Yyl....G.L.....................
ENSTNIP00000001888  ASSR...G..WT........................QIVQMLLK...H......G.A.....................
ENSTNIP00000008457  AAQA...G..HI........................TITNYLLN...Yyl....G.L.....................
ENSTNIP00000019974  ASSR...G..WT........................QIVQMLLK...H......G.A.....................
ENSTNIP00000016215  AVAS...P..HPkrk.....................QVTELLLR...K......G.A.....................
ENSTNIP00000012669  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000014343  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000009374  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000013843  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000019152  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000019800  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000011128  AVMN...D..SL........................DAAVALMD...G......A.P.....................
ENSTNIP00000016214  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000003581  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000009375  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000019856  GVKN...G..HL........................ECVRWMVS...E......T.E.....................
ENSTNIP00000017493  AAMG...G..HA........................DCLVWLTQ...A......G.A.....................
ENSTNIP00000004637  AAQA...G..HM........................LISSYLLS...Yfp....G.L.....................
ENSTNIP00000000199  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000014598  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000022443  TCMS...T..HSdqqsvska................KIVKYLLD...N......Q.A.....................
ENSTNIP00000021145  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000016530  ACRT...-..--........................--------...-......-.-.....................
ENSTNIP00000001856  AVCA...G..HT........................EIVKFLVQ...F......G.V.....................
ENSTNIP00000003340  AVCA...G..HT........................EIVKFLVQ...F......G.V.....................
ENSTNIP00000003075  AVCA...G..HT........................EIVKFLVQ...F......G.V.....................
ENSTNIP00000011507  AVCA...G..HT........................EIVKFLVQ...F......G.V.....................
ENSTNIP00000021687  SSCN...G..NE........................SIVKLLLS...H......G.A.....................
ENSTNIP00000004278  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000018637  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000011193  ACVR...G..DE........................AMVQMLLD...A......G.A.....................
ENSTNIP00000015635  ACVR...G..DE........................AMVQMLLD...A......G.A.....................
ENSTNIP00000006573  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000005633  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000005157  ASAF...G..TQ........................EMVEFLCE...R......G.A.....................
ENSTNIP00000019463  AVCA...G..HH........................HIVKFLLD...F......G.V.....................
ENSTNIP00000015383  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000017006  AHAHl..G..HA........................DVVALLLD...Q......G.A.....................
ENSTNIP00000004078  AVCA...G..HA........................EIVKFLVQ...F......G.V.....................
ENSTNIP00000007396  AVCA...G..HA........................EIVKFLVQ...F......G.V.....................
ENSTNIP00000018125  AAQA...G..FV........................NILNYIIN...Fya....G.V.....................
ENSTNIP00000013051  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000002932  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000005133  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000018052  ACAR...G..WL........................TIVQHLLD...Y......G.A.....................
ENSTNIP00000002528  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000017494  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000020678  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000002762  ACAR...G..WL........................TIVQHLLD...Y......G.A.....................
ENSTNIP00000017148  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000022679  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000016402  VAER...G..LL........................GAAQVLLR...Y......G.A.....................
ENSTNIP00000014119  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000005520  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000009225  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000000650  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000016194  SVID...G..NL........................ELVKLLVN...F......G.A.....................
ENSTNIP00000023095  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000019373  AICG...G..HY........................NIVDFLVR...A......G.A.....................
ENSTNIP00000007443  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000012036  LCQG...P..QIlllsegalsprlarphrdeqrra.ECLQMILS...Wt.....G.Arleggqyeka...........
ENSTNIP00000002856  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000011373  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000017385  AAMH...N..HH........................LMVADLIR...L......G.A.....................
ENSTNIP00000016007  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000018968  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000016756  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000022850  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000011921  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000015620  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000015621  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000018971  AIER...R..CK........................QYVELLVE...K......G.A.....................
ENSTNIP00000019525  AAKQ...G..KA........................ELLSQLLA...FakenaiP.V.....................
ENSTNIP00000017519  AAKH...G..QP........................ELLALIFN...FakrnnvP.L.....................
ENSTNIP00000002927  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000007442  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000018523  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000018573  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000018967  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000009206  ALLNlrdG..KN........................DTVKVLLD...V......A.Artgdlqdli............
ENSTNIP00000011337  SCAM...A..NV........................VITQLLIW...Y......G.V.....................
ENSTNIP00000011338  SCAM...A..NV........................VITQLLIW...Y......G.V.....................
ENSTNIP00000013404  AVMM...G..HK........................ECAHLLLA...H......N.A.....................
ENSTNIP00000020298  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000011339  SCAM...A..NV........................VITQLLIW...Y......G.V.....................
ENSTNIP00000022519  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000012880  AVAN...E..HL........................EVTELLLG...R......A.D.....................
ENSTNIP00000011355  ----...-..--........................--------...-......-.H.....................
ENSTNIP00000015560  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000019851  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000018795  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000002487  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000015606  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000004513  LVWN...Nq.YL........................ELDRELQK...K......E.Q.....................
ENSTNIP00000011764  ----...-..--........................----EILK...R......G.C.....................
ENSTNIP00000022664  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000005233  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000004058  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000005705  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000021608  ACSK...G..HE........................TSALLILE...K......I.T.....................
ENSTNIP00000005234  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000015738  AIEN...E..NL........................DILQLLLD...H......G.C.....................
ENSTNIP00000014183  AIEN...E..NL........................EIMELLLD...H......G.I.....................
ENSTNIP00000016122  LVWN...N..QY........................LELDRELQ...K......K.E.....................
ENSTNIP00000017007  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000009570  ----...-..--........................-TLKLLLK...R......G.A.....................
ENSTNIP00000000064  AVAN...E..HL........................EVTELLLK...K......D.G.....................
ENSTNIP00000008592  AVAN...E..HL........................EVTELLLK...K......D.G.....................
ENSTNIP00000003464  AVAN...E..RL........................EITKLLLQ...K......K.E.....................
ENSTNIP00000009671  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000022235  AVAN...E..RL........................EITKLLLQ...K......K.E.....................
ENSTNIP00000015515  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000009474  AANS...G..HP........................NLVKELLD...-......-.-.....................
ENSTNIP00000012823  GIEN...E..NL........................EIIELLLS...F......G.V.....................
ENSTNIP00000005275  AAAQ...G..YT........................HLIHTLIH...W......K.V.....................
ENSTNIP00000021054  ACLC...G..HE........................ELVEYLLA...S......G.A.....................
ENSTNIP00000006242  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000007859  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000005228  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000003152  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000021405  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000004004  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000017490  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000003748  AANS...G..HP........................NLVKELLD...S......V.P.....................
ENSTNIP00000019574  ALLN...-..--........................--------...-......-.-.....................
ENSTNIP00000019868  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000019867  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000020790  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000009879  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000000101  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000005477  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000007556  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000014109  ----...-..--........................---TRCLK...R......G.C.....................
ENSTNIP00000017432  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000009570  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000006306  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000006163  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000015769  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000015422  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000019364  ----...-..--........................EIIELLLS...Y......N.V.....................
ENSTNIP00000014874  AALG...G..HR........................RL------...-......-.-.....................
ENSTNIP00000001049  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000014843  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000016727  CERG...G..PL........................ELAELLVR...R......G.A.....................
ENSTNIP00000006578  ----...-..--........................--------...-......-.-.....................
ENSTNIP00000007406  ----...-..--........................--------...-......-.-.....................


                                                                100                                 
                                                                  |                                 
d1s70b_               .....................................N.....INQ.........................P....DN
ENSTNIP00000018931  .....................................N.....PNA.........................A....GK
ENSTNIP00000004671  .....................................N.....ANA.........................A....GK
ENSTNIP00000008004  .....................................N.....ANA.........................A....GK
ENSTNIP00000017432  .....................................C.....PDA.........................A....GK
ENSTNIP00000020962  .....................................H.....PDA.........................A....TT
ENSTNIP00000020961  .....................................H.....PDA.........................A....TT
ENSTNIP00000020964  .....................................H.....PDA.........................A....TT
ENSTNIP00000020160  .....................................S.....ANA.........................A....TT
ENSTNIP00000022654  .....................................S.....ANA.........................A....TT
ENSTNIP00000007965  .....................................P.....PDC.........................A....GK
ENSTNIP00000020160  .....................................A.....VDF.........................M....AR
ENSTNIP00000022654  .....................................A.....VDF.........................M....AR
ENSTNIP00000004254  .....................................E.....VSC.........................K....DK
ENSTNIP00000015489  .....................................D.....KSC.........................K....DK
ENSTNIP00000009879  .....................................N.....INR.........................P....NR
ENSTNIP00000007449  .....................................N.....TNT.........................T....GQ
ENSTNIP00000005052  .....................................N.....TNT.........................T....GQ
ENSTNIP00000001326  .....................................N.....TNT.........................T....GQ
ENSTNIP00000020926  .....................................N.....INA.........................F....DK
ENSTNIP00000022840  .....................................N.....TNT.........................T....GQ
ENSTNIP00000004030  .....................................N.....PNI.........................T....GQ
ENSTNIP00000020447  .....................................N.....PNI.........................T....GQ
ENSTNIP00000002067  .....................................K.....VNC.........................S....DK
ENSTNIP00000003481  .....................................K.....VNC.........................S....DK
ENSTNIP00000001972  .....................................N.....VSQ.........................P....NN
ENSTNIP00000001668  .....................................N.....PNI.........................T....GQ
ENSTNIP00000000101  .....................................E.....IDD.........................S....NA
ENSTNIP00000000847  .....................................D.....IDT.........................P....DD
ENSTNIP00000021608  .....................................N.....VNV.........................S....DR
ENSTNIP00000011850  .....................................N.....LEE.........................V....ND
ENSTNIP00000011850  .....................................N.....KEH.........................R....NV
ENSTNIP00000010597  .....................................T.....PDT.........................R....EK
ENSTNIP00000018931  .....................................Q.....IDA.........................K....TK
ENSTNIP00000021608  .....................................D.....IDT.........................P....DD
ENSTNIP00000021608  .....................................A.....VDI.........................Q....DG
ENSTNIP00000004671  .....................................Q.....IDA.........................K....TK
ENSTNIP00000008004  .....................................Q.....IDA.........................K....TK
ENSTNIP00000000651  shavqqaliaaasmgyteivsylldlpekdeeeveraQ.....INN.........................F....DT
ENSTNIP00000017452  shavqqaliaaasmgyteivsylldlpekdeeeveraQ.....INN.........................F....DT
ENSTNIP00000020962  .....................................Q.....IDA.........................K....TR
ENSTNIP00000020961  .....................................Q.....IDA.........................K....TR
ENSTNIP00000019592  ..............aassmghtqvvrdllalnnehtvQ.....IDS.........................H....DT
ENSTNIP00000007965  .....................................Q.....IDA.........................K....TR
ENSTNIP00000018708  .....................................N.....PDL.........................A....DR
ENSTNIP00000011422  .....................................A.....INE.........................T....DG
ENSTNIP00000017008  .......ltaaasmghaqvvsylldlsgkddkngqspE.....INT.........................P....DS
ENSTNIP00000020964  .....................................Q.....IDA.........................K....TR
ENSTNIP00000012589  .....................................F.....LNV.........................Q....NH
ENSTNIP00000007468  .....................................K.....HNL.........................T....NV
ENSTNIP00000015489  .....................................E.....VNE.........................P....DQ
ENSTNIP00000020926  .....................................N.....VCV.........................R....DA
ENSTNIP00000016214  .....................................S.....VNV.........................A....DL
ENSTNIP00000016215  .....................................S.....VNV.........................A....DL
ENSTNIP00000020449  .....................................-.....---.........................-....--
ENSTNIP00000000938  .....................................-.....---.........................-....--
ENSTNIP00000000106  .....................................-.....---.........................-....--
ENSTNIP00000011013  .....................................D.....INC.........................V....DY
ENSTNIP00000022975  .....................................Dl....TDA.........................A....DS
ENSTNIP00000001836  .....................................D.....IDY.........................K....DA
ENSTNIP00000005054  .....................................-.....---.........................-....--
ENSTNIP00000000636  .....................................-.....---.........................-....--
ENSTNIP00000022060  .....................................S.....VNV.........................A....DL
ENSTNIP00000017877  .....................................D.....LNA.........................R....NK
ENSTNIP00000013825  .....................................N.....VNL.........................L....NN
ENSTNIP00000007887  .....................................N.....ATH.........................K....DV
ENSTNIP00000006529  .....................................-.....LNL.........................Q....NH
ENSTNIP00000013614  .....................................N.....VNV.........................Q....DA
ENSTNIP00000012342  ....tqavqqaltaaaslghtqvvknilelkdeqlavQ.....MDA.........................Q....DA
ENSTNIP00000010055  .....................................A.....LER.........................Q....DK
ENSTNIP00000002777  .....................................E.....VNL.........................Q....DD
ENSTNIP00000015489  .....................................S.....ALS.........................R....DA
ENSTNIP00000001972  .....................................AeasslPVL.........................R....DL
ENSTNIP00000004254  .....................................AeasslPVL.........................R....DL
ENSTNIP00000020780  .....................................D.....INY.........................Q....RE
ENSTNIP00000020505  .....................................D.....PDI.........................S....SK
ENSTNIP00000019489  .....................................S.....LEL.........................Q....DR
ENSTNIP00000001972  .....................................R.....VNA.........................K....DS
ENSTNIP00000022060  .....................................D.....PNA.........................R....DN
ENSTNIP00000020274  .....................................-.....---.........................-....--
ENSTNIP00000011600  .....................................C.....VDDcppgfgg..................R....EL
ENSTNIP00000020643  .....................................K.....VDQ.........................E....VC
ENSTNIP00000008767  .....................................-.....---.........................-....--
ENSTNIP00000008004  .....................................N.....VNA.........................Q....SH
ENSTNIP00000020403  .....................................-.....---.........................-....--
ENSTNIP00000005775  .....................................D.....LEV.........................A....NR
ENSTNIP00000016350  .....................................D.....PSL.........................P....DK
ENSTNIP00000006475  .....................................C.....VYH.........................V....EE
ENSTNIP00000004288  .....................................C.....VNA.........................C....DS
ENSTNIP00000007797  .....................................I.....VDQ.........................L....GG
ENSTNIP00000010973  .....................................C.....VNA.........................C....DS
ENSTNIP00000009851  .....................................N.....VNA.........................Q....DN
ENSTNIP00000003355  .....................................R.....VDS.........................L....KK
ENSTNIP00000013324  .....................................N.....TDA.........................Q....DN
ENSTNIP00000002256  .....................................D.....VNQ.........................T....GP
ENSTNIP00000015625  .....................................S.....IDQ.........................P....DN
ENSTNIP00000001122  .....................................D.....INR.........................G....DN
ENSTNIP00000016215  .....................................T.....PTP.........................G....TN
ENSTNIP00000000847  .....................................D.....VNA.........................R....DK
ENSTNIP00000000101  .....................................S.....YTL.........................Ke...HR
ENSTNIP00000019171  .....................................D.....INR.........................G....DN
ENSTNIP00000003589  .....................................D.....INR.........................G....DN
ENSTNIP00000021546  .....................................N.....WLQ.........................K....DL
ENSTNIP00000016214  .....................................T.....PTP.........................G....TN
ENSTNIP00000008096  .....................................Q.....VDA.........................R....NV
ENSTNIP00000021658  .....................................F.....VEQ.........................V....CL
ENSTNIP00000009879  .....................................S.....ALY.........................R....DS
ENSTNIP00000009476  .....................................Rrdi..INA.........................K....SN
ENSTNIP00000020961  .....................................N.....INS.........................Q....SQ
ENSTNIP00000014947  .....................................D.....PGA.........................S....TD
ENSTNIP00000020962  .....................................N.....INS.........................Q....SQ
ENSTNIP00000003486  .....................................Sg....VNE.........................L....NN
ENSTNIP00000002157  .....................................Sg....VNE.........................L....NN
ENSTNIP00000022028  .....................................Sg....VNE.........................L....NN
ENSTNIP00000009270  .....................................S.....VNG.........................A....SL
ENSTNIP00000009271  .....................................S.....VNG.........................A....SL
ENSTNIP00000005251  .....................................D.....PTL.........................A....DR
ENSTNIP00000005250  .....................................D.....PTL.........................A....DR
ENSTNIP00000002767  .....................................Sg....VNE.........................L....NN
ENSTNIP00000005249  .....................................D.....PTL.........................A....DR
ENSTNIP00000017214  .....................................N.....PNY.........................Q....DI
ENSTNIP00000018491  .....................................D.....TMK.........................P....NQ
ENSTNIP00000001443  .....................................D.....VTA.........................T....DA
ENSTNIP00000012425  .....................................D.....VTA.........................T....DA
ENSTNIP00000000418  .....................................D.....VTA.........................T....DA
ENSTNIP00000011989  .....................................D.....LTV.........................S....DA
ENSTNIP00000019096  .....................................Q.....VEA.........................R....NI
ENSTNIP00000022908  .....................................D.....VTA.........................T....DA
ENSTNIP00000021546  .....................................M.....VDS.........................L....DV
ENSTNIP00000001350  .....................................Nl....HNQ.........................T....DR
ENSTNIP00000022034  .....................................Shcr..VNQqrpsanvltleegreagslppsvlpQ....NH
ENSTNIP00000003225  .....................................Nl....HNQ.........................T....DR
ENSTNIP00000004105  .....................................Nl....HNQ.........................T....DR
ENSTNIP00000010006  .....................................Nl....HNQ.........................T....DR
ENSTNIP00000014371  .....................................Shcr..VNQqrpsanvltleegreagslppsvlpQ....NH
ENSTNIP00000017023  .....................................S.....VNG.........................Q....SD
ENSTNIP00000015550  ..................................fdpY.....INA.........................K....NN
ENSTNIP00000004821  ..................................fdpY.....INA.........................K....NN
ENSTNIP00000018664  .....................................Nl....HNQ.........................T....DR
ENSTNIP00000020926  .....................................S.....VNV.........................L....DQ
ENSTNIP00000011335  .....................................N.....ANA.........................V....SE
ENSTNIP00000004556  .....................................I.....VDQ.........................L....GG
ENSTNIP00000013317  .....................................R.....VNH.........................K....DL
ENSTNIP00000009417  .....................................Sl....IAQ.........................T....DR
ENSTNIP00000021733  .....................................S.....LAA.........................Qt...DR
ENSTNIP00000003914  .....................................Sl....IAQ.........................T....DR
ENSTNIP00000022373  .....................................D.....LAL.........................Q....DK
ENSTNIP00000011405  .....................................H.....VNA.........................Q....DA
ENSTNIP00000016960  .....................................N.....VNS.........................S....TV
ENSTNIP00000007293  .....................................S.....VNG.........................Q....SD
ENSTNIP00000008146  .....................................S.....VNG.........................Q....SD
ENSTNIP00000016915  .....................................K.....VDA.........................A....ST
ENSTNIP00000020652  .....................................S.....VNQ.........................A....DS
ENSTNIP00000020964  .....................................P.....VDS.........................S....TK
ENSTNIP00000015802  .....................................D.....LDG.........................K....NK
ENSTNIP00000011405  .....................................Q.....VNA.........................A....TV
ENSTNIP00000002262  .....................................P.....ADV.........................S....HE
ENSTNIP00000019154  .....................................P.....ADV.........................S....HE
ENSTNIP00000015812  .....................................H.....LDF.........................R....NR
ENSTNIP00000018163  .....................................D.....VNR.........................M....-H
ENSTNIP00000006897  .....................................D.....CIL.........................L....AA
ENSTNIP00000011305  .....................................R.....LNL.........................C....DN
ENSTNIP00000016930  .....................................N.....VNL.........................Q....DE
ENSTNIP00000019629  .....................................D.....TNL.........................A....CD
ENSTNIP00000000664  .....................................N.....VNL.........................Q....DE
ENSTNIP00000005820  .....................................N.....VNA.........................A....TI
ENSTNIP00000005228  .....................................N.....VNH.........................T....TI
ENSTNIP00000007470  .....................................-.....---.........................-....--
ENSTNIP00000011306  .....................................R.....LNL.........................C....DN
ENSTNIP00000004387  .....................................K.....VNS.........................L....SL
ENSTNIP00000000847  .....................................Ni....INT.........................S....DS
ENSTNIP00000001107  .....................................D.....VEM.........................R....LD
ENSTNIP00000021112  .....................................H.....IDF.........................R....SK
ENSTNIP00000017960  .....................................H.....IDF.........................R....SK
ENSTNIP00000005432  .....................................H.....LDF.........................R....TR
ENSTNIP00000000101  .....................................Di....VNA.........................R....DA
ENSTNIP00000013166  .....................................K.....VNT.........................R....DL
ENSTNIP00000002306  .....................................D.....VNA.........................Qve..GG
ENSTNIP00000018558  .....................................-.....---.........................-....--
ENSTNIP00000001438  .....................................D.....VEM.........................R....LD
ENSTNIP00000021633  .....................................D.....INA.........................C....DV
ENSTNIP00000022373  .....................................-.....---.........................-....--
ENSTNIP00000011850  .....................................N.....VED.........................R....GI
ENSTNIP00000008855  .....................................-.....---.........................-....--
ENSTNIP00000007188  .....................................D.....PNV.........................Q....DK
ENSTNIP00000004671  .....................................-.....---.........................-....--
ENSTNIP00000004034  .....................................D.....VEM.........................R....LD
ENSTNIP00000018931  .....................................-.....---.........................-....--
ENSTNIP00000010671  .....................................-.....VNL.........................A....DD
ENSTNIP00000013098  .....................................-.....VNV.........................T....DG
ENSTNIP00000016922  .....................................-.....---.........................-....--
ENSTNIP00000021111  .....................................H.....LDF.........................R....TK
ENSTNIP00000003381  .....................................-.....-NM.........................A....DG
ENSTNIP00000020505  .....................................D.....ANR.........................A....AA
ENSTNIP00000018712  .....................................-.....-NM.........................A....DG
ENSTNIP00000021261  .....................................-.....VNL.........................T....DG
ENSTNIP00000022919  .....................................-.....-GC.........................R....DA
ENSTNIP00000010298  .....................................-.....-NM.........................A....DG
ENSTNIP00000019340  .....................................-.....---.........................-....--
ENSTNIP00000019537  .....................................-.....---.........................-....--
ENSTNIP00000012849  .....................................-.....---.........................-....--
ENSTNIP00000021203  .....................................-.....---.........................-....--
ENSTNIP00000016430  .....................................-.....---.........................-....--
ENSTNIP00000021749  .....................................-.....INM.........................A....DG
ENSTNIP00000003121  .....................................D.....INV.........................Q....DN
ENSTNIP00000018281  .....................................D.....INV.........................Q....DN
ENSTNIP00000002757  .....................................-.....---.........................-....--
ENSTNIP00000017905  .....................................-.....---.........................-....--
ENSTNIP00000016177  .....................................-.....---.........................-....--
ENSTNIP00000004254  .....................................T.....ASL.........................E....DK
ENSTNIP00000004505  .....................................-.....---.........................-....-K
ENSTNIP00000007098  .....................................L.....VDC.........................V....DV
ENSTNIP00000018860  .....................................E.....VDS.........................L....DV
ENSTNIP00000018861  .....................................E.....VDS.........................L....DV
ENSTNIP00000011013  .....................................D.....PNI.........................L....NT
ENSTNIP00000004254  .....................................D.....HSR.........................T....DN
ENSTNIP00000018753  .....................................-.....---.........................-....--
ENSTNIP00000003344  .....................................D.....INR.........................Q....DF
ENSTNIP00000011405  .....................................S.....IND.........................T....MS
ENSTNIP00000017191  .....................................-.....---.........................-....--
ENSTNIP00000020431  .....................................-.....---.........................-....--
ENSTNIP00000011744  .....................................E.....VDL.........................V....DV
ENSTNIP00000014438  .....................................C.....ASP.........................Q....TP
ENSTNIP00000022060  .....................................-.....---.........................-....--
ENSTNIP00000005333  .....................................D.....VRA.........................S....NK
ENSTNIP00000014824  .....................................-.....---.........................-....--
ENSTNIP00000009879  .....................................S.....LDV.........................R....DI
ENSTNIP00000001972  .....................................T.....ASL.........................E....DK
ENSTNIP00000008197  .....................................D.....LLA.........................T....DY
ENSTNIP00000008859  .....................................D.....IER.........................R....NC
ENSTNIP00000001888  .....................................D.....VNC.........................S....AQ
ENSTNIP00000008457  .....................................D.....IER.........................R....NC
ENSTNIP00000019974  .....................................D.....VNC.........................S....AQ
ENSTNIP00000016215  .....................................S.....VNE.........................K....NK
ENSTNIP00000012669  .....................................-.....---.........................-....--
ENSTNIP00000014343  .....................................-.....---.........................-....--
ENSTNIP00000009374  .....................................-.....---.........................-....--
ENSTNIP00000013843  .....................................-.....---.........................-....--
ENSTNIP00000019152  .....................................-.....---.........................-....--
ENSTNIP00000019800  .....................................-.....---.........................-....--
ENSTNIP00000011128  .....................................El....INE.........................PmtseLF
ENSTNIP00000016214  .....................................-.....---.........................-....--
ENSTNIP00000003581  .....................................-.....---.........................-....--
ENSTNIP00000009375  .....................................-.....---.........................-....--
ENSTNIP00000019856  .....................................A.....IAE.........................L....--
ENSTNIP00000017493  .....................................D.....INR.........................Q....DF
ENSTNIP00000004637  .....................................D.....LER.........................R....NC
ENSTNIP00000000199  .....................................-.....---.........................-....--
ENSTNIP00000014598  .....................................-.....---.........................-....--
ENSTNIP00000022443  .....................................D.....PNI.........................Q....DK
ENSTNIP00000021145  .....................................-.....---.........................-....--
ENSTNIP00000016530  .....................................-.....---.........................-....--
ENSTNIP00000001856  .....................................N.....VNA.........................A....DS
ENSTNIP00000003340  .....................................N.....VNA.........................A....DS
ENSTNIP00000003075  .....................................N.....VNA.........................A....DS
ENSTNIP00000011507  .....................................N.....VNA.........................A....DS
ENSTNIP00000021687  .....................................D.....PNQ.........................R....DS
ENSTNIP00000004278  .....................................-.....---.........................-....--
ENSTNIP00000018637  .....................................-.....---.........................-....--
ENSTNIP00000011193  .....................................D.....INSevpnsvhkhpsvf............P....ET
ENSTNIP00000015635  .....................................D.....INSqvpstvnkhpsvy............P....ET
ENSTNIP00000006573  .....................................-.....---.........................-....--
ENSTNIP00000005633  .....................................-.....---.........................-....--
ENSTNIP00000005157  .....................................D.....VNR.........................-....-G
ENSTNIP00000019463  .....................................N.....VNA.........................A....DS
ENSTNIP00000015383  .....................................-.....---.........................-....--
ENSTNIP00000017006  .....................................Q.....VGA.........................Q....SH
ENSTNIP00000004078  .....................................N.....ANA.........................A....DS
ENSTNIP00000007396  .....................................N.....ANA.........................A....DS
ENSTNIP00000018125  .....................................D.....TEV.........................R....DP
ENSTNIP00000013051  .....................................-.....---.........................-....--
ENSTNIP00000002932  .....................................-.....---.........................-....--
ENSTNIP00000005133  .....................................-.....---.........................-....--
ENSTNIP00000018052  .....................................D.....INC.........................S....AQ
ENSTNIP00000002528  .....................................-.....---.........................-....--
ENSTNIP00000017494  .....................................-.....---.........................-....--
ENSTNIP00000020678  .....................................-.....---.........................-....--
ENSTNIP00000002762  .....................................D.....INC.........................S....AQ
ENSTNIP00000017148  .....................................-.....---.........................-....--
ENSTNIP00000022679  .....................................-.....---.........................-....--
ENSTNIP00000016402  .....................................D.....LNF.........................E....DP
ENSTNIP00000014119  .....................................-.....---.........................-....--
ENSTNIP00000005520  .....................................-.....---.........................-....--
ENSTNIP00000009225  .....................................-.....---.........................-....--
ENSTNIP00000000650  .....................................-.....---.........................-....--
ENSTNIP00000016194  .....................................D.....IRL.........................A....NR
ENSTNIP00000023095  .....................................-.....---.........................-....--
ENSTNIP00000019373  .....................................N.....VSA.........................P....DS
ENSTNIP00000007443  .....................................-.....---.........................-....--
ENSTNIP00000012036  .....................................N.....VNA.........................T....DN
ENSTNIP00000002856  .....................................-.....---.........................-....--
ENSTNIP00000011373  .....................................-.....VNLayts.....................A....YY
ENSTNIP00000017385  .....................................D.....VNA.........................K....NH
ENSTNIP00000016007  .....................................-.....---.........................-....--
ENSTNIP00000018968  .....................................-.....---.........................-....--
ENSTNIP00000016756  .....................................-.....---.........................-....--
ENSTNIP00000022850  .....................................-.....---.........................-....--
ENSTNIP00000011921  .....................................-.....---.........................-....--
ENSTNIP00000015620  .....................................-.....---.........................-....--
ENSTNIP00000015621  .....................................-.....---.........................-....--
ENSTNIP00000018971  .....................................D.....VHAqargrffqprdegg...........Y....FY
ENSTNIP00000019525  .....................................N.....LNV.........................R....SS
ENSTNIP00000017519  .....................................S.....VDV.........................R....SN
ENSTNIP00000002927  .....................................-.....---.........................-....--
ENSTNIP00000007442  .....................................-.....---.........................-....DP
ENSTNIP00000018523  .....................................-.....---.........................-....--
ENSTNIP00000018573  .....................................-.....---.........................-....--
ENSTNIP00000018967  .....................................-.....TEA.........................V....DP
ENSTNIP00000009206  .....................................N.....ASY.........................Q....DP
ENSTNIP00000011337  .....................................D.....VKS.........................R....DA
ENSTNIP00000011338  .....................................D.....VKS.........................R....DA
ENSTNIP00000013404  .....................................P.....VKV.........................K....NA
ENSTNIP00000020298  .....................................-.....---.........................-....--
ENSTNIP00000011339  .....................................D.....VKS.........................R....DA
ENSTNIP00000022519  .....................................-.....---.........................-....--
ENSTNIP00000012880  .....................................L.....ARV.........................G....D-
ENSTNIP00000011355  .....................................S.....ITQ.........................K....DA
ENSTNIP00000015560  .....................................-.....---.........................-....--
ENSTNIP00000019851  .....................................-.....---.........................-....--
ENSTNIP00000018795  .....................................-.....---.........................-....--
ENSTNIP00000002487  .....................................-.....---.........................-....--
ENSTNIP00000015606  .....................................-.....---.........................-....--
ENSTNIP00000004513  .....................................D.....VGR.........................L....DP
ENSTNIP00000011764  .....................................G.....VND.........................R....DG
ENSTNIP00000022664  .....................................-.....---.........................-....--
ENSTNIP00000005233  .....................................-.....---.........................-....--
ENSTNIP00000004058  .....................................-.....---.........................-....--
ENSTNIP00000005705  .....................................-.....---.........................-....--
ENSTNIP00000021608  .....................................Drnv..INA.........................T....NA
ENSTNIP00000005234  .....................................-.....---.........................-....--
ENSTNIP00000015738  .....................................Q.....ATD.........................-....--
ENSTNIP00000014183  .....................................H.....TGD.........................-....--
ENSTNIP00000016122  .....................................D.....VGR.........................L....DP
ENSTNIP00000017007  .....................................-.....---.........................-....--
ENSTNIP00000009570  .....................................D.....PNT.........................S....-R
ENSTNIP00000000064  .....................................L.....ARI.........................G....D-
ENSTNIP00000008592  .....................................L.....ARI.........................G....D-
ENSTNIP00000003464  .....................................L.....ARI.........................G....D-
ENSTNIP00000009671  .....................................-.....---.........................-....--
ENSTNIP00000022235  .....................................L.....ARI.........................G....D-
ENSTNIP00000015515  .....................................-.....---.........................-....--
ENSTNIP00000009474  .....................................-.....---.........................-....--
ENSTNIP00000012823  .....................................Y.....VGD.........................-....--
ENSTNIP00000005275  .....................................T.....MNNdsldleqevdpln............I....DH
ENSTNIP00000021054  .....................................K.....SEA.........................N....TF
ENSTNIP00000006242  .....................................-.....---.........................-....--
ENSTNIP00000007859  .....................................-.....---.........................-....--
ENSTNIP00000005228  .....................................-.....---.........................-....--
ENSTNIP00000003152  .....................................-.....---.........................-....--
ENSTNIP00000021405  .....................................-.....---.........................-....--
ENSTNIP00000004004  .....................................-.....---.........................-....--
ENSTNIP00000017490  .....................................-.....---.........................-....--
ENSTNIP00000003748  .....................................D.....TEF.........................C....--
ENSTNIP00000019574  .....................................-.....---.........................-....--
ENSTNIP00000019868  .....................................-.....---.........................-....--
ENSTNIP00000019867  .....................................-.....---.........................-....--
ENSTNIP00000020790  .....................................-.....---.........................-....--
ENSTNIP00000009879  .....................................-.....---.........................-....--
ENSTNIP00000000101  .....................................-.....---.........................-....--
ENSTNIP00000005477  .....................................-.....---.........................-....--
ENSTNIP00000007556  .....................................-.....---.........................-....--
ENSTNIP00000014109  .....................................H.....VND.........................R....DG
ENSTNIP00000017432  .....................................-.....---.........................-....--
ENSTNIP00000009570  .....................................-.....---.........................-....--
ENSTNIP00000006306  .....................................-.....---.........................-....--
ENSTNIP00000006163  .....................................-.....---.........................-....--
ENSTNIP00000015769  .....................................-.....---.........................-....--
ENSTNIP00000015422  .....................................-.....---.........................-....--
ENSTNIP00000019364  .....................................Y.....VGD.........................-....--
ENSTNIP00000014874  .....................................-.....---.........................-....--
ENSTNIP00000001049  .....................................-.....---.........................-....--
ENSTNIP00000014843  .....................................-.....---.........................-....--
ENSTNIP00000016727  .....................................-.....---.........................-....--
ENSTNIP00000006578  .....................................-.....---.........................-....--
ENSTNIP00000007406  .....................................-.....---.........................-....--


                                                           110                                      
                                                             |                                      
d1s70b_               E..GWIP................................LHAAASC...........G.Y..................
ENSTNIP00000018931  N..GLTP................................LHVAVHH...........N.N..................
ENSTNIP00000004671  N..GLTP................................LHVAVHH...........N.N..................
ENSTNIP00000008004  N..GLTP................................LHVAVHH...........N.N..................
ENSTNIP00000017432  S..GLTP................................LHVAAHY...........D.N..................
ENSTNIP00000020962  N..GYTP................................LHISARE...........G.Q..................
ENSTNIP00000020961  N..GYTP................................LHISARE...........G.Q..................
ENSTNIP00000020964  N..GYTP................................LHISARE...........G.Q..................
ENSTNIP00000020160  S..GYTP................................LHLAARE...........G.H..................
ENSTNIP00000022654  S..GYTP................................LHLAARE...........G.H..................
ENSTNIP00000007965  N..GLTP................................LHVAAHY...........D.N..................
ENSTNIP00000020160  N..DITP................................LHVASKR...........G.N..................
ENSTNIP00000022654  N..DITP................................LHVASKR...........G.N..................
ENSTNIP00000004254  R..GYTP................................LHTAASS...........G.Q..................
ENSTNIP00000015489  Q..GYTP................................LHAAAAS...........G.H..................
ENSTNIP00000009879  H..GSTP................................LHLAAAS...........S.Sg.................
ENSTNIP00000007449  Y..SVYP................................IIWAAGR...........G.H..................
ENSTNIP00000005052  Y..SVYP................................IIWAAGR...........G.H..................
ENSTNIP00000001326  Y..SVYP................................IIWAAGR...........G.H..................
ENSTNIP00000020926  K..DRRA................................IHWGAYM...........G.H..................
ENSTNIP00000022840  Y..SVYP................................IIWAAGR...........G.H..................
ENSTNIP00000004030  Y..SVYP................................IIWAAGR...........G.H..................
ENSTNIP00000020447  Y..SVYP................................IIWAAGR...........G.H..................
ENSTNIP00000002067  Y..GTTP................................LIWAARK...........G.H..................
ENSTNIP00000003481  Y..GTTP................................LIWAARK...........G.H..................
ENSTNIP00000001972  K..GFTP................................LHFAAAS...........T.Hg.................
ENSTNIP00000001668  Qy.SVYP................................IIWAAGR...........G.H..................
ENSTNIP00000000101  Y..GNTA................................LHMACYT...........G.Q..................
ENSTNIP00000000847  F..GRTC................................LHAAAAG...........G.N..................
ENSTNIP00000021608  A..GRTA................................LHHAAFS...........G.H..................
ENSTNIP00000011850  E..GYTP................................LMEAARE...........G.H..................
ENSTNIP00000011850  S..DYTP................................LSLAASG...........G.Y..................
ENSTNIP00000010597  A..GWMP................................LHLACQN...........G.H..................
ENSTNIP00000018931  D..ELTP................................LHCAARN...........G.H..................
ENSTNIP00000021608  F..GRTC................................LHAAAAG...........G.N..................
ENSTNIP00000021608  N..GQTP................................LMLSVLS...........G.H..................
ENSTNIP00000004671  D..ELTP................................LHCAARN...........G.H..................
ENSTNIP00000008004  D..ELTP................................LHCAARN...........G.H..................
ENSTNIP00000000651  Lw.GETA................................LTAASGR...........G.K..................
ENSTNIP00000017452  Lw.GETA................................LTAASGR...........G.K..................
ENSTNIP00000020962  D..GLTP................................LHCAARS...........G.H..................
ENSTNIP00000020961  D..GLTP................................LHCAARS...........G.H..................
ENSTNIP00000019592  Lw.GETA................................LTAAAGR...........G.K..................
ENSTNIP00000007965  D..GLTP................................LHCAARS...........G.H..................
ENSTNIP00000018708  E..QETP................................LHCAAWH...........G.Y..................
ENSTNIP00000011422  R..GRTP................................AHIACQH...........G.Q..................
ENSTNIP00000017008  Lw.GETA................................LSAAAGS...........G.R..................
ENSTNIP00000020964  D..GLTP................................LHCAARS...........G.H..................
ENSTNIP00000012589  Q..RQTA................................LHLAVIT...........R.Q..................
ENSTNIP00000007468  Y..GIAP................................LFSAAQS...........G.Q..................
ENSTNIP00000015489  I..GCTP................................LHYAAAS...........Q.Afsrvdrhfsgnhddsnee
ENSTNIP00000020926  Q..GRSP................................LHLASAC...........G.R..................
ENSTNIP00000016214  W..KFTP................................LHEAAAK...........G.K..................
ENSTNIP00000016215  W..KFTP................................LHEAAAK...........G.K..................
ENSTNIP00000020449  -..----................................-------...........-.-..................
ENSTNIP00000000938  -..----................................-------...........-.-..................
ENSTNIP00000000106  -..----................................-------...........-.-..................
ENSTNIP00000011013  K..GNSP................................LLLATSC...........G.A..................
ENSTNIP00000022975  Q..GQTP................................LMLAVVG...........G.H..................
ENSTNIP00000001836  D..GRPT................................LYILALE...........N.Q..................
ENSTNIP00000005054  -..----................................-------...........-.-..................
ENSTNIP00000000636  -..----................................-------...........-.-..................
ENSTNIP00000022060  W..KFTP................................LHEAAAK...........G.K..................
ENSTNIP00000017877  R..RQTP................................LHIAVNK...........G.H..................
ENSTNIP00000013825  S..MCTA................................LHIAVNK...........G.F..................
ENSTNIP00000007887  E..GFTC................................LHLAAKS...........G.H..................
ENSTNIP00000006529  Q..SQTP................................LHLAVIT...........N.Q..................
ENSTNIP00000013614  V..FFTP................................LHIASCY...........G.H..................
ENSTNIP00000012342  Lw.GETA................................LSAASGR...........G.R..................
ENSTNIP00000010055  D..GNTA................................LHEASWH...........G.F..................
ENSTNIP00000002777  A..SWTP................................LHIAASA...........G.R..................
ENSTNIP00000015489  Q..GSTP................................LHRAASG...........G.H..................
ENSTNIP00000001972  G..GYTP................................LHWACYY...........G.H..................
ENSTNIP00000004254  G..GYTP................................LHWACYY...........G.H..................
ENSTNIP00000020780  T..GSTA................................LFFASQQ...........G.H..................
ENSTNIP00000020505  N..KETP................................LYKACEL...........E.N..................
ENSTNIP00000019489  D..GNTA................................LHVACQQ...........G.Q..................
ENSTNIP00000001972  M..WLTP................................LHRAVAS...........R.S..................
ENSTNIP00000022060  W..NYTP................................LHEAAIK...........G.K..................
ENSTNIP00000020274  -..----................................-------...........-.-..................
ENSTNIP00000011600  V..EVTA................................LMVASQH...........G.H..................
ENSTNIP00000020643  H..GRRP................................LHEASRL...........G.R..................
ENSTNIP00000008767  -..----................................-------...........-.-..................
ENSTNIP00000008004  K..GFSP................................LYMAAQE...........N.H..................
ENSTNIP00000020403  -..----................................-------...........-.-..................
ENSTNIP00000005775  H..GHTC................................LMISCYK...........G.H..................
ENSTNIP00000016350  D..GRTP................................VHLAASA...........G.D..................
ENSTNIP00000006475  D..GYTG................................LHHAAKL...........G.N..................
ENSTNIP00000004288  E..LWTP................................LHAAATC...........G.H..................
ENSTNIP00000007797  Dl.NSTP................................LHWATRQ...........G.H..................
ENSTNIP00000010973  E..LWTP................................LHAAATC...........G.H..................
ENSTNIP00000009851  E..LWTP................................LHAAATC...........G.H..................
ENSTNIP00000003355  A..DWTP................................LMMACTR...........S.N..................
ENSTNIP00000013324  N..GNTP................................LLLACTY...........G.H..................
ENSTNIP00000002256  L..NRTA................................LHESAFL...........G.L..................
ENSTNIP00000015625  E..GWLP................................LHAASSC...........G.Y..................
ENSTNIP00000001122  E..GWTP................................LHAAASC...........G.F..................
ENSTNIP00000016215  W..NYTQ................................LKEAAHK...........G.Qrceelsccvc........
ENSTNIP00000000847  N..WQTP................................LHVAASN...........K.A..................
ENSTNIP00000000101  H..KWTA................................LHAAAAE...........G.Q..................
ENSTNIP00000019171  E..GWTP................................LHAAASC...........G.F..................
ENSTNIP00000003589  E..GWTP................................LHAAASC...........G.F..................
ENSTNIP00000021546  E..EMTP................................LHLATRH...........P.S..................
ENSTNIP00000016214  W..NYTQ................................LKEAAHK...........G.Qrceelsccvc........
ENSTNIP00000008096  D..GSTP................................LCDACSA...........G.S..................
ENSTNIP00000021658  T..KWTA................................THEAAKV...........G.C..................
ENSTNIP00000009879  Q..GRTP................................LHLAASL...........G.H..................
ENSTNIP00000009476  D..GWTP................................LHVAAHY...........G.R..................
ENSTNIP00000020961  N..GFTP................................LYMAAQE...........N.H..................
ENSTNIP00000014947  T..GALP................................IHYAAAK...........G.D..................
ENSTNIP00000020962  N..GFTP................................LYMAAQE...........N.H..................
ENSTNIP00000003486  S..GETP................................LHVACRL...........G.R..................
ENSTNIP00000002157  S..GETP................................LHVACRL...........G.R..................
ENSTNIP00000022028  S..GETP................................LHVACRL...........G.R..................
ENSTNIP00000009270  D..GHIP................................LHLAAQY...........G.H..................
ENSTNIP00000009271  D..GHIP................................LHLAAQY...........G.H..................
ENSTNIP00000005251  H..GNTP................................LHLASQQ...........GgD..................
ENSTNIP00000005250  H..GNTP................................LHLASQQ...........GgD..................
ENSTNIP00000002767  S..GETP................................LHVACRL...........G.R..................
ENSTNIP00000005249  H..GNTP................................LHLASQQ...........GgD..................
ENSTNIP00000017214  S..GCTP................................LHLAARN...........G.Q..................
ENSTNIP00000018491  T..GDTP................................LHLAARN...........G.H..................
ENSTNIP00000001443  S..GKNA................................LHLSSRN...........G.H..................
ENSTNIP00000012425  S..GKNA................................LHLSSRN...........G.H..................
ENSTNIP00000000418  S..GKNA................................LHLSSRN...........G.H..................
ENSTNIP00000011989  A..GLAP................................LHLAARN...........N.H..................
ENSTNIP00000019096  D..GSTP................................LCDACAA...........G.S..................
ENSTNIP00000022908  S..GKNA................................LHLSSRN...........G.H..................
ENSTNIP00000021546  M..KHTP................................LFRACEM...........G.H..................
ENSTNIP00000001350  T..GETA................................LHLAARY...........A.R..................
ENSTNIP00000022034  E..KETA................................LHCAAQY...........G.H..................
ENSTNIP00000003225  T..GETA................................LHLAARY...........A.R..................
ENSTNIP00000004105  T..GETA................................LHLAARY...........A.R..................
ENSTNIP00000010006  T..GETA................................LHLAARY...........A.R..................
ENSTNIP00000014371  E..KETA................................LHCAAQY...........G.H..................
ENSTNIP00000017023  E..GQIP................................LHLAA-H...........G.H..................
ENSTNIP00000015550  A..NETP................................LHCAAQY...........G.H..................
ENSTNIP00000004821  A..NETP................................LHCAAQY...........G.H..................
ENSTNIP00000018664  T..GETA................................LHLAARY...........A.R..................
ENSTNIP00000020926  R..GCGP................................LHYAAAA...........D.Tevvpfir...........
ENSTNIP00000011335  D..GYMP................................LHYCTQP...........E.S..................
ENSTNIP00000004556  Dl.SSTP................................LHWAIRQ...........G.H..................
ENSTNIP00000013317  T..GVTP................................LAVAAEH...........G.H..................
ENSTNIP00000009417  T..GETA................................LHLAARY...........A.R..................
ENSTNIP00000021733  T..GETA................................LHLAARY...........A.R..................
ENSTNIP00000003914  T..GETA................................LHLAARY...........A.R..................
ENSTNIP00000022373  E..GQGV................................LFYCIYPte.........N.H..................
ENSTNIP00000011405  E..GRAP................................IHVAISN...........Q.H..................
ENSTNIP00000016960  D..GVTP................................LSEACAR...........G.H..................
ENSTNIP00000007293  E..GQIP................................LHLSSQH...........G.H..................
ENSTNIP00000008146  E..GQIP................................LHLSSQH...........G.H..................
ENSTNIP00000016915  D..GATP................................LFNSCSS...........G.S..................
ENSTNIP00000020652  E..GWTP................................LHVAASC...........G.Y..................
ENSTNIP00000020964  K..GNSA................................LHIASLA...........G.Q..................
ENSTNIP00000015802  G..GWTP................................LMYASYI...........G.H..................
ENSTNIP00000011405  Ga.VETP................................LHLVCSFspkkhsaevmaG.M..................
ENSTNIP00000002262  N..GFTP................................LHLAAAY...........G.N..................
ENSTNIP00000019154  N..GFTP................................LHLAAAY...........G.N..................
ENSTNIP00000015812  D..GFTA................................LHKAVWA...........H.N..................
ENSTNIP00000018163  G..TLKP................................LHCACMV...........A.D..................
ENSTNIP00000006897  D..GSAP................................LHLCTSV...........Q.S..................
ENSTNIP00000011305  Q..NRSA................................LMKAVQC...........Q.H..................
ENSTNIP00000016930  D..LWTA................................LHVACVC...........D.H..................
ENSTNIP00000019629  A..GQTA................................FHFACRQ...........G.N..................
ENSTNIP00000000664  D..LWTA................................LHVACVC...........D.H..................
ENSTNIP00000005820  D..GLTP................................LYNCCRS...........G.S..................
ENSTNIP00000005228  T..NSTP................................LRAACFD...........G.R..................
ENSTNIP00000007470  -..----................................LLEAARK...........G.Q..................
ENSTNIP00000011306  Q..NRSA................................LMKAVQC...........Q.H..................
ENSTNIP00000004387  S..GHTP................................LHYCITA...........R.S..................
ENSTNIP00000000847  K..GRTP................................LHAAAFS...........D.H..................
ENSTNIP00000001107  F..GWTP................................MMCAVSV...........A.D..................
ENSTNIP00000021112  D..GLTP................................VHKAVRG...........H.R..................
ENSTNIP00000017960  D..GLTP................................VHKAVRG...........H.R..................
ENSTNIP00000005432  D..GITA................................LHRAVLC...........R.N..................
ENSTNIP00000000101  Kg.SRTP................................LHSAAYS...........G.K..................
ENSTNIP00000013166  W..GRSP................................LHVCAQK...........G.Halsl..............
ENSTNIP00000002306  S..RHTA................................LHLSVHH...........R.A..................
ENSTNIP00000018558  -..----................................LCKASAQ...........G.N..................
ENSTNIP00000001438  F..GWTP................................M-CAVSV...........A.D..................
ENSTNIP00000021633  N..GQTA................................LHLAAHY...........G.F..................
ENSTNIP00000022373  -..---P................................INNCVRN...........G.D..................
ENSTNIP00000011850  Kg.DITP................................LMAAASG...........G.Y..................
ENSTNIP00000008855  -..-RTA................................LHKASFK...........G.H..................
ENSTNIP00000007188  H..GIAP................................VHDAART...........G.F..................
ENSTNIP00000004671  -..---S................................FLRAARS...........G.N..................
ENSTNIP00000004034  F..GWTP................................M-CAVSV...........A.D..................
ENSTNIP00000018931  -..----................................---AARS...........G.N..................
ENSTNIP00000010671  N..GNTV................................LHYSVSH...........C.N..................
ENSTNIP00000013098  N..GNTA................................LHYSVSH...........S.N..................
ENSTNIP00000016922  -..---P................................LHRACRD...........G.D..................
ENSTNIP00000021111  D..GITA................................LHKAVRS...........K.N..................
ENSTNIP00000003381  N..GNTA................................LHYSVSH...........S.N..................
ENSTNIP00000020505  S..GLLP................................LHVAAQQ...........G.H..................
ENSTNIP00000018712  N..GNTA................................LHYSVSH...........S.N..................
ENSTNIP00000021261  N..GNMA................................LHYCVSH...........S.N..................
ENSTNIP00000022919  K..GRTP................................LHAAAFA...........G.H..................
ENSTNIP00000010298  N..GNTA................................LHYSVSH...........S.N..................
ENSTNIP00000019340  -..----................................-------...........-.-..................
ENSTNIP00000019537  -..----................................-------...........-.-..................
ENSTNIP00000012849  -..----................................-------...........-.N..................
ENSTNIP00000021203  -..----................................-------...........-.-..................
ENSTNIP00000016430  -..----................................-------...........-.-..................
ENSTNIP00000021749  N..GNTA................................LHYTVSH...........S.N..................
ENSTNIP00000003121  M..GDTP................................LHKAALA...........G.R..................
ENSTNIP00000018281  M..GDTP................................LHKAALA...........G.R..................
ENSTNIP00000002757  -..----................................-------...........-.-..................
ENSTNIP00000017905  -..----................................-------...........-.-..................
ENSTNIP00000016177  -..----................................-------...........-.-..................
ENSTNIP00000004254  Q..GYRP................................IHYAAAY...........G.H..................
ENSTNIP00000004505  F..DRSL................................LHIAANC...........R.S..................
ENSTNIP00000007098  K..AQTP................................LFTAVRG...........K.Y..................
ENSTNIP00000018860  K..AQTP................................LFTAVSG...........K.H..................
ENSTNIP00000018861  K..AQTP................................LFTAVSG...........K.H..................
ENSTNIP00000011013  A..LLAP................................LHLAVSL...........Q.H..................
ENSTNIP00000004254  C..GRTP................................LHYAAAS...........R.H..................
ENSTNIP00000018753  -..----................................--DAVKS...........G.H..................
ENSTNIP00000003344  L..GEAP................................IHKAARS...........G.S..................
ENSTNIP00000011405  N..GQTL................................LHMAIHR...........Q.D..................
ENSTNIP00000017191  -..----................................-LWAAEK...........N.R..................
ENSTNIP00000020431  -..----................................-------...........-.-..................
ENSTNIP00000011744  K..GQTA................................LYVAVVN...........G.H..................
ENSTNIP00000014438  G..GA-T................................LHRAAYC...........G.H..................
ENSTNIP00000022060  -..----................................-------...........-.-..................
ENSTNIP00000005333  K..RRTA................................LHYVSRR...........-.-..................
ENSTNIP00000014824  -..----................................-------...........-.-..................
ENSTNIP00000009879  E..GRSA................................LHLAARR...........G.F..................
ENSTNIP00000001972  Q..GYRP................................IHYAAAY...........G.H..................
ENSTNIP00000008197  Q..GNTA................................LHLC---...........G.H..................
ENSTNIP00000008859  H..GFTA................................LMKAAMQ...........G.R..................
ENSTNIP00000001888  D..GTRP................................LHDAVAS...........D.N..................
ENSTNIP00000008457  H..GFTA................................LMKAAMQ...........G.R..................
ENSTNIP00000019974  D..GTRP................................LHDAVAS...........D.N..................
ENSTNIP00000016215  D..FMTP................................LHVAAEA...........-.H..................
ENSTNIP00000012669  -..----................................-------...........-.-..................
ENSTNIP00000014343  -..----................................-------...........-.-..................
ENSTNIP00000009374  -..----................................-------...........-.-..................
ENSTNIP00000013843  -..----................................-------...........-.-..................
ENSTNIP00000019152  -..----................................-------...........-.-..................
ENSTNIP00000019800  -..----................................-------...........-.-..................
ENSTNIP00000011128  Q..GLTP................................LHIAVVN...........Q.N..................
ENSTNIP00000016214  -..-ETA................................LHCAVAS...........P.Hpkr...............
ENSTNIP00000003581  -..----................................-------...........-.-..................
ENSTNIP00000009375  -..----................................-------...........-.-..................
ENSTNIP00000019856  -..----................................-------...........-.-..................
ENSTNIP00000017493  L..GEAP................................IHKAARS...........G.S..................
ENSTNIP00000004637  H..GFTA................................LMKAAVQ...........G.R..................
ENSTNIP00000000199  -..----................................-------...........-.-..................
ENSTNIP00000014598  -..----................................-------...........-.-..................
ENSTNIP00000022443  A..GRTA................................LMHACMH...........K.Ag.................
ENSTNIP00000021145  -..----................................-------...........-.-..................
ENSTNIP00000016530  -..----................................-------...........-.-..................
ENSTNIP00000001856  D..GWTP................................LHCAASC...........N.N..................
ENSTNIP00000003340  D..GWTP................................LHCAASC...........N.N..................
ENSTNIP00000003075  D..GWTP................................LHCAASC...........N.N..................
ENSTNIP00000011507  D..GWTP................................LHCAASC...........N.N..................
ENSTNIP00000021687  L..GNTP................................LHLAACT...........N.H..................
ENSTNIP00000004278  -..----................................-------...........-.-..................
ENSTNIP00000018637  -..----................................-------...........-.-..................
ENSTNIP00000011193  R..QATP................................LTFAVLH...........G.H..................
ENSTNIP00000015635  R..QGTP................................LTFAVLH...........G.H..................
ENSTNIP00000006573  -..----................................-------...........-.-..................
ENSTNIP00000005633  -..----................................-------...........-.-..................
ENSTNIP00000005157  Q..RSSS................................LHYAACF...........G.R..................
ENSTNIP00000019463  D..GWTP................................LHCAASC...........N.S..................
ENSTNIP00000015383  -..----................................-------...........-.-..................
ENSTNIP00000017006  D..GVSA................................LGFAAAA...........G.H..................
ENSTNIP00000004078  D..GWTP................................LHCAASC...........N.N..................
ENSTNIP00000007396  D..GWTP................................LHCAASC...........N.N..................
ENSTNIP00000018125  R..GFTA................................LIKAGLQ...........G.R..................
ENSTNIP00000013051  -..----................................-------...........-.-..................
ENSTNIP00000002932  -..----................................-------...........-.-..................
ENSTNIP00000005133  -..----................................-------...........-.-..................
ENSTNIP00000018052  D..GTRP................................IHDAVEN...........D.H..................
ENSTNIP00000002528  -..----................................-------...........-.-..................
ENSTNIP00000017494  -..----................................-------...........-.-..................
ENSTNIP00000020678  -..----................................-------...........-.-..................
ENSTNIP00000002762  D..GTRP................................IHDAVEN...........D.H..................
ENSTNIP00000017148  -..----................................-------...........-.-..................
ENSTNIP00000022679  -..----................................-------...........-.-..................
ENSTNIP00000016402  Vs.YYNP................................LHIAVLR...........N.R..................
ENSTNIP00000014119  -..----................................-------...........-.-..................
ENSTNIP00000005520  -..----................................-------...........-.-..................
ENSTNIP00000009225  -..----................................-------...........-.-..................
ENSTNIP00000000650  -..----................................-------...........-.-..................
ENSTNIP00000016194  E..GWSA................................LHIAAFG...........G.H..................
ENSTNIP00000023095  -..----................................-------...........-.-..................
ENSTNIP00000019373  H..GWTP................................LHCAASC...........N.D..................
ENSTNIP00000007443  -..----................................-------...........-.-..................
ENSTNIP00000012036  H..SSTC................................MHHAAAA...........G.M..................
ENSTNIP00000002856  -..----................................-------...........-.-..................
ENSTNIP00000011373  K..GQTA................................LHVAIER...........R.S..................
ENSTNIP00000017385  S..GKSC................................LHLSAEK...........G.Y..................
ENSTNIP00000016007  -..----................................-------...........-.-..................
ENSTNIP00000018968  -..----................................-------...........-.-..................
ENSTNIP00000016756  -..----................................-------...........-.-..................
ENSTNIP00000022850  -..----................................-------...........-.-..................
ENSTNIP00000011921  -..----................................-------...........-.-..................
ENSTNIP00000015620  -..----................................-------...........-.-..................
ENSTNIP00000015621  -..----................................-------...........-.-..................
ENSTNIP00000018971  F..GELP................................LSLAACT...........N.Q..................
ENSTNIP00000019525  A..GYTP................................LHLAAMH...........G.H..................
ENSTNIP00000017519  A..GYTP................................LHVAAMQ...........N.H..................
ENSTNIP00000002927  -..----................................-------...........-.-..................
ENSTNIP00000007442  R..GRTP................................LHLAVTL...........G.H..................
ENSTNIP00000018523  -..----................................-------...........-.-..................
ENSTNIP00000018573  -..----................................-------...........-.-..................
ENSTNIP00000018967  R..GRTP................................LHLAVSL...........G.H..................
ENSTNIP00000009206  FykGQSP................................LHVAIER...........R.S..................
ENSTNIP00000011337  R..GQTP................................LSYARRA...........G.S..................
ENSTNIP00000011338  R..GQTP................................LSYARRA...........G.S..................
ENSTNIP00000013404  Q..GWSP................................LAEAISY...........G.D..................
ENSTNIP00000020298  -..----................................-------...........-.-..................
ENSTNIP00000011339  R..GQTP................................LSYARRA...........G.S..................
ENSTNIP00000022519  -..----................................-------...........-.-..................
ENSTNIP00000012880  -..---A................................LLLAISK...........G.Y..................
ENSTNIP00000011355  H..GNTP................................LHLAVML...........G.H..................
ENSTNIP00000015560  -..----................................-------...........-.-..................
ENSTNIP00000019851  -..----................................-------...........-.-..................
ENSTNIP00000018795  -..----................................-------...........-.-..................
ENSTNIP00000002487  -..----................................-------...........-.-..................
ENSTNIP00000015606  -..----................................-------...........-.-..................
ENSTNIP00000004513  R..GRTP................................LELAVCL...........G.H..................
ENSTNIP00000011764  Lt.DMSL................................LHFCCKA...........G.Aqgigdadaa.........
ENSTNIP00000022664  -..----................................-------...........-.-..................
ENSTNIP00000005233  -..----................................-------...........-.-..................
ENSTNIP00000004058  -..----................................-------...........-.-..................
ENSTNIP00000005705  -..----................................-------...........-.-..................
ENSTNIP00000021608  A..LQTP................................LHVAARN...........G.L..................
ENSTNIP00000005234  -..----................................-------...........-.-..................
ENSTNIP00000015738  -..---A................................LLVAIDS...........E.V..................
ENSTNIP00000014183  -..---A................................LLYAIRK...........E.V..................
ENSTNIP00000016122  R..GRTP................................LELAVCL...........G.H..................
ENSTNIP00000017007  -..----................................-------...........-.-..................
ENSTNIP00000009570  T..PVPV................................LFSAILA...........C.D..................
ENSTNIP00000000064  -..---G................................LLLAISK...........G.Y..................
ENSTNIP00000008592  -..---G................................LLLAISK...........G.Y..................
ENSTNIP00000003464  -..---A................................LLLAISK...........G.Y..................
ENSTNIP00000009671  -..----................................-------...........-.-..................
ENSTNIP00000022235  -..---A................................LLLAISK...........G.Y..................
ENSTNIP00000015515  -..----................................-------...........-.-..................
ENSTNIP00000009474  -..----................................-------...........-.-..................
ENSTNIP00000012823  -..---A................................LLHAIRK...........E.V..................
ENSTNIP00000005275  -..----................................-------...........-.-..................
ENSTNIP00000021054  D..GERCmygslndsirrllkeykcvsvsamkrgdvayfL------...........-.-..................
ENSTNIP00000006242  -..----................................-------...........-.-..................
ENSTNIP00000007859  -..----................................-------...........-.-..................
ENSTNIP00000005228  -..----................................-------...........-.-..................
ENSTNIP00000003152  -..----................................-------...........-.-..................
ENSTNIP00000021405  -..----................................-------...........-.-..................
ENSTNIP00000004004  -..----................................-------...........-.-..................
ENSTNIP00000017490  -..----................................-------...........-.-..................
ENSTNIP00000003748  -..--TAavsnvfgqrpvscqsggslpgpclridllnwmLAKSCQH...........G.H..................
ENSTNIP00000019574  -..----................................-------...........-.-..................
ENSTNIP00000019868  -..----................................-------...........-.-..................
ENSTNIP00000019867  -..----................................-------...........-.-..................
ENSTNIP00000020790  -..----................................-------...........-.-..................
ENSTNIP00000009879  K..DQSP................................LVQAIFS...........R.D..................
ENSTNIP00000000101  K..DQSP................................LVQAIFS...........R.D..................
ENSTNIP00000005477  -..----................................-------...........-.-..................
ENSTNIP00000007556  -..---A................................LLYAVVH...........D.H..................
ENSTNIP00000014109  A..DRQL................................LHYSCKA...........R.Rpaavgdpaaa........
ENSTNIP00000017432  -..----................................-------...........-.-..................
ENSTNIP00000009570  -..----................................-------...........-.-..................
ENSTNIP00000006306  -..----................................-------...........-.-..................
ENSTNIP00000006163  -..----................................-------...........-.-..................
ENSTNIP00000015769  -..----................................-------...........-.-..................
ENSTNIP00000015422  -..----................................-------...........-.-..................
ENSTNIP00000019364  -..---A................................LLHAIRK...........Q.V..................
ENSTNIP00000014874  -..----................................-------...........-.-..................
ENSTNIP00000001049  -..----................................-------...........-.-..................
ENSTNIP00000014843  -..----................................-------...........-.-..................
ENSTNIP00000016727  -..----................................-------...........-.-..................
ENSTNIP00000006578  -..----................................-------...........-.-..................
ENSTNIP00000007406  -..----................................-------...........-.-..................


                          120                      130                                              
                            |                        |                                              
d1s70b_               .....LDIAEYL.....I..SQ.....G...A...................H..VG..A.............V....N
ENSTNIP00000018931  .....LDVVNLL.....V..SK.....G...G...................S..PH..S.............A....A
ENSTNIP00000004671  .....LDVVKLL.....V..SK.....G...G...................S..AH..S.............T....A
ENSTNIP00000008004  .....LDVVKLL.....V..SK.....G...G...................S..AH..S.............T....A
ENSTNIP00000017432  .....QKVALLL.....L..NQ.....G...A...................S..PH..V.............A....A
ENSTNIP00000020962  .....LETAAVL.....L..EA.....G...A...................S..HS..L.............P....T
ENSTNIP00000020961  .....LETAAVL.....L..EA.....G...A...................S..HS..L.............P....T
ENSTNIP00000020964  .....LETAAVL.....L..EA.....G...A...................S..HS..L.............P....T
ENSTNIP00000020160  .....HDVAVML.....L..EN.....G...A...................S..LC..S.............S....T
ENSTNIP00000022654  .....HDVAVML.....L..EN.....G...A...................S..LC..S.............S....T
ENSTNIP00000007965  .....QRVALLL.....L..DK.....G...A...................S..PH..A.............A....A
ENSTNIP00000020160  .....SNMVKLL.....L..DR.....G...A...................K..ID..A.............K....T
ENSTNIP00000022654  .....SNMVKLL.....L..DR.....G...A...................K..ID..A.............K....T
ENSTNIP00000004254  .....IAVIKHL.....L..NL.....A...V...................E..ID..E.............S....N
ENSTNIP00000015489  .....IEIVKYL.....L..RM.....G...A...................E..ID..E.............P....N
ENSTNIP00000009879  .....VLCLELL.....V..NN.....G...A...................D..VT..M.............Q....N
ENSTNIP00000007449  .....AEIVKLL.....L..QN.....G...A...................K..VN..C.............S....D
ENSTNIP00000005052  .....AEIVKLL.....L..QN.....G...A...................K..VN..C.............S....D
ENSTNIP00000001326  .....AEIVKLL.....L..QN.....G...A...................K..VN..C.............S....D
ENSTNIP00000020926  .....LEVVKLL.....V..AS.....G...A...................E..VD..C.............K....D
ENSTNIP00000022840  .....AEIVKLL.....L..QN.....G...A...................K..VN..C.............S....D
ENSTNIP00000004030  .....AEIVHLL.....L..QH.....G...A...................K..VN..C.............S....D
ENSTNIP00000020447  .....AEIVHLL.....L..QH.....G...A...................K..VN..C.............S....D
ENSTNIP00000002067  .....YESVMHL.....L..SN.....G...A...................-..--..-.............-....-
ENSTNIP00000003481  .....YESVMHL.....L..SN.....G...A...................-..--..-.............-....-
ENSTNIP00000001972  .....APCFEFL.....V..NN.....G...A...................D..VN..V.............Q....S
ENSTNIP00000001668  .....AEIVHLL.....L..QH.....G...A...................K..VN..C.............S....D
ENSTNIP00000000101  .....DTVANEL.....V..NC.....G...A...................N..IN..R.............P....N
ENSTNIP00000000847  .....LECLNLL.....L..KV.....G...A...................D..LN..R.............K....D
ENSTNIP00000021608  .....LEMVRLL.....L..SR.....G...A...................N..IN..A.............F....D
ENSTNIP00000011850  .....EEMVALL.....L..AQ.....G...A...................N..IN..A.............Q....T
ENSTNIP00000011850  .....VNIIKIL.....L..NA.....G...A...................E..IN..S.............SirtgS
ENSTNIP00000010597  .....EPVVRLL.....L..SRms...E...E...................A..LE..E.............R....E
ENSTNIP00000018931  .....VRIIEIL.....L..DH.....G...A...................P..IQ..A.............K....T
ENSTNIP00000021608  .....LECLNLL.....L..NT.....G...A...................D..FN..R.............K....D
ENSTNIP00000021608  .....TDCVYSL.....L..NK.....G...A...................S..VE..A.............K....D
ENSTNIP00000004671  .....VRIIEIL.....L..EH.....G...A...................P..IQ..A.............K....T
ENSTNIP00000008004  .....VRIIEIL.....L..EH.....G...A...................P..IQ..A.............K....T
ENSTNIP00000000651  .....LEVCRLL.....L..EQ.....G...A...................A..VA..Q.............P....N
ENSTNIP00000017452  .....LEVCRLL.....L..EQ.....G...A...................A..VA..Q.............P....N
ENSTNIP00000020962  .....DQAVEIL.....L..DR.....G...A...................P..IL..A.............R....T
ENSTNIP00000020961  .....DQAVEIL.....L..DR.....G...A...................P..IL..A.............R....T
ENSTNIP00000019592  .....IEVCTFL.....L..EQ.....G...A...................V..VQ..Q.............V....N
ENSTNIP00000007965  .....DASVELL.....L..ER.....G...A...................P..LL..A.............R....T
ENSTNIP00000018708  .....STVARAL.....C..QA.....G...C...................R..VD..A.............K....N
ENSTNIP00000011422  .....ENVIRVL.....L..SR.....G...A...................D..VQ..I.............R....G
ENSTNIP00000017008  .....LSVCSLL.....L..EQ.....G...A...................A..VD..R.............G....N
ENSTNIP00000020964  .....DQAVEIL.....L..DR.....G...A...................P..IL..A.............R....T
ENSTNIP00000012589  .....PQLVEKL.....L..KA.....G...A...................D..PR..L.............V....D
ENSTNIP00000007468  .....LATLRFL.....L..KH.....G...A...................D..IN..S.............Q....A
ENSTNIP00000015489  eakesYFCLEHL.....L..DN.....G...A...................D..PS..M.............V....N
ENSTNIP00000020926  .....VAVLGAL.....L..QA.....G...S...................SshTH..L.............T....D
ENSTNIP00000016214  .....YEICKLL.....L..KH.....G...A...................D..PT..K.............K....N
ENSTNIP00000016215  .....YEICKLL.....L..KH.....G...A...................D..PT..K.............K....N
ENSTNIP00000020449  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000000938  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000000106  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000011013  .....WKTVSLL.....L..SK.....G...A...................S..VD..V.............R....D
ENSTNIP00000022975  .....VDAVSLL.....L..ER.....E...A...................S..VN..V.............S....N
ENSTNIP00000001836  .....LAMTEYF.....L..EN.....G...A...................N..VE..A.............S....D
ENSTNIP00000005054  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000000636  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000022060  .....YEICKLL.....L..KH.....G...A...................D..PT..K.............K....N
ENSTNIP00000017877  .....LQVVKTL.....L..DF.....G...C...................H..PS..L.............Q....D
ENSTNIP00000013825  .....TDLVRVL.....T..EH.....S...A...................D..VN..L.............Q....D
ENSTNIP00000007887  .....YTIVEHL.....L..ST.....Gl..I...................N..IN..C.............Q....D
ENSTNIP00000006529  .....ASVCLDL.....L..AS.....G...C...................D..PT..L.............V....D
ENSTNIP00000013614  .....EQVAKLL.....L..KF.....G...A...................D..EN..V.............S....G
ENSTNIP00000012342  .....MEVCAFL.....L..EH.....G...P...................N..LE..I.............A....N
ENSTNIP00000010055  .....SRSVQLL.....V..KA.....G...A...................N..VH..A.............K....N
ENSTNIP00000002777  .....EDIVRAL.....I..SK.....G...A...................Q..LN..S.............V....N
ENSTNIP00000015489  .....TKILASL.....L..QAam...A...T...................D..PQdqL.............L....D
ENSTNIP00000001972  .....EGCVEVL.....L..EQk....G...C...................R..--..C.............I....D
ENSTNIP00000004254  .....EGCVEVL.....L..EQk....G...C...................R..--..C.............I....D
ENSTNIP00000020780  .....NEVVKLL.....F..DF.....G...A...................S..TE..F.............R....T
ENSTNIP00000020505  .....MDLVRLL.....L..SY.....G...A...................T..VN..Q.............R....C
ENSTNIP00000019489  .....TEMAGEM.....T..RRvspsqL...A...................Pi.LE..T.............Q....N
ENSTNIP00000001972  .....EEAVRVL.....I..HH.....S...A...................D..VN..A.............R....D
ENSTNIP00000022060  .....IDVCIVL.....L..QH.....G...A...................D..PN..I.............R....N
ENSTNIP00000020274  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000011600  .....EAAVRLL.....L..EW.....G...S...................D..VNf.S.............Q....R
ENSTNIP00000020643  .....AALVTLL.....L..EA.....G...A...................H..PD..P.............R....S
ENSTNIP00000008767  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000008004  .....LEVVKFL.....L..EN.....G...A...................N..QS..L.............P....T
ENSTNIP00000020403  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000005775  .....KDIAQFL.....L..QN.....G...A...................D..VN..R.............K....S
ENSTNIP00000016350  .....SATLRLL.....L..AHlges.H...A...................Hv.VN..S.............P....D
ENSTNIP00000006475  .....LEIVNML.....L..ET.....Gq..V...................D..VN..A.............Q....D
ENSTNIP00000004288  .....TGLVQLL.....I..QA.....G...A...................D..LL..A.............V....N
ENSTNIP00000007797  .....LSMVVQL.....M..KY.....G...A...................D..PS..L.............I....D
ENSTNIP00000010973  .....TGLVQLL.....I..QA.....G...A...................D..LL..A.............V....N
ENSTNIP00000009851  .....AGLVIIL.....I..AY.....G...A...................D..LL..A.............V....N
ENSTNIP00000003355  .....LAVIQDL.....L..RH.....G...A...................D..PV..L.............K....N
ENSTNIP00000013324  .....EDCVKAL.....V..YY.....DmqtC...................H..LD..L.............Q....N
ENSTNIP00000002256  .....ENFVYLL.....L..ES.....G...A...................D..PN..A.............R....D
ENSTNIP00000015625  .....LDIAAYL.....I..SQ.....G...A...................N..VG..G.............V....N
ENSTNIP00000001122  .....IQIVKFL.....I..EH.....G...A...................H..VG..A.............V....N
ENSTNIP00000016215  .....LPSPTVL.....L..QH.....G...A...................E..PS..I.............R....N
ENSTNIP00000000847  .....VRCAEAL.....V..PL.....L...S...................N..VN..V.............S....D
ENSTNIP00000000101  .....MDCLLLL.....VnqEH.....S...A...................Di.ID..C.............P....D
ENSTNIP00000019171  .....IQIVKFL.....I..EH.....G...A...................H..VG..A.............V....N
ENSTNIP00000003589  .....IQIVKFL.....I..EH.....G...A...................H..VG..A.............V....N
ENSTNIP00000021546  .....PKALALL.....L..KHig...P...G...................E..VD..T.............Q....D
ENSTNIP00000016214  .....LPSPTVL.....L..QH.....G...A...................E..PS..I.............R....N
ENSTNIP00000008096  .....LECVRLL.....L..EH.....G...A...................K..ANp.A.............L....T
ENSTNIP00000021658  .....TDILKLL.....L..RH.....G...A...................K..VS..S.............R....D
ENSTNIP00000009879  .....TELLQTL.....L..KAam...K...S...................D..PLdsM.............L....D
ENSTNIP00000009476  .....DSFVRLL.....L..EF.....R...A...................E..VD..P.............L....S
ENSTNIP00000020961  .....LEVVRYL.....L..EN.....D...G...................N..QS..I.............A....T
ENSTNIP00000014947  .....LCSLRLL.....L..EH.....S...P...................Nl.IN..S.............Q....T
ENSTNIP00000020962  .....LEVVRYL.....L..EN.....D...G...................N..QS..I.............A....T
ENSTNIP00000003486  .....VESVKAL.....L..AG.....G...A...................K..CD..I.............I....G
ENSTNIP00000002157  .....VESVKAL.....L..AG.....G...A...................K..CD..I.............I....G
ENSTNIP00000022028  .....VESVKAL.....L..AG.....G...A...................K..CD..I.............I....G
ENSTNIP00000009270  .....HQVSEML.....L..QH.....Q...S...................N..PC..L.............V....N
ENSTNIP00000009271  .....HQVSEML.....L..QH.....Q...S...................N..PC..L.............V....N
ENSTNIP00000005251  .....GGMVGFL.....Lq.DE.....G...M...................RglLE..L.............P....N
ENSTNIP00000005250  .....GGMVGFL.....Lq.DE.....G...M...................RglLE..L.............P....N
ENSTNIP00000002767  .....VESVKAL.....L..AG.....G...A...................K..CD..I.............I....G
ENSTNIP00000005249  .....GGMVGFL.....Lq.DE.....G...M...................RglLE..L.............P....N
ENSTNIP00000017214  .....KKCMGRL.....L..EY.....N...A...................D..VN..I.............C....N
ENSTNIP00000018491  .....LDAIDML.....L..LH.....F...E...................T..RD..E.............V....N
ENSTNIP00000001443  .....SQCVQKL.....L..QH.....N...C...................P..VG..N.............V....D
ENSTNIP00000012425  .....SQCVQKL.....L..QH.....N...C...................P..VG..N.............V....D
ENSTNIP00000000418  .....SQCVQKL.....L..QH.....N...C...................P..VG..N.............V....D
ENSTNIP00000011989  .....LECCRKL.....L..QS.....K...S...................P..VD..A.............A....D
ENSTNIP00000019096  .....LECVKLM.....L..EY.....G...A...................T..VN..-.............P....P
ENSTNIP00000022908  .....SQCVQKL.....L..QH.....N...C...................P..VG..N.............V....D
ENSTNIP00000021546  .....RDVILTL.....I..KG.....G...A...................Q..VD..L.............V....D
ENSTNIP00000001350  .....SDAAKRL.....L..ES.....S...A...................D..AN..V.............Q....D
ENSTNIP00000022034  .....SDVVSVL.....L..HE.....L...T...................D..PT..M.............R....N
ENSTNIP00000003225  .....SDAAKRL.....L..ES.....S...A...................D..AN..V.............Q....D
ENSTNIP00000004105  .....SDAAKRL.....L..ES.....S...A...................D..AN..V.............Q....D
ENSTNIP00000010006  .....SDAAKRL.....L..ES.....S...A...................D..AN..V.............Q....D
ENSTNIP00000014371  .....SDVVSVL.....L..HE.....L...T...................D..PT..M.............R....N
ENSTNIP00000017023  .....YDVSEML.....L..QH.....Q...S...................N..PC..I.............V....D
ENSTNIP00000015550  .....TGVVRIL.....L..EE.....L...T...................D..PT..M.............R....N
ENSTNIP00000004821  .....TGVVRIL.....L..EE.....L...T...................D..PT..M.............R....N
ENSTNIP00000018664  .....SDAAKRL.....L..EA.....S...A...................D..AN..I.............Q....D
ENSTNIP00000020926  .....LRCVEYL.....L..RN.....G...A...................D..PG..A.............N....D
ENSTNIP00000011335  .....LECAKYL.....L..QY.....G...A...................A..VS..G.............Cs...S
ENSTNIP00000004556  .....LSMVIQL.....L..RY.....G...A...................D..PS..I.............A....D
ENSTNIP00000013317  .....AHIAELL.....L..SC.....G...G...................R..VN..A.............Q....A
ENSTNIP00000009417  .....ADAAKRL.....L..DA.....G...A...................D..PN..A.............H....D
ENSTNIP00000021733  .....ADAAKRL.....L..DA.....G...A...................D..AN..A.............Q....D
ENSTNIP00000003914  .....ADAAKRL.....L..DA.....G...A...................D..PN..A.............H....D
ENSTNIP00000022373  .....ARCLQAA.....L..AA.....R...A...................D..VN..S.............I....S
ENSTNIP00000011405  .....SVIIQLL.....I..SHp....D...I...................R..LN..I.............R....D
ENSTNIP00000016960  .....VALASLL.....L..QR.....G...A...................N..PS..-.............G....S
ENSTNIP00000007293  .....YDGTEML.....L..QH.....Q...S...................N..PC..I.............S....D
ENSTNIP00000008146  .....YDGTEML.....L..QH.....Q...S...................N..PC..I.............S....D
ENSTNIP00000016915  .....AACVGVL.....L..QH.....G...A...................S..VY..-.............T....P
ENSTNIP00000020652  .....PDIAEFL.....L..QR.....G...A...................S..LS..A.............V....N
ENSTNIP00000020964  .....KEVVRLL.....V..KR.....G...A...................N..IN..S.............Q....S
ENSTNIP00000015802  .....DNIANLL.....L..EA.....G...V...................N..VN..A.............S....T
ENSTNIP00000011405  .....ARIAEAL.....L..KT.....G...A...................N..PN..M.............Q....N
ENSTNIP00000002262  .....SSCVEEL.....L..AA.....G...A...................A..VD..A.............P....T
ENSTNIP00000019154  .....SSCVEEL.....L..AA.....G...A...................A..VD..A.............P....T
ENSTNIP00000015812  .....HAGLLVL.....L..SL.....G...A...................S..AN..Y.............K....D
ENSTNIP00000018163  .....ADCVELL.....L..HH.....G...A...................E..VN..A.............L....D
ENSTNIP00000006897  .....LHCAELL.....L..QG.....G...A...................E..VN..V.............Rm...Q
ENSTNIP00000011305  .....ERCVRLL.....L..EN.....D...A...................D..PN..L.............V....D
ENSTNIP00000016930  .....ADVVLLL.....L..LA.....G...V...................N..ML..L.............Q....D
ENSTNIP00000019629  .....IYIIHQM.....M..QH.....G...A...................D..LH..I.............R....D
ENSTNIP00000000664  .....ADVVLLL.....L..LA.....G...V...................N..ML..L.............Q....D
ENSTNIP00000005820  .....ASCMELL.....L..QH.....G...A...................R..AH..S.............A....H
ENSTNIP00000005228  .....LDIVRYL.....V..EH.....-...A...................D..IS..I.............T....N
ENSTNIP00000007470  .....DDEVRNL.....M..AN.....G...A...................P..FT..-.............T....D
ENSTNIP00000011306  .....ERCVRLL.....L..EN.....D...A...................D..PN..L.............V....D
ENSTNIP00000004387  .....VDCAKQL.....I..LK.....G...L...................H..VN..A.............Psq..N
ENSTNIP00000000847  .....VECVSLL.....L..SH.....G...A...................E..AN..A.............V....D
ENSTNIP00000001107  .....YNVAELL.....L..ER.....G...A...................D..AS..-.............F....H
ENSTNIP00000021112  .....HTALLAL.....L..SL.....G...A...................S..PD..Y.............K....D
ENSTNIP00000017960  .....HTALLAL.....L..SL.....G...A...................S..PD..Y.............K....D
ENSTNIP00000005432  .....SASLTTM.....L..DL.....G...A...................S..PD..Y.............K....D
ENSTNIP00000000101  .....VAGLQLV.....I..DQ.....G...A...................E..VN..S.............V....D
ENSTNIP00000013166  .....QAIWRTL.....QrtRQ.....Q...P...................D..LE..M.............Y....N
ENSTNIP00000002306  .....LSTVHAL.....A..SH.....G...A...................N..VN..A.............V....N
ENSTNIP00000018558  .....LAAVKRL.....L..QN.....G...V...................D..VN..G.............L....N
ENSTNIP00000001438  .....YNVAELL.....L..ER.....G...A...................D..AS..F.............H....K
ENSTNIP00000021633  .....PVVLQAI.....L..SNrp...A...V...................N..LE..A.............R....N
ENSTNIP00000022373  .....MPSLDLA.....F..RQ.....G...I...................P..VD..I.............Q....D
ENSTNIP00000011850  .....VDIVKLL.....V..-H.....G...A...................D..VN..A.............Q....S
ENSTNIP00000008855  .....VDIMKRL.....L..EA.....G...A...................S..MD..K.............K....D
ENSTNIP00000007188  .....LDTLQVL.....V..EY.....G...A...................S..VN..L.............P....D
ENSTNIP00000004671  .....LEKALDH.....I..RN.....G...I...................D..IN..T.............A....N
ENSTNIP00000004034  .....YNVAELL.....L..ER.....G...A...................D..AS..-.............F....H
ENSTNIP00000018931  .....LDKALEH.....I..KN.....G...I...................D..IN..T.............A....N
ENSTNIP00000010671  .....YGIVGLL.....L..ET.....Ga..C...................D..VN..L.............Q....N
ENSTNIP00000013098  .....FGVVELL.....L..DT.....Gv..C...................S..VD..K.............P....N
ENSTNIP00000016922  .....VGALCSL.....L..QRasn..P...A...................D..LT..V.............E....D
ENSTNIP00000021111  .....HTALIPL.....K..AA.....K...H...................Q..FD..F.............S....S
ENSTNIP00000003381  .....FHVVKKL.....L..DA.....Dv..C...................N..VN..Q.............Q....N
ENSTNIP00000020505  .....PQIVSLL.....V..PV.....T...S...................R..AR..L.............-....R
ENSTNIP00000018712  .....FHVVKKL.....L..DA.....Dv..C...................N..VN..Q.............Q....N
ENSTNIP00000021261  .....FPVVKLL.....L..DT.....Gl..C...................E..TD..N.............M....N
ENSTNIP00000022919  .....VDCIHLL.....L..SH.....D...A...................P..VD..A.............V....D
ENSTNIP00000010298  .....FGIVQKL.....L..EA.....Dv..C...................N..MN..H.............Q....N
ENSTNIP00000019340  .....-------.....-..--.....-...N...................D..LN..Q.............G....D
ENSTNIP00000019537  .....-------.....-..--.....-...-...................-..--..K.............R....N
ENSTNIP00000012849  .....SVAVRLW.....L..DNt....E...N...................D..LN..L.............G....D
ENSTNIP00000021203  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000016430  .....-------.....-..--.....-...-...................-..IN..L.............Q....D
ENSTNIP00000021749  .....FPVVKLL.....L..DT.....Gl..C...................N..AD..K.............Q....N
ENSTNIP00000003121  .....KEIVLLL.....L..RY.....D...A...................-..--..-.............-....-
ENSTNIP00000018281  .....KEIVLLL.....L..RY.....D...A...................-..--..-.............-....-
ENSTNIP00000002757  .....-------.....-..--.....-...-...................-..VN..K.............R....N
ENSTNIP00000017905  .....-------.....-..--.....-...-...................-..VN..K.............R....N
ENSTNIP00000016177  .....-------.....-..--.....-...-...................-..LN..N.............Q....D
ENSTNIP00000004254  .....KRCLELL.....L..DRd....H...S...................H..PNn.P.............E....Y
ENSTNIP00000004505  .....VECLVLL.....L..RR.....G...A...................N..PN..Y.............Q....D
ENSTNIP00000007098  .....LDCVLAL.....L..RA.....G...A...................S..PN..G.............S....S
ENSTNIP00000018860  .....LDCVVAL.....L..KA.....G...A...................D..PN..G.............S....Q
ENSTNIP00000018861  .....LDCVVAL.....L..KA.....G...A...................D..PN..G.............S....Q
ENSTNIP00000011013  .....NNLVELL.....L..SYs....S...T...................D..SN..L.............Q....G
ENSTNIP00000004254  .....YQCLETL.....V..AC.....G...T...................A..IN..A.............T....D
ENSTNIP00000018753  .....YMTVKLA.....L..NSke...E...Y...................N..LD..Q.............E....D
ENSTNIP00000003344  .....LECTQVL.....L..IG.....G...A...................K..PS..L.............Q....-
ENSTNIP00000011405  .....SKSALFL.....L..EH.....Q...A...................D..IN..M.............R....T
ENSTNIP00000017191  .....ISTINRL.....Lt.DN.....P...S...................L..VD..S.............C....D
ENSTNIP00000020431  .....-------.....-..--.....-...-...................-..-N..K.............R....N
ENSTNIP00000011744  .....LDCVRIL.....L..EA.....G...A...................N..PN..G.............S....R
ENSTNIP00000014438  .....VDVVGLL.....L..EH.....G...A...................N..PS..L.............R....D
ENSTNIP00000022060  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000005333  .....-------.....-..--.....-...-...................-..--..-.............-....T
ENSTNIP00000014824  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000009879  .....APCVEVL.....L..KH.....Q...A...................S..YT..L.............Ke...H
ENSTNIP00000001972  .....KRCLELVrtralLdrDH.....S...H...................P..NN..P.............E....Y
ENSTNIP00000008197  .....VDTIQFL.....V..SN.....G...L...................K..ID..I.............C....N
ENSTNIP00000008859  .....VECVRSL.....M..MA.....G...A...................A..LN..A.............R....D
ENSTNIP00000001888  .....LPIVWLL.....L..NH.....G...A...................D..PT..L.............A....T
ENSTNIP00000008457  .....VECVRSL.....M..MA.....G...A...................A..LN..A.............R....D
ENSTNIP00000019974  .....LPIVWLL.....L..NH.....G...A...................D..PT..L.............A....T
ENSTNIP00000016215  .....NDIMEVL.....Q..KH.....G...A...................K..VN..A.............L....D
ENSTNIP00000012669  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000014343  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000009374  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000013843  .....-------.....-..--.....-...-...................-..-D..V.............K....K
ENSTNIP00000019152  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000019800  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000011128  .....INLVQHL.....I..SR.....G...G...................D..VA..T.............P....Q
ENSTNIP00000016214  .....KQVTELL.....L..R-.....-...-...................-..--..-.............-....-
ENSTNIP00000003581  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000009375  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000019856  .....-------.....-..--.....-...-...................-..--..S.............C....T
ENSTNIP00000017493  .....LECTQVL.....L..I-.....-...-...................-..--..-.............-....-
ENSTNIP00000004637  .....AGCVRAL.....M..LA.....G...G...................N..IQ..A.............R....D
ENSTNIP00000000199  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000014598  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000022443  .....HEVVDHL.....L..SN.....G...A...................D..PS..L.............E....D
ENSTNIP00000021145  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000016530  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000001856  .....VQVCKFL.....V..ES.....G...A...................A..VF..A.............M....T
ENSTNIP00000003340  .....VQVCKFL.....V..ES.....G...A...................A..VF..A.............M....T
ENSTNIP00000003075  .....VQVCKFL.....V..ES.....G...A...................A..VF..A.............M....T
ENSTNIP00000011507  .....VQVCKFL.....V..ES.....G...A...................A..VF..A.............M....T
ENSTNIP00000021687  .....VPVITTL.....L..--.....-...-...................-..--..-.............-....-
ENSTNIP00000004278  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000018637  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000011193  .....VPVVQLL.....L..DA.....K...A...................N..VE..Gslqdg........M....E
ENSTNIP00000015635  .....VPVVQLL.....L..DN.....R...A...................D..V-..-.............-....-
ENSTNIP00000006573  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000005633  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000005157  .....PQVAKTL.....L..RH.....G...A...................N..PD..L.............R....D
ENSTNIP00000019463  .....VHLCKLL.....V..ES.....G...A...................A..IF..-.............-....-
ENSTNIP00000015383  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000017006  .....LDIVTML.....S..QN.....A...A...................K..VG..H.............V....D
ENSTNIP00000004078  .....VQLCKFL.....V..ES.....G...A...................A..VF..A.............A....T
ENSTNIP00000007396  .....VQLCKFL.....V..ES.....G...A...................A..VF..A.............A....T
ENSTNIP00000018125  .....EECVAAL.....L..MH.....G...A...................D..IN..A.............M....D
ENSTNIP00000013051  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000002932  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000005133  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000018052  .....LDVVRIL.....L..SY.....G...A...................D..PT..L.............A....T
ENSTNIP00000002528  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000017494  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000020678  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000002762  .....LDVVRIL.....L..SY.....G...A...................D..PT..L.............A....T
ENSTNIP00000017148  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000022679  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000016402  .....PSMVRLL.....V..SH.....G...A...................D..VE..K.............R....D
ENSTNIP00000014119  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000005520  .....-----ML.....L..QH.....Q...S...................N..PC..I.............K....N
ENSTNIP00000009225  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000000650  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000016194  .....QDIVLYL.....I..T-.....-...-...................-..--..-.............-....-
ENSTNIP00000023095  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000019373  .....RPLCEFL.....V..RS.....G...A...................A..VM..A.............-....-
ENSTNIP00000007443  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000012036  .....KICVELL.....I..QS.....E...A...................D..LF..V.............E....D
ENSTNIP00000002856  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000011373  .....ISYVKLL.....V..SK.....G...A...................D..VH..AracgrffqphngpN....F
ENSTNIP00000017385  .....VRVLEVL.....K..QAmvngvY...V...................D..VE..A.............A....D
ENSTNIP00000016007  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000018968  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000016756  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000022850  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000011921  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000015620  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000015621  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000018971  .....PDIVHYL.....T..ENphk..K...A...................D..LR..R.............Q....D
ENSTNIP00000019525  .....TQVVRVL.....Ls.DW.....E...A...................D..PE..A.............R....D
ENSTNIP00000017519  .....LEVVKLL.....V..--.....-...-...................-..--..-.............-....-
ENSTNIP00000002927  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000007442  .....LDCARLL.....L..QQ.....G...A...................D..VS..K.............E....N
ENSTNIP00000018523  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000018573  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000018967  .....LESVRVL.....L..RH.....N...A...................S..VT..K.............E....N
ENSTNIP00000009206  .....FDHVKML.....V..QN.....G...A...................D..VQ..A.............K....A
ENSTNIP00000011337  .....QECADIL.....L..QH.....G...C...................-..--..-.............-....-
ENSTNIP00000011338  .....QECADIL.....L..QH.....G...C...................-..--..-.............-....-
ENSTNIP00000013404  .....RQMITAL.....L..--.....-...-...................-..--..-.............-....-
ENSTNIP00000020298  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000011339  .....QECADIL.....L..QH.....G...C...................-..--..-.............-....-
ENSTNIP00000022519  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000012880  .....IRITEAL.....L..SH.....P...Afrdarrltaspaqadmld.D..FY..A.............Y....D
ENSTNIP00000011355  .....KECALLL.....L..AH.....N...A...................P..VK..I.............K....N
ENSTNIP00000015560  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000019851  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000018795  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000002487  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000015606  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000004513  .....LESTRVL.....L..RH.....S...S...................D..PT..H.............C....N
ENSTNIP00000011764  .....ADFARQL.....L..AL.....G...A...................D..PN..L.............R....S
ENSTNIP00000022664  .....-------.....-..--.....-...-...................-..--..-.............K....N
ENSTNIP00000005233  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000004058  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000005705  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000021608  .....TVVVQEL.....L..AK.....G...A...................S..VL..A.............V....D
ENSTNIP00000005234  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000015738  .....VGAVDIL.....L..NH.....R...Prrsskpsiaklmqriq...N..PE..Y.............S....T
ENSTNIP00000014183  .....VGAVELL.....L..SH.....R...RpsgekqvpslmmdsqfsefT..--..-.............-....-
ENSTNIP00000016122  .....LESTRVL.....L..RH.....S...S...................D..PT..H.............C....N
ENSTNIP00000017007  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000009570  .....REGIRRL.....L..LL.....G...A...................R..TD..I.............Plpp.K
ENSTNIP00000000064  .....VRIVEAI.....L..AH.....P...AfggglrlalspleqemrddD..FY..A.............Y....D
ENSTNIP00000008592  .....VRIVEAI.....L..AH.....P...AfggglrlalspleqemrddD..FY..A.............Y....D
ENSTNIP00000003464  .....IRIVEAL.....L..RH.....Q...Afldgqrlsdcpsqadd...D..FF..T.............Y....D
ENSTNIP00000009671  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000022235  .....IRIVEAL.....L..RH.....Q...Afldgqrlsdcpsqadd...D..FF..T.............Y....D
ENSTNIP00000015515  .....-------.....-..--.....-...-...................-..--..S.............K....T
ENSTNIP00000009474  .....-------.....-..-S.....V...P...................G..PC..L.............R....I
ENSTNIP00000012823  .....VGAVELL.....L..NH.....K...Kpsggmqvppilldkqfs..D..--..-.............-....-
ENSTNIP00000005275  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000021054  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000006242  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000007859  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000005228  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000003152  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000021405  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000004004  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000017490  .....-----EL.....H..TK.....G...A...................D..LT..I.............L....D
ENSTNIP00000003748  .....LDVVRLL.....V..QRy....H...A...................D..VR..-.............-....-
ENSTNIP00000019574  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000019868  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000019867  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000020790  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000009879  .....TEEVTFL.....L..DH.....N...Q...................D..AS..S.............L....D
ENSTNIP00000000101  .....TEEVTFL.....L..DH.....N...Q...................D..AS..S.............L....D
ENSTNIP00000005477  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000007556  .....QPYARFL.....L..GR.....-...-...................-..--..-.............-....-
ENSTNIP00000014109  .....LRLSSQL.....I..SL.....G...A...................D..VS..L.............R....S
ENSTNIP00000017432  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000009570  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000006306  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000006163  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000015769  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000015422  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000019364  .....VGAVELL.....L..NH.....K...K...................P..HG..E.............K....-
ENSTNIP00000014874  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000001049  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000014843  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000016727  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000006578  .....-------.....-..--.....-...-...................-..--..-.............-....-
ENSTNIP00000007406  .....-------.....-..--.....-...-...................-..--..-.............-....-


                        140                                                                         
                          |                                                                         
d1s70b_               S.EGDTP.................................................................L.DIAE
ENSTNIP00000018931  R.NGYTA.................................................................L.HIAS
ENSTNIP00000004671  R.NGYTP.................................................................L.HIAA
ENSTNIP00000008004  R.NGYTP.................................................................L.HIAA
ENSTNIP00000017432  K.NGYTP.................................................................L.HIAA
ENSTNIP00000020962  K.KGFTP.................................................................L.HVAA
ENSTNIP00000020961  K.KGFTP.................................................................L.HVAA
ENSTNIP00000020964  K.KGFTP.................................................................L.HVAA
ENSTNIP00000020160  K.KGFSP.................................................................L.HVAA
ENSTNIP00000022654  K.KGFSP.................................................................L.HVAA
ENSTNIP00000007965  K.NGYTP.................................................................L.HIAA
ENSTNIP00000020160  K.DGLTP.................................................................L.HCGA
ENSTNIP00000022654  K.DGLTP.................................................................L.HCGA
ENSTNIP00000004254  A.FGNTA.................................................................L.HLAC
ENSTNIP00000015489  G.FGNTP.................................................................L.HVAC
ENSTNIP00000009879  K.EGKSP.................................................................L.HVAA
ENSTNIP00000007449  K.YGTTP.................................................................L.IWAS
ENSTNIP00000005052  K.YGTTP.................................................................L.IWAS
ENSTNIP00000001326  K.YGTTP.................................................................L.IWAS
ENSTNIP00000020926  K.KAYTP.................................................................L.HAAA
ENSTNIP00000022840  K.YGTTP.................................................................L.IWAS
ENSTNIP00000004030  K.YGTTP.................................................................L.IWAA
ENSTNIP00000020447  K.YGTTP.................................................................L.IWAA
ENSTNIP00000002067  -.-----.................................................................-.----
ENSTNIP00000003481  -.-----.................................................................-.----
ENSTNIP00000001972  R.DGKSP.................................................................L.HMTA
ENSTNIP00000001668  K.YGTTP.................................................................L.IWAA
ENSTNIP00000000101  R.HGSTP.................................................................L.HLAA
ENSTNIP00000000847  H.FGRTP.................................................................L.HYAS
ENSTNIP00000021608  K.RDRRA.................................................................I.HWAA
ENSTNIP00000011850  EeTQETA.................................................................L.TLAC
ENSTNIP00000011850  K.LGISP.................................................................L.MLAA
ENSTNIP00000010597  G.HGRTP.................................................................L.HLAC
ENSTNIP00000018931  K.NGLSP.................................................................I.HMAA
ENSTNIP00000021608  S.FGRTP.................................................................L.HYAA
ENSTNIP00000021608  K.WGRTA.................................................................L.HRGA
ENSTNIP00000004671  K.NGLSP.................................................................I.HMAA
ENSTNIP00000008004  K.NGLSP.................................................................I.HMAA
ENSTNIP00000000651  R.RGIVP.................................................................L.FSAV
ENSTNIP00000017452  R.RGIVP.................................................................L.FSAV
ENSTNIP00000020962  K.NGLSP.................................................................L.HMSA
ENSTNIP00000020961  K.NGLSP.................................................................L.HMSA
ENSTNIP00000019592  R.RGVSP.................................................................L.FCAI
ENSTNIP00000007965  K.NGLSA.................................................................L.HMAA
ENSTNIP00000018708  R.EGESP.................................................................L.LTAS
ENSTNIP00000011422  K.DDWTA.................................................................L.HLAA
ENSTNIP00000017008  R.RGVTP.................................................................L.FSAV
ENSTNIP00000020964  K.NGLSP.................................................................L.HMSA
ENSTNIP00000012589  N.SGNTA.................................................................L.HIAC
ENSTNIP00000007468  A.DGATA.................................................................L.YEAA
ENSTNIP00000015489  A.KGYSA.................................................................V.HYAA
ENSTNIP00000020926  N.QGYTP.................................................................L.HWAC
ENSTNIP00000016214  R.DGNTPldlvkdgdtdiqdllrgdaa.............................................L.LDAA
ENSTNIP00000016215  R.DGNTPldlvkdgdtdiqdllrgdaa.............................................L.LDAA
ENSTNIP00000020449  -.-----.................................................................-.----
ENSTNIP00000000938  -.-----.................................................................-.----
ENSTNIP00000000106  -.-----.................................................................-.----
ENSTNIP00000011013  A.CGCNF.................................................................L.HLAI
ENSTNIP00000022975  K.HGFTAlhlgeciqclleqeasvllgdsqgrtaihlaaarghaswlsellniacaeasslpvlrdlggytpL.HWAC
ENSTNIP00000001836  T.EGRTA.................................................................L.HVSC
ENSTNIP00000005054  -.-----.................................................................-.----
ENSTNIP00000000636  -.-----.................................................................-.----
ENSTNIP00000022060  R.DGNIPldmvkdgdtdiqdllrgdaa.............................................L.LDAA
ENSTNIP00000017877  S.EGDTP.................................................................L.HDAI
ENSTNIP00000013825  S.YGDTP.................................................................L.HDAI
ENSTNIP00000007887  D.GGWTP.................................................................M.IWAT
ENSTNIP00000006529  D.RGDTP.................................................................L.HIAC
ENSTNIP00000013614  E.VGDRP.................................................................L.HLAA
ENSTNIP00000012342  R.RGMVP.................................................................L.LSAT
ENSTNIP00000010055  K.VGHTP.................................................................L.HLAC
ENSTNIP00000002777  Q.NGCTP.................................................................L.HYAA
ENSTNIP00000015489  N.QQYTP.................................................................L.HWAA
ENSTNIP00000001972  G.NPFTP.................................................................L.HCAV
ENSTNIP00000004254  G.NPFTP.................................................................L.HCAV
ENSTNIP00000020780  K.DGGTA.................................................................L.TAAS
ENSTNIP00000020505  A.QGWTA.................................................................L.HEAV
ENSTNIP00000019489  W.KGLAC.................................................................L.HLAA
ENSTNIP00000001972  K.NWQTP.................................................................L.HVAA
ENSTNIP00000022060  T.DGKSAldladpsakavltgeykkde.............................................L.LEAA
ENSTNIP00000020274  -.-----.................................................................-.----
ENSTNIP00000011600  T.TQWGP.................................................................L.MAAT
ENSTNIP00000020643  H.YGL-P.................................................................L.ALAA
ENSTNIP00000008767  -.-----.................................................................-.----
ENSTNIP00000008004  E.DGFTP.................................................................L.AVAL
ENSTNIP00000020403  -.-----.................................................................L.YDAV
ENSTNIP00000005775  V.KGNTA.................................................................L.HDCA
ENSTNIP00000016350  Y.HGLRP.................................................................L.HLAV
ENSTNIP00000006475  S.GGWTP.................................................................I.-WAA
ENSTNIP00000004288  A.DGNMP.................................................................Y.DLCE
ENSTNIP00000007797  G.EGCSC.................................................................V.HLAA
ENSTNIP00000010973  A.DGNMP.................................................................Y.DLCE
ENSTNIP00000009851  S.DGNMP.................................................................Y.DLCE
ENSTNIP00000003355  K.DGWTA.................................................................F.HIAC
ENSTNIP00000013324  D.KGDAA.................................................................L.HLAA
ENSTNIP00000002256  I.KKKTP.................................................................L.ALAA
ENSTNIP00000015625  S.EGETP.................................................................L.DIAE
ENSTNIP00000001122  S.EGELP.................................................................L.DVAT
ENSTNIP00000016215  T.DGRSAldladasakavltgeykkde.............................................L.LEAA
ENSTNIP00000000847  R.AGRTA.................................................................L.HHAA
ENSTNIP00000000101  T.KGQTA.................................................................L.MLAA
ENSTNIP00000019171  S.EGELP.................................................................L.DVAT
ENSTNIP00000003589  S.EGELP.................................................................L.DVAT
ENSTNIP00000021546  K.NKQTA.................................................................L.HWSA
ENSTNIP00000016214  T.DGRSAldladasakavltgeykkde.............................................L.LEAA
ENSTNIP00000008096  S.RTASP.................................................................L.HEAC
ENSTNIP00000021658  A.HGVTP.................................................................L.AIAA
ENSTNIP00000009879  Y.RGYMP.................................................................V.HWAA
ENSTNIP00000009476  D.KGTTP.................................................................L.QLAI
ENSTNIP00000020961  E.DGFTP.................................................................L.AIAL
ENSTNIP00000014947  K.NGATP.................................................................L.YLAC
ENSTNIP00000020962  E.DGFTP.................................................................L.AIAL
ENSTNIP00000003486  G.AGY-P.................................................................I.HSAM
ENSTNIP00000002157  G.AGY-P.................................................................I.HSAM
ENSTNIP00000022028  G.AGY-P.................................................................I.HSAM
ENSTNIP00000009270  K.AKKTP.................................................................L.DLAC
ENSTNIP00000009271  K.AKKTP.................................................................L.DLAC
ENSTNIP00000005251  R.AGLCP.................................................................I.HLAV
ENSTNIP00000005250  R.AGLCP.................................................................I.HLAV
ENSTNIP00000002767  G.AGY-P.................................................................I.HSAM
ENSTNIP00000005249  R.AGLCP.................................................................I.HLAV
ENSTNIP00000017214  N.EGLTA.................................................................I.HWLA
ENSTNIP00000018491  L.DGETA.................................................................L.YLAV
ENSTNIP00000001443  L.QGRIA.................................................................L.HDAV
ENSTNIP00000012425  L.QGRIA.................................................................L.HDAV
ENSTNIP00000000418  L.QGRIA.................................................................L.HDAV
ENSTNIP00000011989  V.SGRTA.................................................................L.HHAA
ENSTNIP00000019096  L.FTFSP.................................................................L.HEAC
ENSTNIP00000022908  L.QGRIA.................................................................L.HDAV
ENSTNIP00000021546  V.EGHTA.................................................................L.HWAA
ENSTNIP00000001350  N.MGRTP.................................................................L.HSAV
ENSTNIP00000022034  S.RQETP.................................................................L.DLAA
ENSTNIP00000003225  N.MGRTP.................................................................L.HSAV
ENSTNIP00000004105  N.MGRTP.................................................................L.HSAV
ENSTNIP00000010006  N.MGRTP.................................................................L.HSAV
ENSTNIP00000014371  S.RQETP.................................................................L.DLAA
ENSTNIP00000017023  N.AGKTP.................................................................L.DLAC
ENSTNIP00000015550  N.KFETP.................................................................L.DLAA
ENSTNIP00000004821  N.KFETP.................................................................L.DLAA
ENSTNIP00000018664  N.MGRTP.................................................................L.HAAV
ENSTNIP00000020926  K.QGYCA.................................................................V.HYAS
ENSTNIP00000011335  D.EGDTP.................................................................L.HVAA
ENSTNIP00000004556  G.EGYRA.................................................................L.HLAI
ENSTNIP00000013317  C.NGDSV.................................................................L.LDAA
ENSTNIP00000009417  N.MGRTP.................................................................L.HAAV
ENSTNIP00000021733  N.TGRTP.................................................................L.HAAV
ENSTNIP00000003914  N.MGRTP.................................................................L.HAAV
ENSTNIP00000022373  S.RGVHV.................................................................F.QLMC
ENSTNIP00000011405  R.QGMTP.................................................................F.ACAM
ENSTNIP00000016960  G.HSNSP.................................................................I.LKAA
ENSTNIP00000007293  A.AGKTP.................................................................L.DLAC
ENSTNIP00000008146  A.AGKTP.................................................................L.DLAC
ENSTNIP00000016915  S.PLASP.................................................................I.HEAA
ENSTNIP00000020652  C.DGDVP.................................................................L.DIAL
ENSTNIP00000020964  Q.NGFTP.................................................................L.YMAA
ENSTNIP00000015802  A.KGVTP.................................................................L.MLAA
ENSTNIP00000011405  S.KGRTP.................................................................L.HEAV
ENSTNIP00000002262  A.DGQTP.................................................................L.LLAC
ENSTNIP00000019154  A.DGQTP.................................................................L.LLAC
ENSTNIP00000015812  R.CGLTP.................................................................L.YHTV
ENSTNIP00000018163  G.YNRTA.................................................................L.HYAA
ENSTNIP00000006897  E.SRLTP.................................................................L.HIAG
ENSTNIP00000011305  I.DDNTA.................................................................L.HLAA
ENSTNIP00000016930  V.NGNIP.................................................................V.DYAS
ENSTNIP00000019629  L.QGKTA.................................................................M.HHAV
ENSTNIP00000000664  V.NGNIP.................................................................V.DYAS
ENSTNIP00000005820  T.HYPSA.................................................................L.HEAC
ENSTNIP00000005228  K.YNNTC.................................................................L.MIAA
ENSTNIP00000007470  W.LGTSP.................................................................L.HLAA
ENSTNIP00000011306  I.DDNTA.................................................................L.HLAA
ENSTNIP00000004387  S.SEDTP.................................................................L.HTAA
ENSTNIP00000000847  ArLSRTP.................................................................L.MMAA
ENSTNIP00000001107  K.DGWSV.................................................................L.MACI
ENSTNIP00000021112  R.RGLTP.................................................................L.YHTV
ENSTNIP00000017960  R.RGLTP.................................................................L.YHTV
ENSTNIP00000005432  S.RGLTP.................................................................L.YHSA
ENSTNIP00000000101  Q.RGCSA.................................................................L.MVAA
ENSTNIP00000013166  Y.DGLTA.................................................................L.HAAT
ENSTNIP00000002306  N.SGMTP.................................................................L.HMAA
ENSTNIP00000018558  T.FNRTA.................................................................L.QV-V
ENSTNIP00000001438  A.DGWSV.................................................................L.MACI
ENSTNIP00000021633  F.EGMTP.................................................................L.HCAA
ENSTNIP00000022373  Q.AYKTP.................................................................L.MVAC
ENSTNIP00000011850  S.TGNTA.................................................................L.TYAC
ENSTNIP00000008855  K.LEATA.................................................................V.HWAC
ENSTNIP00000007188  Q.SGALP.................................................................IpHCQS
ENSTNIP00000004671  Q.NGLNG.................................................................L.HLAS
ENSTNIP00000004034  K.DGWSV.................................................................L.MACI
ENSTNIP00000018931  Q.NGLNG.................................................................L.HLAS
ENSTNIP00000010671  N.AGYTA.................................................................V.MLAA
ENSTNIP00000013098  K.AGYTA.................................................................I.MLAA
ENSTNIP00000016922  TfYGWTP.................................................................I.HWGA
ENSTNIP00000021111  E.KICTP.................................................................L.LXCC
ENSTNIP00000003381  K.AGYTP.................................................................I.MLAT
ENSTNIP00000020505  H.SCVSP.................................................................L.HLAA
ENSTNIP00000018712  K.AGYTP.................................................................I.MLAT
ENSTNIP00000021261  K.AGYTP.................................................................V.MLAA
ENSTNIP00000022919  Q.SGFTP.................................................................L.MMAA
ENSTNIP00000010298  K.AGYTP.................................................................I.MLAA
ENSTNIP00000019340  D.HGFSP.................................................................L.HWAC
ENSTNIP00000019537  Y.KGETP.................................................................L.HIAS
ENSTNIP00000012849  D.HGFSP.................................................................L.HWAC
ENSTNIP00000021203  -.-----.................................................................-.TAAA
ENSTNIP00000016430  E.EGFTP.................................................................L.MWAA
ENSTNIP00000021749  K.AGYTA.................................................................I.MLTA
ENSTNIP00000003121  -.-----.................................................................-.----
ENSTNIP00000018281  -.-----.................................................................-.----
ENSTNIP00000002757  E.RGETP.................................................................L.HMAA
ENSTNIP00000017905  E.RGETP.................................................................L.HMAA
ENSTNIP00000016177  E.RGFTP.................................................................L.MWAA
ENSTNIP00000004254  L.DARSP.................................................................L.HLAA
ENSTNIP00000004505  I.SGCTP.................................................................L.HLAA
ENSTNIP00000007098  S.NNCSP.................................................................V.LTAA
ENSTNIP00000018860  Y.NNCSP.................................................................V.LTAA
ENSTNIP00000018861  Y.NNCSP.................................................................V.LTAA
ENSTNIP00000011013  D.LGNTP.................................................................T.ILAC
ENSTNIP00000004254  Q.WGRSA.................................................................L.HYAA
ENSTNIP00000018753  V.SGMSL.................................................................S.MLAA
ENSTNIP00000003344  -.-----.................................................................-.----
ENSTNIP00000011405  Q.EGETA.................................................................L.QLAI
ENSTNIP00000017191  E.DGYTP.................................................................L.HRAA
ENSTNIP00000020431  E.KGETS.................................................................L.HRAC
ENSTNIP00000011744  H.HRSTP.................................................................L.YHAA
ENSTNIP00000014438  G.DGATP.................................................................L.HKAA
ENSTNIP00000022060  -.--DTA.................................................................L.HCAV
ENSTNIP00000005333  F.SLLDY.................................................................L.MIAV
ENSTNIP00000014824  -.-----.................................................................-.HRAA
ENSTNIP00000009879  R.HKWTA.................................................................L.HAAA
ENSTNIP00000001972  L.DARSP.................................................................L.HLAA
ENSTNIP00000008197  H.NGSTP.................................................................L.VLAK
ENSTNIP00000008859  CgRNFTA.................................................................R.EWAL
ENSTNIP00000001888  Y.SGQTP.................................................................V.KLA-
ENSTNIP00000008457  CgRNFTA.................................................................R.EWAL
ENSTNIP00000019974  Y.SGQTP.................................................................V.KLA-
ENSTNIP00000016215  T.LGQTA.................................................................L.HRAA
ENSTNIP00000012669  -.-----.................................................................-.HRAA
ENSTNIP00000014343  -.-----.................................................................L.IWAL
ENSTNIP00000009374  N.AGETL.................................................................L.QRAA
ENSTNIP00000013843  E.DGFSA.................................................................L.HLAA
ENSTNIP00000019152  -.-----.................................................................-.----
ENSTNIP00000019800  -.---NP.................................................................L.HEAA
ENSTNIP00000011128  V.SGLY-.................................................................-.----
ENSTNIP00000016214  -.-----.................................................................-.----
ENSTNIP00000003581  N.AGETL.................................................................L.QRAA
ENSTNIP00000009375  N.AGETL.................................................................L.QRAA
ENSTNIP00000019856  R.EYPSL.................................................................I.HYAA
ENSTNIP00000017493  -.-----.................................................................-.----
ENSTNIP00000004637  HgRSLTP.................................................................R.EWAL
ENSTNIP00000000199  -.-----.................................................................L.CQAV
ENSTNIP00000014598  -.-----.................................................................-.----
ENSTNIP00000022443  R.SGASA.................................................................L.VYAI
ENSTNIP00000021145  -.-----.................................................................Y.HKAA
ENSTNIP00000016530  -.-----.................................................................-.----
ENSTNIP00000001856  Y.-----.................................................................-.----
ENSTNIP00000003340  Y.-----.................................................................-.----
ENSTNIP00000003075  Y.-----.................................................................-.----
ENSTNIP00000011507  Y.-----.................................................................-.----
ENSTNIP00000021687  -.-----.................................................................-.----
ENSTNIP00000004278  -.-----.................................................................-.----
ENSTNIP00000018637  -.-----.................................................................-.----
ENSTNIP00000011193  N.YTETP.................................................................L.QLAA
ENSTNIP00000015635  -.-----.................................................................-.----
ENSTNIP00000006573  -.-----.................................................................L.HRAS
ENSTNIP00000005633  -.-----.................................................................-.--AS
ENSTNIP00000005157  E.DGKTP.................................................................L.DKAR
ENSTNIP00000019463  -.-----.................................................................-.----
ENSTNIP00000015383  -.-----.................................................................L.HRAS
ENSTNIP00000017006  N.SGRCV.................................................................L.VHAA
ENSTNIP00000004078  H.-----.................................................................-.----
ENSTNIP00000007396  H.-----.................................................................-.----
ENSTNIP00000018125  -.-----.................................................................-.----
ENSTNIP00000013051  -.-----.................................................................-.-RSA
ENSTNIP00000002932  -.-----.................................................................-.-RSA
ENSTNIP00000005133  -.-----.................................................................L.YRAS
ENSTNIP00000018052  Y.SGRG-.................................................................-.----
ENSTNIP00000002528  -.-----.................................................................-.----
ENSTNIP00000017494  -.-----.................................................................-.----
ENSTNIP00000020678  -.VDDFP.................................................................L.HRSA
ENSTNIP00000002762  Y.SGR--.................................................................-.----
ENSTNIP00000017148  -.-----.................................................................-.----
ENSTNIP00000022679  -.-----.................................................................-.----
ENSTNIP00000016402  RiHESSP.................................................................L.DLAS
ENSTNIP00000014119  -.-----.................................................................-.YRAA
ENSTNIP00000005520  K.AKKTP.................................................................L.DLAC
ENSTNIP00000009225  -.-----.................................................................-.----
ENSTNIP00000000650  -.-----.................................................................-.----
ENSTNIP00000016194  -.-----.................................................................-.----
ENSTNIP00000023095  -.-----.................................................................-.----
ENSTNIP00000019373  -.-----.................................................................-.----
ENSTNIP00000007443  -.-----.................................................................-.----
ENSTNIP00000012036  Q.EKLTP.................................................................C.DHAE
ENSTNIP00000002856  -.-----.................................................................-.----
ENSTNIP00000011373  Y.FGELP.................................................................L.SLAA
ENSTNIP00000017385  N.SGMSV.................................................................L.QCAA
ENSTNIP00000016007  -.-----.................................................................-.----
ENSTNIP00000018968  -.-----.................................................................-.----
ENSTNIP00000016756  -.-----.................................................................-.----
ENSTNIP00000022850  -.-----.................................................................-.----
ENSTNIP00000011921  -.-----.................................................................-.----
ENSTNIP00000015620  -.----A.................................................................L.LTAA
ENSTNIP00000015621  -.----A.................................................................L.LTAA
ENSTNIP00000018971  S.RGNTV.................................................................L.HALV
ENSTNIP00000019525  Y.SGRRA.................................................................I.Q---
ENSTNIP00000017519  -.-----.................................................................-.----
ENSTNIP00000002927  -.-----.................................................................-.----
ENSTNIP00000007442  H.NGWTV.................................................................L.QEAV
ENSTNIP00000018523  -.-----.................................................................-.----
ENSTNIP00000018573  -.-----.................................................................-.---C
ENSTNIP00000018967  A.SNWTV.................................................................L.QEAV
ENSTNIP00000009206  N.GTF--.................................................................-.----
ENSTNIP00000011337  -.-----.................................................................-.----
ENSTNIP00000011338  -.-----.................................................................-.----
ENSTNIP00000013404  -.-----.................................................................-.----
ENSTNIP00000020298  -.-----.................................................................-.----
ENSTNIP00000011339  -.-----.................................................................-.----
ENSTNIP00000022519  -.-----.................................................................-.----
ENSTNIP00000012880  E.DGT--.................................................................-.----
ENSTNIP00000011355  S.QGWSP.................................................................L.AEAI
ENSTNIP00000015560  -.-----.................................................................-.----
ENSTNIP00000019851  -.-----.................................................................-.----
ENSTNIP00000018795  -.-----.................................................................-.----
ENSTNIP00000002487  -.-----.................................................................-.----
ENSTNIP00000015606  -.-----.................................................................-.----
ENSTNIP00000004513  A.QGWTI.................................................................L.QEAV
ENSTNIP00000011764  RwTNMRA.................................................................L.HYAA
ENSTNIP00000022664  S.RGMTL.................................................................L.HLAA
ENSTNIP00000005233  -.-----.................................................................-.----
ENSTNIP00000004058  -.-----.................................................................-.----
ENSTNIP00000005705  -.-----.................................................................-.----
ENSTNIP00000021608  E.NGYTP.................................................................A.LACA
ENSTNIP00000005234  -.-----.................................................................-.----
ENSTNIP00000015738  T.MDVAP.................................................................V.ILAA
ENSTNIP00000014183  -.PDITP.................................................................I.MLAA
ENSTNIP00000016122  A.QGWTI.................................................................L.QEAV
ENSTNIP00000017007  -.-----.................................................................-.----
ENSTNIP00000009570  S.KGLYP.................................................................L.HVAA
ENSTNIP00000000064  E.DGT--.................................................................-.----
ENSTNIP00000008592  E.DGT--.................................................................-.----
ENSTNIP00000003464  E.DG---.................................................................-.----
ENSTNIP00000009671  -.-----.................................................................-.----
ENSTNIP00000022235  E.DG---.................................................................-.----
ENSTNIP00000015515  F.RGMTL.................................................................L.HLAA
ENSTNIP00000009474  D.LLNWM.................................................................L.AKSC
ENSTNIP00000012823  F.-----.................................................................-.----
ENSTNIP00000005275  -.-----.................................................................-.----
ENSTNIP00000021054  -.-----.................................................................-.HMLW
ENSTNIP00000006242  -.-----.................................................................-.----
ENSTNIP00000007859  -.-----.................................................................-.----
ENSTNIP00000005228  -.-----.................................................................-.----
ENSTNIP00000003152  -.-----.................................................................-.----
ENSTNIP00000021405  -.-----.................................................................-.----
ENSTNIP00000004004  -.-----.................................................................-.----
ENSTNIP00000017490  G.SGYSL.................................................................L.HHAV
ENSTNIP00000003748  -.-----.................................................................-.DFAI
ENSTNIP00000019574  -.-----.................................................................-.----
ENSTNIP00000019868  -.-----.................................................................-.----
ENSTNIP00000019867  -.-----.................................................................-.----
ENSTNIP00000020790  -.-----.................................................................-.----
ENSTNIP00000009879  Q.EQSTP.................................................................L.HAAS
ENSTNIP00000000101  Q.EQSTP.................................................................L.HAAS
ENSTNIP00000005477  -.-----.................................................................-.----
ENSTNIP00000007556  -.-----.................................................................-.----
ENSTNIP00000014109  R.WTNMN.................................................................L.HYAA
ENSTNIP00000017432  -.-----.................................................................-.----
ENSTNIP00000009570  -.-----.................................................................-.----
ENSTNIP00000006306  -.-----.................................................................-.----
ENSTNIP00000006163  -.-----.................................................................-.----
ENSTNIP00000015769  -.-----.................................................................-.----
ENSTNIP00000015422  -.-----.................................................................-.----
ENSTNIP00000019364  -.-----.................................................................-.----
ENSTNIP00000014874  -.-----.................................................................-.----
ENSTNIP00000001049  -.-----.................................................................-.----
ENSTNIP00000014843  -.-----.................................................................-.----
ENSTNIP00000016727  -.-----.................................................................-.----
ENSTNIP00000006578  -.-----.................................................................-.----
ENSTNIP00000007406  -.-----.................................................................-.----


                           150                160                                                   
                             |                  |                                                   
d1s70b_               EE.....A......M...EELLQNEVN.R.................................................
ENSTNIP00000018931  KQ.....N......Q...VEVANSLLQ.-.................................................
ENSTNIP00000004671  KQ.....N......Q...MEVASCLLQ.-.................................................
ENSTNIP00000008004  KQ.....N......Q...MEVASCLLQ.-.................................................
ENSTNIP00000017432  KK.....N......Q...MEITTTLLE.-.................................................
ENSTNIP00000020962  KY.....G......N...LDVAKLLLQ.Skalpddagkngltslhvaahydnqdvalllldkgasphstakngytplh
ENSTNIP00000020961  KY.....G......N...LDVAKLLLQ.Skalpddagkngltslhvaahydnqdvalllldkgasphstakngytplh
ENSTNIP00000020964  KY.....G......N...LDVAKLLLQ.Skalpddagkngltslhvaahydnqdvalllldkgasphstakngytplh
ENSTNIP00000020160  KY.....G......K...MEVASLLLQ.Kgaapdaagkrllqsgltplhvaahydnqrvalllldqgasphsaakngy
ENSTNIP00000022654  KY.....G......K...MEVASLLLQ.Kgaapdaagkrllqsgltplhvaahydnqrvalllldqgasphsaakngy
ENSTNIP00000007965  KK.....H......Q...VEVAVALLQ.-.................................................
ENSTNIP00000020160  RS.....G......H...EQVVEILLD.-.................................................
ENSTNIP00000022654  RS.....G......H...EQVVEILLD.-.................................................
ENSTNIP00000004254  FN.....G......Q...DMVASELID.-.................................................
ENSTNIP00000015489  YM.....G......Q...EAVATELVN.-.................................................
ENSTNIP00000009879  MH.....G......R...FTGSQILIQ.-.................................................
ENSTNIP00000007449  RK.....G......H...FDCVMHLLE.-.................................................
ENSTNIP00000005052  RK.....G......H...FDCVMHLLE.-.................................................
ENSTNIP00000001326  RK.....G......H...FDCVMHLLE.-.................................................
ENSTNIP00000020926  SS.....G......M...SSTVHYLLS.-.................................................
ENSTNIP00000022840  RK.....G......H...FDCVMHLLE.-.................................................
ENSTNIP00000004030  RK.....G......H...YESVMHLLS.-.................................................
ENSTNIP00000020447  RK.....G......H...YESVMHLLS.-.................................................
ENSTNIP00000002067  --.....-......-...---------.-.................................................
ENSTNIP00000003481  --.....-......-...---------.-.................................................
ENSTNIP00000001972  VH.....G......R...FTRSQTLIQ.-.................................................
ENSTNIP00000001668  RK.....G......H...YESVMHLLS.-.................................................
ENSTNIP00000000101  AS.....Ss.....G...VLCLELLVN.-.................................................
ENSTNIP00000000847  AN.....C......N...YQCVFALGG.-.................................................
ENSTNIP00000021608  YM.....G......H...IEVVKLLAS.-.................................................
ENSTNIP00000011850  CG.....G......F...LEVADFLIK.-.................................................
ENSTNIP00000011850  MN.....G......H...VPAVKLLLD.-.................................................
ENSTNIP00000010597  VY.....G......H...LSIAKLLLS.-.................................................
ENSTNIP00000018931  QG.....D......H...MDCVKQLLQ.-.................................................
ENSTNIP00000021608  AN.....C......N...YQCLFALVG.-.................................................
ENSTNIP00000021608  VT.....G......H...EECVEALLQ.-.................................................
ENSTNIP00000004671  QG.....D......H...MDGVRQLLQ.-.................................................
ENSTNIP00000008004  QG.....D......H...MDGVRQLLQ.-.................................................
ENSTNIP00000000651  RQ.....G......H...WQIVDLLLT.-.................................................
ENSTNIP00000017452  RQ.....G......H...WQIVDLLLT.-.................................................
ENSTNIP00000020962  QG.....D......H...IECVKLLLQ.-.................................................
ENSTNIP00000020961  QG.....D......H...IECVKLLLQ.-.................................................
ENSTNIP00000019592  RQ.....G......H...WQIAEQLLQ.-.................................................
ENSTNIP00000007965  QG.....D......H...VDCVQHLLR.-.................................................
ENSTNIP00000018708  AR.....G......F...VDIVECLVE.-.................................................
ENSTNIP00000011422  WQ.....G......H...LGIVKLLVK.Q.................................................
ENSTNIP00000017008  KH.....N......H...WQVVQLLLN.-.................................................
ENSTNIP00000020964  QG.....D......H...IECVKLLLQ.-.................................................
ENSTNIP00000012589  KR.....G......S...LASFGVITQ.N.................................................
ENSTNIP00000007468  KN.....E......H...QDIVEFLIS.-.................................................
ENSTNIP00000015489  YH.....G......N...KQNLELLLEmS.................................................
ENSTNIP00000020926  YN.....G......Y...DSCVEVLLD.-.................................................
ENSTNIP00000016214  KK.....G......C...LARVQKLCS.P.................................................
ENSTNIP00000016215  KK.....G......C...LARVQKLCS.P.................................................
ENSTNIP00000020449  --.....-......-...---------.-.................................................
ENSTNIP00000000938  --.....-......-...---------.-.................................................
ENSTNIP00000000106  --.....-......-...---------.-.................................................
ENSTNIP00000011013  LQpkglkN......I...PEEVLQHNS.-.................................................
ENSTNIP00000022975  YY.....G......H...EGCVEVLLE.-.................................................
ENSTNIP00000001836  WQ.....G......H...IEMVRLLIN.-.................................................
ENSTNIP00000005054  --.....-......-...---------.-.................................................
ENSTNIP00000000636  --.....-......-...---------.-.................................................
ENSTNIP00000022060  KK.....G......C...LARVQKLCS.P.................................................
ENSTNIP00000017877  SK.....K......R...DDMLSVLLE.-.................................................
ENSTNIP00000013825  AK.....D......F...RSIIEILVL.V.................................................
ENSTNIP00000007887  EY.....K......H...VDQVKLLLS.-.................................................
ENSTNIP00000006529  RH.....G......N...LLCFSVITQ.H.................................................
ENSTNIP00000013614  AK.....G......F...LSIVKLLVEeG.................................................
ENSTNIP00000012342  KH.....G......H...TQVAELLLK.-.................................................
ENSTNIP00000010055  QN.....G......H...IQSSKVLLL.-.................................................
ENSTNIP00000002777  SK.....D......R...YEIALMLLE.-.................................................
ENSTNIP00000015489  YK.....G......H...EDCLEVLLE.Fktfiheegnpftplhcalmnghsgaaerllesa................
ENSTNIP00000001972  GN.....N......H...EPCASLLLE.A.................................................
ENSTNIP00000004254  GN.....N......H...EPCASLLLE.A.................................................
ENSTNIP00000020780  QH.....G......H...SKVVDTLLK.-.................................................
ENSTNIP00000020505  SR.....D......N...TEICETLIR.-.................................................
ENSTNIP00000019489  LN.....R......Q...HQIISDLAR.-.................................................
ENSTNIP00000001972  AN.....N......A...LRCAEVIIP.-.................................................
ENSTNIP00000022060  RS.....G......N...EEKLMALLT.P.................................................
ENSTNIP00000020274  --.....-......-...---------.-.................................................
ENSTNIP00000011600  LS.....G......K...VAVAQQLVE.-.................................................
ENSTNIP00000020643  QG.....G......H...HQVVEALLD.-.................................................
ENSTNIP00000008767  --.....-......-...---------.-.................................................
ENSTNIP00000008004  QQ.....G......H...ENVVALLIN.-.................................................
ENSTNIP00000020403  RS.....R......D...LTSLLQLYA.-.................................................
ENSTNIP00000005775  ES.....G......S...LEIMQMLLQ.-.................................................
ENSTNIP00000016350  RR.....D......G...ERCLRLLVE.-.................................................
ENSTNIP00000006475  EH.....K......H...LDVIKVLLN.-.................................................
ENSTNIP00000004288  DE.....A......T...LELLEIVMA.-.................................................
ENSTNIP00000007797  QF.....G......H...TSIVAYLIA.-.................................................
ENSTNIP00000010973  DE.....A......T...LELLEIVMA.-.................................................
ENSTNIP00000009851  DD.....P......T...LDIIETAMA.N.................................................
ENSTNIP00000003355  RK.....G......D...PLVVDYLLT.Fapdiwgivsgrkransaavsaaefafsaslhc.................
ENSTNIP00000013324  RW.....G......Y...EGIIQVLLE.-.................................................
ENSTNIP00000002256  QK.....G......H...LNIVEVLLE.-.................................................
ENSTNIP00000015625  EE.....A......M...EELLQNEIN.R.................................................
ENSTNIP00000001122  ED.....A......M...ERLLKEEIK.K.................................................
ENSTNIP00000016215  RS.....G......N...EEKLMALLT.P.................................................
ENSTNIP00000000847  FS.....G......H...VE-------.-.................................................
ENSTNIP00000000101  LG.....G......H...IDCVHILLE.-.................................................
ENSTNIP00000019171  ED.....A......M...ERLLKEEIK.K.................................................
ENSTNIP00000003589  ED.....A......M...ERLLKEEIK.K.................................................
ENSTNIP00000021546  FY.....N......R...PEHVRLLIK.-.................................................
ENSTNIP00000016214  RS.....G......N...EEKLMALLT.P.................................................
ENSTNIP00000008096  IG.....G......N...ADCVKLLIA.-.................................................
ENSTNIP00000021658  ER.....G......N...TEALDVLVR.-.................................................
ENSTNIP00000009879  YH.....G......H...EDCLCILLE.-.................................................
ENSTNIP00000009476  IR.....E......R...SSCVRILLD.-.................................................
ENSTNIP00000020961  QQ.....G......H...NSVVSLLLE.-.................................................
ENSTNIP00000014947  QE.....G......H...LEIVQYLLK.D.................................................
ENSTNIP00000020962  QQ.....G......H...NSVVSLLLE.-.................................................
ENSTNIP00000003486  KY.....S......E...KCCVEEVLK.A.................................................
ENSTNIP00000002157  KY.....S......E...KCCVEEVLK.A.................................................
ENSTNIP00000022028  KY.....S......E...KCCVEEVLK.A.................................................
ENSTNIP00000009270  EF.....G......R...VQVAQLLLS.-.................................................
ENSTNIP00000009271  EF.....G......R...VQVAQLLLS.-.................................................
ENSTNIP00000005251  LA.....N......Q...LSSLRELLE.-.................................................
ENSTNIP00000005250  LA.....N......Q...LSSLRELLE.-.................................................
ENSTNIP00000002767  KY.....S......E...KCCVEEVLK.A.................................................
ENSTNIP00000005249  LA.....N......Q...LSSLRELLE.-.................................................
ENSTNIP00000017214  VN.....G......R...TELLHDLVQ.-.................................................
ENSTNIP00000018491  NN.....G......H...DACALALLE.-.................................................
ENSTNIP00000001443  MA.....G......C...SSSVKLLCD.-.................................................
ENSTNIP00000012425  MA.....G......C...SSSVKLLCD.-.................................................
ENSTNIP00000000418  MA.....G......C...SSSVKLLCD.-.................................................
ENSTNIP00000011989  SG.....G......N...TQVVQLLCE.-.................................................
ENSTNIP00000019096  MS.....G......N...SECVQLMID.-.................................................
ENSTNIP00000022908  MA.....G......C...SSSVKLLCD.-.................................................
ENSTNIP00000021546  LG.....G......N...AEVCQILME.-.................................................
ENSTNIP00000001350  AA.....D......A...QGVFQILIR.N.................................................
ENSTNIP00000022034  LY.....G......R...LEVVCMLIN.-.................................................
ENSTNIP00000003225  AA.....D......A...QGVFQILIR.N.................................................
ENSTNIP00000004105  AA.....D......A...QGVFQILIR.N.................................................
ENSTNIP00000010006  AA.....D......A...QGVFQILIR.N.................................................
ENSTNIP00000014371  LY.....G......R...LEVVCMLIN.-.................................................
ENSTNIP00000017023  EF.....G......R...VGVVQLLLS.-.................................................
ENSTNIP00000015550  LY.....G......R...LEVVKLLLT.-.................................................
ENSTNIP00000004821  LY.....G......R...LEVVKLLLT.-.................................................
ENSTNIP00000018664  AA.....D......A...QGVFQILIR.N.................................................
ENSTNIP00000020926  AY.....G......R...TLCLELLME.T.................................................
ENSTNIP00000011335  RN.....G......L...PDHVELYLR.-.................................................
ENSTNIP00000004556  LF.....Q......H...MAIAAYLMA.-.................................................
ENSTNIP00000013317  GS.....G......S...TACIRLLLD.-.................................................
ENSTNIP00000009417  AA.....D......A...QGVFQILIR.N.................................................
ENSTNIP00000021733  AA.....D......A...QGVFQILIR.N.................................................
ENSTNIP00000003914  AA.....D......A...QGVFQILIR.N.................................................
ENSTNIP00000022373  EKaq...G......H...VAMCLRMLE.-.................................................
ENSTNIP00000011405  TH.....K......N...NKAAEAIIK.R.................................................
ENSTNIP00000016960  AK.....G......H...SECLEPLVQ.-.................................................
ENSTNIP00000007293  EF.....G......R...VAVVQLLLS.-.................................................
ENSTNIP00000008146  EF.....G......R...VAVVQLLLS.-.................................................
ENSTNIP00000016915  KK.....G......H...TECLDLLLS.-.................................................
ENSTNIP00000020652  DE.....A......T...ESLLQDYTL.-.................................................
ENSTNIP00000020964  QE.....N......H...LEVVRYLLE.-.................................................
ENSTNIP00000015802  SC.....G......N...ESIAYFLLQ.-.................................................
ENSTNIP00000011405  AS.....G......N...EPVFNQLLQ.C.................................................
ENSTNIP00000002262  EA.....G......R...LDCVRVLLT.-.................................................
ENSTNIP00000019154  EA.....G......R...LDCVRVLLT.-.................................................
ENSTNIP00000015812  LV.....Gg.....D...TSCCETLLY.-.................................................
ENSTNIP00000018163  EK.....-......D...ESCVELLLE.-.................................................
ENSTNIP00000006897  RR.....G......L...EEHVELFLK.-.................................................
ENSTNIP00000011305  SI.....P......S...ISTAVLLLK.-.................................................
ENSTNIP00000016930  EG.....Te.....S...SWILRKHLE.E.................................................
ENSTNIP00000019629  TG.....G......S...IVTVHYLWE.-.................................................
ENSTNIP00000000664  EG.....Te.....S...SWILRKHLE.E.................................................
ENSTNIP00000005820  KR.....G......S...SKCVKSLLS.-.................................................
ENSTNIP00000005228  YK.....G......H...ADVVRFLLE.-.................................................
ENSTNIP00000007470  QH.....G......H...YSTADVLLR.-.................................................
ENSTNIP00000011306  SI.....P......S...ISTAVLLLK.-.................................................
ENSTNIP00000004387  RF.....G......I...PELVALYLA.-.................................................
ENSTNIP00000000847  LN.....G......Q...TNTVEVLVN.-.................................................
ENSTNIP00000001107  TA.....Saqedr.I...TRCVELLLS.-.................................................
ENSTNIP00000021112  LT.....Gg.....E...TSCCETLLY.-.................................................
ENSTNIP00000017960  LT.....Gg.....E...TSCCETLLY.-.................................................
ENSTNIP00000005432  IV.....Gg.....A...PYCCELLLQ.-.................................................
ENSTNIP00000000101  ER.....G......Q...TRAVEFLLH.-.................................................
ENSTNIP00000013166  VS.....-......H...NAVVKELRD.A.................................................
ENSTNIP00000002306  GI.....L......H...EDLLAGLIK.-.................................................
ENSTNIP00000018558  KT.....G......H...TALVLELLL.-.................................................
ENSTNIP00000001438  TA.....Saqedr.I...TRCVELLLS.-.................................................
ENSTNIP00000021633  IS.....H......S...ATMKALSSG.-.................................................
ENSTNIP00000022373  AE.....G......C...YEVVRYLLG.-.................................................
ENSTNIP00000011850  AG.....G......F...IDVVKVLLK.-.................................................
ENSTNIP00000008855  RG.....G......S...LPALQLLLN.-.................................................
ENSTNIP00000007188  EK.....G......H...RDVVEFLAP.-.................................................
ENSTNIP00000004671  KE.....G......H...VKMVLELLH.-.................................................
ENSTNIP00000004034  TA.....Saqedr.I...TRCVELLLS.-.................................................
ENSTNIP00000018931  KE.....G......H...VKMVLELLH.-.................................................
ENSTNIP00000010671  LTapdgpG......G...MEVVRKLME.-.................................................
ENSTNIP00000013098  LS.....TvkeeeeD...MGVVKKLFC.-.................................................
ENSTNIP00000016922  HF.....G......K...LECVMRLVQ.-.................................................
ENSTNIP00000021111  --.....-......-...---------.-.................................................
ENSTNIP00000003381  LA.....Avdtpk.D...MRTVEELFS.-.................................................
ENSTNIP00000020505  ER.....N......R...RAAAAVLLQ.-.................................................
ENSTNIP00000018712  LA.....Avdtpk.D...MRTVEELFS.-.................................................
ENSTNIP00000021261  LT.....Aadspd.D...LEVAQQLLK.-.................................................
ENSTNIP00000022919  EK.....G......R...DGALEVLLT.-.................................................
ENSTNIP00000010298  LA.....Avespd.D...MKVVEQLFR.-.................................................
ENSTNIP00000019340  RE.....G......R...SSVVDMLIM.-.................................................
ENSTNIP00000019537  IK.....G......D...VEAVKELLD.-.................................................
ENSTNIP00000012849  RE.....G......R...SGVVDMLIM.-.................................................
ENSTNIP00000021203  AK.....G......D...TAQVRLLLG.-.................................................
ENSTNIP00000016430  AH.....G......Q...IAVVEFLLQ.-.................................................
ENSTNIP00000021749  LA.....Afhs...D...SDFQTVLQT.V.................................................
ENSTNIP00000003121  --.....-......-...---------.-.................................................
ENSTNIP00000018281  --.....-......-...---------.-.................................................
ENSTNIP00000002757  IR.....G......D...VKQVKELIS.-.................................................
ENSTNIP00000017905  IR.....G......D...VKQVKELIS.-.................................................
ENSTNIP00000016177  AF.....G......E...KTMVDFLLD.-.................................................
ENSTNIP00000004254  YH.....G......H...AQALEVLLQ.-.................................................
ENSTNIP00000004505  RN.....G......Q...KKCMGRLLE.-.................................................
ENSTNIP00000007098  RE.....G......D...AEILKELLK.-.................................................
ENSTNIP00000018860  RE.....G......D...VDVLRELLR.-.................................................
ENSTNIP00000018861  RE.....G......D...VDVLRELLR.-.................................................
ENSTNIP00000011013  SI.....N......N...CEALTTLLK.-.................................................
ENSTNIP00000004254  AS.....D......L...D--------.-.................................................
ENSTNIP00000018753  AG.....G......H...DDILRLLIR.-.................................................
ENSTNIP00000003344  --.....-......-...---------.-.................................................
ENSTNIP00000011405  SN.....Q......L...PLVVDAICT.-.................................................
ENSTNIP00000017191  YS.....G......H...VDAASALLT.-.................................................
ENSTNIP00000020431  ID.....G......N...LKQVQYLVE.-.................................................
ENSTNIP00000011744  RV.....G......R...LDILQELIR.-.................................................
ENSTNIP00000014438  AR.....G......H...REVCGLLLQ.S.................................................
ENSTNIP00000022060  AS.....P......HpkrKQVTELLLR.-.................................................
ENSTNIP00000005333  LM.....P......V...LLLGYFILG.-.................................................
ENSTNIP00000014824  RD.....G......Y...LDVLKEATR.-.................................................
ENSTNIP00000009879  AE.....G......Q...MDCLLLLVN.-.................................................
ENSTNIP00000001972  YH.....G......H...AQALEVLLQ.-.................................................
ENSTNIP00000008197  RR.....Gv.....N...KDAIRL---.-.................................................
ENSTNIP00000008859  FT.....G......R...YETV-----.-.................................................
ENSTNIP00000001888  --.....-......-...---------.-.................................................
ENSTNIP00000008457  FT.....G......R...YETV-----.-.................................................
ENSTNIP00000019974  --.....-......-...---------.-.................................................
ENSTNIP00000016215  MA.....G......H...LHTCRLLLG.-.................................................
ENSTNIP00000012669  RD.....G......R...LDLLKEATR.-.................................................
ENSTNIP00000014343  KT.....G......D...LEEVKAKLV.-.................................................
ENSTNIP00000009374  RL.....G......Y...QDVVLYCLE.-.................................................
ENSTNIP00000013843  LN.....N......H...RDVAEILIK.-.................................................
ENSTNIP00000019152  --.....-......-...--CVELLLS.-.................................................
ENSTNIP00000019800  KR.....G......N...LSWLRECIE.-.................................................
ENSTNIP00000011128  --.....-......-...---------.-.................................................
ENSTNIP00000016214  --.....-......-...---------.-.................................................
ENSTNIP00000003581  RL.....G......Y...QDVVLYCLE.-.................................................
ENSTNIP00000009375  RL.....G......Y...QDVVLYCLE.-.................................................
ENSTNIP00000019856  RY.....G......Q...EKVLLWLLQ.-.................................................
ENSTNIP00000017493  --.....-......-...---------.-.................................................
ENSTNIP00000004637  FT.....G......R...QETAAL---.-.................................................
ENSTNIP00000000199  ED.....G......D...PRSVQLLLT.-.................................................
ENSTNIP00000014598  --.....G......N...VQEASRLLG.-.................................................
ENSTNIP00000022443  NA.....D......D...KETLKLLLD.-.................................................
ENSTNIP00000021145  ID.....G......Y...LDLLKEATR.-.................................................
ENSTNIP00000016530  --.....Q......H...CDA------.-.................................................
ENSTNIP00000001856  --.....-......-...---------.-.................................................
ENSTNIP00000003340  --.....-......-...---------.-.................................................
ENSTNIP00000003075  --.....-......-...---------.-.................................................
ENSTNIP00000011507  --.....-......-...---------.-.................................................
ENSTNIP00000021687  --.....-......-...---------.-.................................................
ENSTNIP00000004278  --.....-......-...-PDMAEALA.-.................................................
ENSTNIP00000018637  --.....-......-...-PDMAEALA.-.................................................
ENSTNIP00000011193  AA.....G......N...FELVSLLLE.-.................................................
ENSTNIP00000015635  --.....-......-...---------.-.................................................
ENSTNIP00000006573  RN.....Q......N...LAAMAEALA.-.................................................
ENSTNIP00000005633  LE.....G......E...FDLVQRIIY.-.................................................
ENSTNIP00000005157  ER.....G......H...SEVVAILQS.-.................................................
ENSTNIP00000019463  --.....-......-...---------.-.................................................
ENSTNIP00000015383  RN.....Q......N...LAAMAEALA.-.................................................
ENSTNIP00000017006  QR.....G......H...IEVLCYLLR.N.................................................
ENSTNIP00000004078  --.....-......-...---------.-.................................................
ENSTNIP00000007396  --.....-......-...---------.-.................................................
ENSTNIP00000018125  --.....-......-...---------.-.................................................
ENSTNIP00000013051  AL.....Q......N...FPIMADALA.-.................................................
ENSTNIP00000002932  AL.....Q......N...FPIMADALA.-.................................................
ENSTNIP00000005133  HL.....H......N...LPLMAEALA.-.................................................
ENSTNIP00000018052  --.....-......-...---------.-.................................................
ENSTNIP00000002528  --.....-......-...---------.-.................................................
ENSTNIP00000017494  --.....-......-...LECLMRLVQ.-.................................................
ENSTNIP00000020678  CE.....G......D...TELLSKLLD.-.................................................
ENSTNIP00000002762  --.....-......-...---------.-.................................................
ENSTNIP00000017148  --.....-......-...---------.-.................................................
ENSTNIP00000022679  --.....-......-...---------.-.................................................
ENSTNIP00000016402  EE.....Se.....R...LPCLLTLLD.-.................................................
ENSTNIP00000014119  LA.....G......D...LVAMAAALA.-.................................................
ENSTNIP00000005520  EF.....G......R...LKVCQCLQT.I.................................................
ENSTNIP00000009225  -R.....G......Q...LSIVQQLLD.-.................................................
ENSTNIP00000000650  -R.....G......Q...LSIVQQLLD.-.................................................
ENSTNIP00000016194  --.....-......-...---------.-.................................................
ENSTNIP00000023095  --.....-......-...---------.-.................................................
ENSTNIP00000019373  --.....-......-...---------.-.................................................
ENSTNIP00000007443  --.....-......-...---------.-.................................................
ENSTNIP00000012036  RH.....N......H...TELALSLES.-.................................................
ENSTNIP00000002856  --.....-......-...---------.-.................................................
ENSTNIP00000011373  CT.....N......Q...PLMVDFLLD.-.................................................
ENSTNIP00000017385  V-.....-......-...---------.-.................................................
ENSTNIP00000016007  --.....G......H...YGCVEALLT.-.................................................
ENSTNIP00000018968  --.....-......-...---------.-.................................................
ENSTNIP00000016756  -T.....E......D...LARLMELHQ.-.................................................
ENSTNIP00000022850  --.....-......-...---------.-.................................................
ENSTNIP00000011921  --.....-......-...---------.-.................................................
ENSTNIP00000015620  GA.....G......D...VATMSECVR.-.................................................
ENSTNIP00000015621  GA.....G......D...VATMSECVR.-.................................................
ENSTNIP00000018971  HI.....-......-...---------.-.................................................
ENSTNIP00000019525  --.....-......-...---------.-.................................................
ENSTNIP00000017519  --.....-......-...---------.-.................................................
ENSTNIP00000002927  --.....-......-...---------.-.................................................
ENSTNIP00000007442  ST.....R......D...PEMVRLVLR.-.................................................
ENSTNIP00000018523  --.....-......-...---------.-.................................................
ENSTNIP00000018573  RE.....N......N...IDHISQAIS.L.................................................
ENSTNIP00000018967  ST.....G......D...PEMVQLVLQ.-.................................................
ENSTNIP00000009206  --.....-......-...---------.-.................................................
ENSTNIP00000011337  --.....-......-...---------.-.................................................
ENSTNIP00000011338  --.....-......-...---------.-.................................................
ENSTNIP00000013404  --.....-......-...--------R.-.................................................
ENSTNIP00000020298  --.....-......-...---------.-.................................................
ENSTNIP00000011339  --.....-......-...---------.-.................................................
ENSTNIP00000022519  --.....-......-...---------.-.................................................
ENSTNIP00000012880  --.....-......-...---------.-.................................................
ENSTNIP00000011355  SY.....G......D...RQMITAILR.-.................................................
ENSTNIP00000015560  --.....-......-...---------.-.................................................
ENSTNIP00000019851  --.....-......-...---------.-.................................................
ENSTNIP00000018795  --.....-......-...---------.-.................................................
ENSTNIP00000002487  --.....-......-...---------.-.................................................
ENSTNIP00000015606  --.....-......-...---------.-.................................................
ENSTNIP00000004513  ST.....G......D...PELVQLVLQ.-.................................................
ENSTNIP00000011764  YF.....D......V...PQLIRVVMQ.-.................................................
ENSTNIP00000022664  AQ.....G......Y...AGLIQTLIR.W.................................................
ENSTNIP00000005233  --.....-......-...---------.-.................................................
ENSTNIP00000004058  --.....-......-...---------.-.................................................
ENSTNIP00000005705  --.....-......-...---------.-.................................................
ENSTNIP00000021608  PN.....K......-...---------.-.................................................
ENSTNIP00000005234  --.....-......-...---------.-.................................................
ENSTNIP00000015738  HR.....N......N...YEILTMLLK.-.................................................
ENSTNIP00000014183  HT.....N......N...YEIIKLLVQ.-.................................................
ENSTNIP00000016122  ST.....G......D...PELVQLVLQ.-.................................................
ENSTNIP00000017007  --.....-......-...---------.-.................................................
ENSTNIP00000009570  AL.....Pgpa...G...PEITEMLLH.-.................................................
ENSTNIP00000000064  --.....-......-...---------.-.................................................
ENSTNIP00000008592  --.....-......-...---------.-.................................................
ENSTNIP00000003464  --.....-......-...---------.-.................................................
ENSTNIP00000009671  --.....-......-...-GQLRLFLS.L.................................................
ENSTNIP00000022235  --.....-......-...---------.-.................................................
ENSTNIP00000015515  GQ.....G......Y...ANLIQTLIK.W.................................................
ENSTNIP00000009474  QH.....G......H...LDVVRLLVQ.R.................................................
ENSTNIP00000012823  --.....-......-...---------.-.................................................
ENSTNIP00000005275  --.....-......-...---------.-.................................................
ENSTNIP00000021054  EQ.....G......Q...YSDVKFLV-.-.................................................
ENSTNIP00000006242  --.....-......-...---------.-.................................................
ENSTNIP00000007859  --.....-......-...---------.-.................................................
ENSTNIP00000005228  --.....-......-...---------.-.................................................
ENSTNIP00000003152  --.....-......-...---------.-.................................................
ENSTNIP00000021405  --.....-......-...---LRLPGS.-.................................................
ENSTNIP00000004004  --.....-......-...---LRLPGS.-.................................................
ENSTNIP00000017490  HT.....G......C...KEMVRYILD.N.................................................
ENSTNIP00000003748  HS.....D......D...FAVIN----.-.................................................
ENSTNIP00000019574  --.....-......-...---------.-.................................................
ENSTNIP00000019868  --.....-......-...---------.-.................................................
ENSTNIP00000019867  --.....-......-...---------.-.................................................
ENSTNIP00000020790  --.....-......-...---------.-.................................................
ENSTNIP00000009879  YL.....G......D...VHIMELIIA.-.................................................
ENSTNIP00000000101  YL.....G......D...VHIMELIIA.-.................................................
ENSTNIP00000005477  --.....-......-...---------.-.................................................
ENSTNIP00000007556  --.....-......-...---------.-.................................................
ENSTNIP00000014109  YF.....Eli....P...ELITAVLLK.A.................................................
ENSTNIP00000017432  --.....-......-...---------.-.................................................
ENSTNIP00000009570  --.....-......-...---------.-.................................................
ENSTNIP00000006306  --.....-......-...---------.-.................................................
ENSTNIP00000006163  --.....-......-...---------.-.................................................
ENSTNIP00000015769  --.....-......-...---------.-.................................................
ENSTNIP00000015422  --.....-......-...---------.-.................................................
ENSTNIP00000019364  QV.....S......L...KKVLSVLLD.R.................................................
ENSTNIP00000014874  --.....-......-...---------.-.................................................
ENSTNIP00000001049  --.....-......-...---------.-.................................................
ENSTNIP00000014843  --.....-......-...---------.-.................................................
ENSTNIP00000016727  --.....-......-...---------.-.................................................
ENSTNIP00000006578  --.....-......-...---------.-.................................................
ENSTNIP00000007406  --.....-......-...---------.-.................................................


                                                 170        180                                     
                                                   |          |                                     
d1s70b_               ....................QGVDI.EAARK.EEERIMLRD.....................................
ENSTNIP00000018931  ....................YGASA.NAESL.QGVTPLHLA.....................................
ENSTNIP00000004671  ....................SGATP.NAESL.QGITPLHLA.....................................
ENSTNIP00000008004  ....................SGATP.NAESL.QGITPLHLA.....................................
ENSTNIP00000017432  ....................YGAPT.NTVTR.QGITPLHLA.....................................
ENSTNIP00000020962  ....iaakknqtkiasallqYGAET.NILTK.QGVSPLHLA.....................................
ENSTNIP00000020961  ....iaakknqtkiasallqYGAET.NILTK.QGVSPLHLA.....................................
ENSTNIP00000020964  ....iaakknqtkiasallqYGAET.NILTK.QGVSPLHLA.....................................
ENSTNIP00000020160  tplhiaakknqmdigttlleYGADT.NAVTR.QGISPIHLA.....................................
ENSTNIP00000022654  tplhiaakknqmdigttlleYGADT.NAVTR.QGISPIHLA.....................................
ENSTNIP00000007965  ....................HGAAT.DVLTV.QGVAPLHLV.....................................
ENSTNIP00000020160  ....................RGAPI.LSKTK.NGLSPLHMA.....................................
ENSTNIP00000022654  ....................RGAPI.LSKTK.NGLSPLHMA.....................................
ENSTNIP00000004254  ....................CGANV.SQPNN.KGFTPLHFA.....................................
ENSTNIP00000015489  ....................HGANV.NQPNK.CGYTPLHLA.....................................
ENSTNIP00000009879  ....................NGGEI.DCVDI.FGNTPLHVA.....................................
ENSTNIP00000007449  ....................AGADV.DQEGA.NSMTALIVA.....................................
ENSTNIP00000005052  ....................AGADV.DQEGA.NSMTALIVA.....................................
ENSTNIP00000001326  ....................AGADV.DQEGA.NSMTALIVA.....................................
ENSTNIP00000020926  ....................LGVNV.NEVNA.YGNTPLHLA.....................................
ENSTNIP00000022840  ....................AGADV.DQEGA.NSMTALIVA.....................................
ENSTNIP00000004030  ....................NGADV.DQEGA.NSMTALIVA.....................................
ENSTNIP00000020447  ....................NGADV.DQEGA.NSMTALIVA.....................................
ENSTNIP00000002067  ....................---DV.DQEGA.NSMTALIVA.....................................
ENSTNIP00000003481  ....................---DV.DQEGA.NSMTALIVA.....................................
ENSTNIP00000001972  ....................NGGEI.DSVDK.DGNTPLHIA.....................................
ENSTNIP00000001668  ....................NGADV.DQEGA.NSMTALIVA.....................................
ENSTNIP00000000101  ....................NGADV.TMQNK.EGKSPLHVA.....................................
ENSTNIP00000000847  ....................SGASV.NVLDQ.RGCGPLHYA.....................................
ENSTNIP00000021608  ....................HGAEV.ACKDK.KSYTPLHAA.....................................
ENSTNIP00000011850  ....................AGADI.ELG--.-CSTPLMEA.....................................
ENSTNIP00000011850  ....................MGSDI.NAQIEtNRNTALTLA.....................................
ENSTNIP00000010597  ....................QGADP.TATDS.SFSTPLHLS.....................................
ENSTNIP00000018931  ....................-----.-----.---------.....................................
ENSTNIP00000021608  ....................SGASV.NDLDE.RGCTPLHYA.....................................
ENSTNIP00000021608  ....................HSANF.LAQDC.KGRTPIHLA.....................................
ENSTNIP00000004671  ....................-----.-----.---------.....................................
ENSTNIP00000008004  ....................-----.-----.---------.....................................
ENSTNIP00000000651  ....................HGADV.NMADK.QGRSPLMMA.....................................
ENSTNIP00000017452  ....................HGADV.NMADK.QGRSPLMMA.....................................
ENSTNIP00000020962  ....................-----.-----.---------.....................................
ENSTNIP00000020961  ....................-----.-----.---------.....................................
ENSTNIP00000019592  ....................HGADI.NVSDK.QGRTLLMVA.....................................
ENSTNIP00000007965  ....................HQAPV.DDVTL.DYLTALHVA.....................................
ENSTNIP00000018708  ....................HRANL.ETCDK.DGHTALHLA.....................................
ENSTNIP00000011422  ....................AGADV.DGQTA.DGRTPLHLA.....................................
ENSTNIP00000017008  ....................HRVDV.NSVDQ.QGRTALMVA.....................................
ENSTNIP00000020964  ....................-----.-----.---------.....................................
ENSTNIP00000012589  ....................CRRH-.-----.---------.....................................
ENSTNIP00000007468  ....................QKADA.NKPGK.TGLLPLHVA.....................................
ENSTNIP00000015489  ....................FNALG.DIESS.IPVSPLHLA.....................................
ENSTNIP00000020926  ....................-QEVF.KQVKG.NAFSPLHCA.....................................
ENSTNIP00000016214  ....................DNINC.RDTQG.RNSTPLHLA.....................................
ENSTNIP00000016215  ....................DNINC.RDTQG.RNSTPLHLA.....................................
ENSTNIP00000020449  ....................-----.-----.---------.....................................
ENSTNIP00000000938  ....................-----.-----.---------.....................................
ENSTNIP00000000106  ....................-----.-----.---------.....................................
ENSTNIP00000011013  ....................VKALL.SCEDN.EGCTPLHYA.....................................
ENSTNIP00000022975  ....................-QKGC.RCIDG.NPFTPLHCA.....................................
ENSTNIP00000001836  ....................-----.-----.---------.....................................
ENSTNIP00000005054  ....................-----.-----.---------.....................................
ENSTNIP00000000636  ....................-----.-----.---------.....................................
ENSTNIP00000022060  ....................ENINC.RDTQG.RNSTPLHLA.....................................
ENSTNIP00000017877  ....................SGADV.TITNN.NGFNALHHA.....................................
ENSTNIP00000013825  ....................PNIDF.TQQNH.RGFNLLHHA.....................................
ENSTNIP00000007887  ....................-----.-----.---------.....................................
ENSTNIP00000006529  ....................CQPEH.-----.---------.....................................
ENSTNIP00000013614  ....................SKAKV.NAKDN.EDHIPLHFS.....................................
ENSTNIP00000012342  ....................-----.-----.---------.....................................
ENSTNIP00000010055  ....................-----.-----.---------.....................................
ENSTNIP00000002777  ....................-----.-----.---------.....................................
ENSTNIP00000015489  ....................GAYML.NTRDA.KGRTPLHAA.....................................
ENSTNIP00000001972  ....................MGSDIvGCRDA.KGRTPLHAA.....................................
ENSTNIP00000004254  ....................MGSDIvGCRDA.KGRTPLHAA.....................................
ENSTNIP00000020780  ....................-----.-----.---------.....................................
ENSTNIP00000020505  ....................-----.-----.---------.....................................
ENSTNIP00000019489  ....................-----.-----.---------.....................................
ENSTNIP00000001972  ....................-----.-----.---------.....................................
ENSTNIP00000022060  ....................LNVNC.HASDG.RKSTPLHLA.....................................
ENSTNIP00000020274  ....................-----.-----.---------.....................................
ENSTNIP00000011600  ....................RGSDP.DRVNV.LSQTAFELA.....................................
ENSTNIP00000020643  ....................KGADV.QSQAH.DDASGLYEA.....................................
ENSTNIP00000008767  ....................-----.-----.---------.....................................
ENSTNIP00000008004  ....................-----.-----.---------.....................................
ENSTNIP00000020403  ....................-----.-----.---------.....................................
ENSTNIP00000005775  ....................YGASM.-----.---------.....................................
ENSTNIP00000016350  ....................-----.-----.---------.....................................
ENSTNIP00000006475  ....................-----.-----.---------.....................................
ENSTNIP00000004288  ....................EQVGI.TQDRI.DEFRGVKEA.....................................
ENSTNIP00000007797  ....................-----.-----.---------.....................................
ENSTNIP00000010973  ....................EQVGI.TQDRI.DEFRGVKEA.....................................
ENSTNIP00000009851  ....................RGITQ.EMINE.TRASTERRM.....................................
ENSTNIP00000003355  ....................S----.-----.---------.....................................
ENSTNIP00000013324  ....................NGADA.HLLNR.SRASPLQCAlnakilmllqsnqngrqhtrsgftvsvssspqtsdhs
ENSTNIP00000002256  ....................KGAHV.KAESE.SGSVLFDAA.....................................
ENSTNIP00000015625  ....................QGVDI.EAARK.EEERVMLRD.....................................
ENSTNIP00000001122  ....................QGIDV.DKARK.EEERVMLQE.....................................
ENSTNIP00000016215  ....................LNVNC.HASDG.RKSTPLHLA.....................................
ENSTNIP00000000847  ....................-----.-----.---------.....................................
ENSTNIP00000000101  ....................-----.-----.---------.....................................
ENSTNIP00000019171  ....................QGIDV.DKARK.EEERVMLQE.....................................
ENSTNIP00000003589  ....................QGIDV.DKARK.EEERVMLQE.....................................
ENSTNIP00000021546  ....................HDSNI.GIPDS.EGKIPLHWA.....................................
ENSTNIP00000016214  ....................LNVNC.HASDG.RKSTPLHLA.....................................
ENSTNIP00000008096  ....................-----.-----.---------.....................................
ENSTNIP00000021658  ....................HGGDV.KAQAT.NGDSVLYDA.....................................
ENSTNIP00000009879  ....................-KKLF.NYKEG.NLFTPLHCA.....................................
ENSTNIP00000009476  ....................-----.-----.---------.....................................
ENSTNIP00000020961  ....................-----.-----.---------.....................................
ENSTNIP00000014947  ....................CQADS.SIRAN.DGMTALHAA.....................................
ENSTNIP00000020962  ....................-----.-----.---------.....................................
ENSTNIP00000003486  ....................DSGQL.HAEDSaYGGTPLHWA.....................................
ENSTNIP00000002157  ....................DSGQL.HAEDSaYGGTPLHWA.....................................
ENSTNIP00000022028  ....................DSGQL.HAEDSaYGGTPLHWA.....................................
ENSTNIP00000009270  ....................SNMVV.ALL--.---------.....................................
ENSTNIP00000009271  ....................SNMVV.ALL--.---------.....................................
ENSTNIP00000005251  ....................-----.-----.---------.....................................
ENSTNIP00000005250  ....................-----.-----.---------.....................................
ENSTNIP00000002767  ....................DSGQL.HAEDSaYGGTPLHWA.....................................
ENSTNIP00000005249  ....................-----.-----.---------.....................................
ENSTNIP00000017214  ....................-----.-----.---------.....................................
ENSTNIP00000018491  ....................AGCEP.NIFMG.KSSVLHPVS.....................................
ENSTNIP00000001443  ....................-----.-----.---------.....................................
ENSTNIP00000012425  ....................-----.-----.---------.....................................
ENSTNIP00000000418  ....................-----.-----.---------.....................................
ENSTNIP00000011989  ....................-----.-----.---------.....................................
ENSTNIP00000019096  ....................-----.-----.---------.....................................
ENSTNIP00000022908  ....................-----.-----.---------.....................................
ENSTNIP00000021546  ....................-----.-----.---------.....................................
ENSTNIP00000001350  ....................RATDL.DARMH.DGTTPLILA.....................................
ENSTNIP00000022034  ....................-----.-----.---------.....................................
ENSTNIP00000003225  ....................RATDL.DARMH.DGTTPLILA.....................................
ENSTNIP00000004105  ....................RATDL.DARMH.DGTTPLILA.....................................
ENSTNIP00000010006  ....................RATDL.DARMH.DGTTPLILA.....................................
ENSTNIP00000014371  ....................-----.-----.---------.....................................
ENSTNIP00000017023  ....................SNMCA.ALL--.---------.....................................
ENSTNIP00000015550  ....................-----.-----.---------.....................................
ENSTNIP00000004821  ....................-----.-----.---------.....................................
ENSTNIP00000018664  ....................RATDL.DARMH.DGTTPLILA.....................................
ENSTNIP00000020926  ....................-----.-----.---------.....................................
ENSTNIP00000011335  ....................-----.-----.---------.....................................
ENSTNIP00000004556  ....................-----.-----.---------.............................