SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

TPR-like alignments in Drosophila melanogaster 76_5

These alignments are sequences aligned to the 0040251 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1kt1a1        ke...................................................................................
FBpp0112456  aqqvvelrpydieswsvmireaqtrpihevrslyeslvnvfpttarywklyiememrsryyerveklfqrclvkilnidlwklyl
FBpp0297503  aqqvvelrpydieswsvmireaqtrpihevrslyeslvnvfpttarywklyiememrsryyerveklfqrclvkilnidlwklyl
FBpp0112455  aqqvvelrpydieswsvmireaqtrpihevrslyeslvnvfpttarywklyiememrsryyerveklfqrclvkilnidlwklyl
FBpp0297502  aqqvvelrpydieswsvmireaqtrpihevrslyeslvnvfpttarywklyiememrsryyerveklfqrclvkilnidlwklyl
FBpp0070352  daykeyefaegnpmsdvenpfekgkeylskgdipsavl...............................................
FBpp0070351  daykeyefaegnpmsdvenpfekgkeylskgdipsavl...............................................
FBpp0070402  ednlrk...............................................................................
FBpp0080138  lyrslytaskqlddakrnvqsvgqlfqheieekrsllvqlckqiifkdyqsvgkkvrevmwrrgyyefiafvkknwhkqcqdaat
FBpp0080139  lyrslytaskqlddakrnvqsvgqlfqheieekrsllvqlckqiifkdyqsvgkkvrevmwrrgyyefiafvkknwhkqcqdaat
FBpp0301685  aqqvvelrpydieswsvmireaqtrpihevrs.....................................................
FBpp0074609  qkalqlmaeaekkltqqkgflgslfggs.........................................................
FBpp0084171  nivhlydqlmvlnqrnlilinwknfcyihdqlqdafkqllleqlkfvcehkvdvffwkllfynvrnylkrqqtdqahthtlllie
FBpp0085420  geiwlaihhfekavtldpnfldayinlgnvlkearifdravaaylralnlspnnavvhgnlacvyyeqglidlai..........
FBpp0085421  geiwlaihhfekavtldpnfldayinlgnvlkearifdravaaylralnlspnnavvhgnlacvyyeqglidlai..........
FBpp0085422  geiwlaihhfekavtldpnfldayinlgnvlkearifdravaaylralnlspnnavvhgnlacvyyeqglidlai..........
FBpp0085420  lelahreyqavdyesaekhcmqlwrqdstntgvllllssihfqcrrldksaqfs...............................
FBpp0085421  lelahreyqavdyesaekhcmqlwrqdstntgvllllssihfqcrrldksaqfs...............................
FBpp0085422  lelahreyqavdyesaekhcmqlwrqdstntgvllllssihfqcrrldksaqfs...............................
FBpp0077790  far..................................................................................
FBpp0082545  eq...................................................................................
FBpp0084693  vtarwsfeegikrpyfhvkpleraqlknwkdyldfeiekgdrervlvlfercliacalydefwlkmlrylesledqsgvvdlvrd
FBpp0084691  vtarwsfeegikrpyfhvkpleraqlknwkdyldfeiekgdrervlvlfercliacalydefwlkmlrylesledqsgvvdlvrd
FBpp0084692  vtarwsfeegikrpyfhvkpleraqlknwkdyldfeiekgdrervlvlfercliacalydefwlkmlrylesledqsgvvdlvrd
FBpp0084694  vtarwsfeegikrpyfhvkpleraqlknwkdyldfeiekgdrervlvlfercliacalydefwlkmlrylesledqsgvvdlvrd
FBpp0112211  vtarwsfeegikrpyfhvkpleraqlknwkdyldfeiekgdrervlvlfercliacalydefwlkmlrylesledqsgvvdlvrd
FBpp0072096  aeaedlvkqaekslklsmlkwvpdyds..........................................................
FBpp0071560  pqakpgvsyhariapnhlnvfinlanliaknqtrleeadhl............................................
FBpp0071561  pqakpgvsyhariapnhlnvfinlanliaknqtrleeadhl............................................
FBpp0077790  ek...................................................................................
FBpp0076600  pvtwcvsgncfslqkeheta.................................................................
FBpp0305561  pvtwcvsgncfslqkeheta.................................................................
FBpp0271716  medllnevvpqedlerfekkyhheleldgevttdtkfeyafclvrsrytndvrkgimileelarthpdg................
FBpp0077790  kv...................................................................................
FBpp0271718  medllnevvpqedlerfekkyhheleldgevttdtkfeyafclvrsrytndvrkgimileelarthpd.................
FBpp0290895  dwrdeeqlfrsaisinppkalgnlgsvlsaqgryeeaeltlr...........................................
FBpp0290896  eeqlfrsaisinppkalgnlgsvlsaqgryeeaeltlr...............................................
FBpp0081673  eeaealigqtdsa........................................................................
FBpp0293601  eslyrsaiain..........................................................................
FBpp0077614  eslyrsaiain..........................................................................
FBpp0084692  rav..................................................................................
FBpp0084694  rav..................................................................................
FBpp0112211  rav..................................................................................
FBpp0084691  rav..................................................................................
FBpp0084693  rav..................................................................................
FBpp0296980  qs...................................................................................
FBpp0300832  qs...................................................................................
FBpp0080535  l....................................................................................
FBpp0296963  l....................................................................................
FBpp0296980  gdrtgmgkaygnmarmahmagsyeaavkyhkqelai.................................................
FBpp0300832  gdrtgmgkaygnmarmahmagsyeaavkyhkqelai.................................................
FBpp0072164  qyk..................................................................................
FBpp0084016  tisfretqelrnmwsallnmelvysnnfddvlkealncndpleiyisvvdilkknkrkdrlssv.....................
FBpp0296980  ckdtqaa..............................................................................
FBpp0300832  ckdtqaa..............................................................................
FBpp0296980  d....................................................................................
FBpp0300832  d....................................................................................
FBpp0080894  p....................................................................................
FBpp0305185  p....................................................................................
FBpp0081606  .....................................................................................
FBpp0081607  .....................................................................................
FBpp0304082  .....................................................................................
FBpp0084559  ravefyqenlklmrdlgdrgaqg..............................................................
FBpp0075683  en...................................................................................
FBpp0303945  en...................................................................................
FBpp0303946  en...................................................................................
FBpp0081284  evs..................................................................................
FBpp0079468  rla..................................................................................
FBpp0087297  qqqdeartyfelavqsgrkl.................................................................
FBpp0074835  k....................................................................................
FBpp0079893  gtfhllcgsyvesqqdfdaiiandyadpnlrayayikraalyiqldqrekgia................................
FBpp0079894  gtfhllcgsyvesqqdfdaiiandyadpnlrayayikraalyiqldqrekgia................................
FBpp0079895  gtfhllcgsyvesqqdfdaiiandyadpnlrayayikraalyiqldqrekgia................................
FBpp0082765  lt...................................................................................
FBpp0079617  q....................................................................................
FBpp0084440  q....................................................................................
FBpp0305670  i....................................................................................
FBpp0080423  i....................................................................................
FBpp0305671  i....................................................................................
FBpp0080424  a....................................................................................
FBpp0305672  a....................................................................................
FBpp0085344  esfekalkfsfgeqhvwrqyglslmaaekhshalrvlqesmkltpsdplpcllasrlcyesletvkqgldyaqqalkrevkglrp
FBpp0081552  as...................................................................................
FBpp0297109  esfekalkfsfgeqhvwrqyglslmaaekhshalrvlqesmkltpsdplpcllasrlcyesletvkqgldyaqqalkrevkglrp
FBpp0087646  dcktfeayllcgklhmalknysdalnyv.........................................................
FBpp0083769  clvengdfnrlfyvah.....................................................................
FBpp0070572  k....................................................................................
FBpp0070573  k....................................................................................
FBpp0070575  k....................................................................................
FBpp0305905  k....................................................................................
FBpp0074835  rdqwfqeaieaeksgavnccqsivkavigigveeedrkq..............................................
FBpp0305670  em...................................................................................
FBpp0080424  m....................................................................................
FBpp0305672  m....................................................................................
FBpp0080423  m....................................................................................
FBpp0305671  m....................................................................................
FBpp0076113  qs...................................................................................
FBpp0076114  qs...................................................................................
FBpp0076115  qs...................................................................................
FBpp0305988  qs...................................................................................
FBpp0072561  ynlarlneamssydvadk...................................................................
FBpp0072562  ynlarlneamssydvadk...................................................................
FBpp0072561  dqshllgrayfcllegdkmdqadaq............................................................
FBpp0072562  dqshllgrayfcllegdkmdqadaq............................................................
FBpp0085923  .....................................................................................
FBpp0293601  eil..................................................................................
FBpp0079893  e....................................................................................
FBpp0079894  e....................................................................................
FBpp0079895  e....................................................................................
FBpp0075683  lr...................................................................................
FBpp0303945  lr...................................................................................
FBpp0303946  lr...................................................................................
FBpp0077614  eil..................................................................................
FBpp0085409  ileelarthpdgr........................................................................
FBpp0271717  ileelarthpdgr........................................................................
FBpp0271719  ileelarthpdgr........................................................................
FBpp0086749  rslkvwsmyadleesfgt...................................................................
FBpp0073411  dekmlat..............................................................................
FBpp0070907  mm...................................................................................
FBpp0303439  dekmlat..............................................................................
FBpp0070908  mm...................................................................................
FBpp0085842  trk..................................................................................
FBpp0300561  eeiet................................................................................
FBpp0077718  fqflyyheadvqkahslcqavleverqkpsgstgctlswwwqqqmgrcllalhyprraepflqqsltsfphpdtylllsrvyqri
FBpp0296980  fr...................................................................................
FBpp0300832  fr...................................................................................
FBpp0076600  esd..................................................................................
FBpp0305561  esd..................................................................................
FBpp0071712  ia...................................................................................
FBpp0086749  ehfvskhgksnhqlwnelcdlisknphkvhslnvdaiirgglrrytdqlg...................................
FBpp0085479  la...................................................................................
FBpp0112016  ia...................................................................................
FBpp0292906  kk...................................................................................
FBpp0305602  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0079666  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0084076  a....................................................................................
FBpp0111406  rv...................................................................................
FBpp0074918  ay...................................................................................
FBpp0082818  pgs..................................................................................
FBpp0074480  elkqyknglklakqilsnpkym...............................................................
FBpp0082819  ldtarfdiatkctkqlal...................................................................
FBpp0292061  svad.................................................................................
FBpp0085279  laealskakeafsldrtlhqfrdqhgenvyhnfdltyaqyersemhiealntysimaknkmfphv....................
FBpp0081805  afrsvad..............................................................................
FBpp0100021  wsade................................................................................
FBpp0100023  wsade................................................................................
FBpp0074877  wsade................................................................................
FBpp0071879  slqynrglvleelhmftlaaen...............................................................
FBpp0084559  gtedlrtls............................................................................
FBpp0075591  sre..................................................................................
FBpp0076526  ekarsdgnrdqvav.......................................................................
FBpp0079851  lhin.................................................................................
FBpp0290395  lnkalvylrqndvhqaietlqmydrksegsmtasaltnlsfiyislgnlemashcvnqlheigslknnapglinagivelgshnl
FBpp0072146  lh...................................................................................
FBpp0296980  q....................................................................................
FBpp0300832  q....................................................................................
FBpp0083238  ev...................................................................................
FBpp0111383  eqr..................................................................................
FBpp0080424  ydt..................................................................................
FBpp0305672  ydt..................................................................................
FBpp0305670  ydt..................................................................................
FBpp0071560  qaa..................................................................................
FBpp0071561  qaa..................................................................................
FBpp0080423  ydt..................................................................................
FBpp0305671  ydt..................................................................................
FBpp0071879  .....................................................................................
FBpp0077738  mdaalavyhkaedwfsqvkilcylgkiskad......................................................
FBpp0077934  lrd..................................................................................
FBpp0292775  mdaalavyhkaedwfsqvkilcylgkiskad......................................................
FBpp0087646  n....................................................................................
FBpp0292906  de...................................................................................
FBpp0079664  de...................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  ad...................................................................................
FBpp0077619  n....................................................................................
FBpp0086164  ltadr................................................................................
FBpp0297722  ltadr................................................................................
FBpp0087232  aae..................................................................................
FBpp0072561  y....................................................................................
FBpp0072562  y....................................................................................
FBpp0088148  eavrtwrsalkgtcqredcfqllgyly..........................................................
FBpp0088149  eavrtwrsalkgtcqredcfqllgyly..........................................................
FBpp0075786  ll...................................................................................
FBpp0075788  ll...................................................................................
FBpp0306229  ll...................................................................................
FBpp0075787  ll...................................................................................
FBpp0075789  ll...................................................................................
FBpp0301715  ll...................................................................................
FBpp0301716  ll...................................................................................
FBpp0306230  ll...................................................................................
FBpp0075785  ll...................................................................................
FBpp0083319  nkfg.................................................................................
FBpp0076498  s....................................................................................
FBpp0293529  s....................................................................................
FBpp0290580  .....................................................................................
FBpp0290395  av...................................................................................
FBpp0080720  wf...................................................................................
FBpp0086164  lm...................................................................................
FBpp0297722  lm...................................................................................
FBpp0080741  davamarratvliaeigrdknmeifcd..........................................................
FBpp0087297  fvqgl................................................................................
FBpp0070720  hvwlkylkarlvvtqtdeerkafeeqcakalgyyysiplseyvvnylvdqgnvqnhvlwaklladydverpdfgdklrslistit
FBpp0089396  hvwlkylkarlvvtqtdeerkafeeqcakalgyyysiplseyvvnylvdqgnvqnhvlwaklladydverpdfgdklrslistit
FBpp0111789  hvwlkylkarlvvtqtdeerkafeeqcakalgyyysiplseyvvnylvdqgnvqnhvlwaklladydverpdfgdklrslistit
FBpp0086683  k....................................................................................
FBpp0289328  nllnqvdqlgekfealrmylssvgyelhrslnekvqyvsnpinafsllrrthedlpkwheyfkeaigegnqsilvdlvkmvpndv
FBpp0070667  dglqhh...............................................................................
FBpp0082624  qqls.................................................................................
FBpp0081552  ree..................................................................................
FBpp0086749  rtr..................................................................................
FBpp0087646  ainwyvqneetdatpa.....................................................................
FBpp0071879  v....................................................................................
FBpp0080894  ygvvlkalnlnqaaeqmlvqairlvpmlwsaylelsplimekkkllslqlgghwmrhffmahtylelylnddglkiyedlqasgf
FBpp0305185  ygvvlkalnlnqaaeqmlvqairlvpmlwsaylelsplimekkkllslqlgghwmrhffmahtylelylnddglkiyedlqasgf
FBpp0112213  .....................................................................................
FBpp0087233  eir..................................................................................
FBpp0070906  y....................................................................................
FBpp0303990  y....................................................................................
FBpp0087646  iklgkhaeaipk.........................................................................
FBpp0082112  eyaa.................................................................................
FBpp0086359  f....................................................................................
FBpp0293627  f....................................................................................
FBpp0076526  ltssvdyaklkgly.......................................................................
FBpp0085279  el...................................................................................
FBpp0074835  .....................................................................................
FBpp0303989  gevn.................................................................................
FBpp0078887  y....................................................................................
FBpp0290580  t....................................................................................
FBpp0085047  qynsslkpid...........................................................................
FBpp0296980  v....................................................................................
FBpp0300832  v....................................................................................
FBpp0086380  hpstileythl..........................................................................
FBpp0083435  gingqave.............................................................................
FBpp0078891  whlata...............................................................................
FBpp0082419  asglptsassedlsqslseytdadesvsapteflaeflsa.............................................
FBpp0082420  asglptsassedlsqslseytdadesvsapteflaeflsa.............................................
FBpp0306145  asglptsassedlsqslseytdadesvsapteflaeflsa.............................................
FBpp0303989  yknshlwsglamrflkgyanprtiidvlrqaakacvvkrdfaranllicqavrrareyfgpthq.....................
FBpp0305372  g....................................................................................
FBpp0086749  eeeilrnaysvkhwlryidhkakapnngvnm......................................................
FBpp0078027  ieqg.................................................................................
FBpp0088148  hra..................................................................................
FBpp0088149  hra..................................................................................
FBpp0290863  m....................................................................................
FBpp0080720  q....................................................................................
FBpp0083319  v....................................................................................
FBpp0071288  qrmiiddmqekfprepglwdllaqrelrgfhlgdleeedldtsdeepaskksrsvngrslkrriqlcvtvyksaveelqttemwn
FBpp0081398  e....................................................................................
FBpp0301016  e....................................................................................
FBpp0085015  rwr..................................................................................
FBpp0084188  v....................................................................................
FBpp0293235  v....................................................................................
FBpp0290580  lr...................................................................................
FBpp0085012  syvnhdyyhtvlwmneamarmleept...........................................................
FBpp0086380  t....................................................................................
FBpp0304708  dhs..................................................................................
FBpp0305372  t....................................................................................
FBpp0304707  sm...................................................................................
FBpp0071879  n....................................................................................
FBpp0076961  pteqqr...............................................................................
FBpp0075717  lqqalmaanlavmrapdrnadpvldegl.........................................................
FBpp0080267  agnds................................................................................
FBpp0070907  n....................................................................................
FBpp0085033  lsv..................................................................................
FBpp0082507  qclqalftfmppskve.....................................................................
FBpp0077738  iwtnlakmcvhtnrldvakvcmghleqarsvralrqaiedddlete.......................................
FBpp0292775  iwtnlakmcvhtnrldvakvcmghleqarsvralrqaiedddlete.......................................
FBpp0085676  sdevlh...............................................................................
FBpp0087091  vefr.................................................................................
FBpp0082624  s....................................................................................
FBpp0070908  eqrrraaecyrqigntdmaietllqvpptlrsprinlmlarlqhhgsrhgttkk...............................
FBpp0070431  lnvwyvktldaafeaa.....................................................................
FBpp0075443  qahdm................................................................................
FBpp0305287  qahdm................................................................................
FBpp0305288  qahdm................................................................................
FBpp0070906  iid..................................................................................
FBpp0303990  iid..................................................................................
FBpp0073018  lr...................................................................................
FBpp0078634  ain..................................................................................
FBpp0087626  sknlreegnlmfkesasgsskdsvl............................................................
FBpp0075754  yfslvgll.............................................................................
FBpp0087625  sknlreegnlmfkesasgsskdsvl............................................................
FBpp0071288  rl...................................................................................
FBpp0085046  lam..................................................................................
FBpp0110159  lam..................................................................................
FBpp0072679  qraeisafy............................................................................
FBpp0306202  qraeisafy............................................................................
FBpp0082624  w....................................................................................
FBpp0084254  ma...................................................................................
FBpp0085032  t....................................................................................


                                                                                                    
                                                                                                    
d1kt1a1        .....................................................................................
FBpp0112456  tyvketksglsthkekmaqaydfalekigmdlhsfsiwqdyiyflrgveavgnyaenqkitavrrvyqkavvtpivgieqlwkdy
FBpp0297503  tyvketksglsthkekmaqaydfalekigmdlhsfsiwqdyiyflrgveavgnyaenqkitavrrvyqkavvtpivgieqlwkdy
FBpp0112455  tyvketksglsthkekmaqaydfalekigmdlhsfsiwqdyiyflrgveavgnyaenqkitavrrvyqkavvtpivgieqlwkdy
FBpp0297502  tyvketksglsthkekmaqaydfalekigmdlhsfsiwqdyiyflrgveavgnyaenqkitavrrvyqkavvtpivgieqlwkdy
FBpp0070352  .....................................................................................
FBpp0070351  .....................................................................................
FBpp0070402  .....................................................................................
FBpp0080138  aqenmqklerflcagifnykrlsarmeeiydldlkylidfsiisdgyisdmigdtmesshsgthavdksleavsfaldtihssll
FBpp0080139  aqenmqklerflcagifnykrlsarmeeiydldlkylidfsiisdgyisdmigdtmesshsgthavdksleavsfaldtihssll
FBpp0301685  .....................................................................................
FBpp0074609  .....................................................................................
FBpp0084171  qaikfyrmlydklmakcvassrcdsalkvvaqrlliclgdltryrvnhv....................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084693  vyrracrih............................................................................
FBpp0084691  vyrracrih............................................................................
FBpp0084692  vyrracrih............................................................................
FBpp0084694  vyrracrih............................................................................
FBpp0112211  vyrracrih............................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0305561  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0271718  .....................................................................................
FBpp0290895  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0293601  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0296963  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0305185  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0081607  .....................................................................................
FBpp0304082  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0303945  .....................................................................................
FBpp0303946  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0085344  srsqlfvgighqqlaiqsnlkserdachklaldaleravqfdgndhlaeyylslqyallgqlaealvhirfalalrmehapclhl
FBpp0081552  .....................................................................................
FBpp0297109  srsqlfvgighqqlaiqsnlkserdachklaldaleravqfdgndhlaeyylslqyallgqlaealvhirfalalrmehapclhl
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070573  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0305905  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0076114  .....................................................................................
FBpp0076115  .....................................................................................
FBpp0305988  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0293601  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0303945  .....................................................................................
FBpp0303946  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0085409  .....................................................................................
FBpp0271717  .....................................................................................
FBpp0271719  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0303439  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0300561  .....................................................................................
FBpp0077718  kqperallvigevvdsrpfdvtyrleqarihqameqqedal............................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0305561  .....................................................................................
FBpp0071712  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0305602  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0079666  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  .....................................................................................
FBpp0082819  .....................................................................................
FBpp0292061  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0081805  .....................................................................................
FBpp0100021  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0074877  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0290395  ilase................................................................................
FBpp0072146  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0297722  .....................................................................................
FBpp0087232  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0075786  .....................................................................................
FBpp0075788  .....................................................................................
FBpp0306229  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0075789  .....................................................................................
FBpp0301715  .....................................................................................
FBpp0301716  .....................................................................................
FBpp0306230  .....................................................................................
FBpp0075785  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076498  .....................................................................................
FBpp0293529  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0297722  .....................................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  deneaaafvemlqkhcvtwtcnveqrqmiksvvdkfkqhldettrgwdwseqhkahvydvetlsldddlknavirfifersvakf
FBpp0089396  deneaaafvemlqkhcvtwtcnveqrqmiksvvdkfkqhldettrgwdwseqhkahvydvetlsldddlknavirfifersvakf
FBpp0111789  deneaaafvemlqkhcvtwtcnveqrqmiksvvdkfkqhldettrgwdwseqhkahvydvetlsldddlknavirfifersvakf
FBpp0086683  .....................................................................................
FBpp0289328  dmlsamhgiqriekiydlkiddlaqgvlqgvqynvqltyr.............................................
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  sksi.................................................................................
FBpp0305185  sksi.................................................................................
FBpp0112213  .....................................................................................
FBpp0087233  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0303990  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0082112  .....................................................................................
FBpp0086359  .....................................................................................
FBpp0293627  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0303989  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085047  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0082420  .....................................................................................
FBpp0306145  .....................................................................................
FBpp0303989  .....................................................................................
FBpp0305372  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0071288  myldamlalnsdgkterilkqqcladalqaghrsqlmgvkhyatlrkmlctapsgreaavtiltealkndssvemhelllathiq
FBpp0081398  .....................................................................................
FBpp0301016  .....................................................................................
FBpp0085015  .....................................................................................
FBpp0084188  .....................................................................................
FBpp0293235  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0304708  .....................................................................................
FBpp0305372  .....................................................................................
FBpp0304707  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  .....................................................................................
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075443  .....................................................................................
FBpp0305287  .....................................................................................
FBpp0305288  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0303990  .....................................................................................
FBpp0073018  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0087626  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0085046  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0306202  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................


                                                                                                    
                                                                                                    
d1kt1a1        .....................................................................................
FBpp0112456  iafeqninpiisekmslerskdymnarrvakeleyhtkglnrnlpavpptltkeevkqvelwkrfityeksnplrtedtalvtrr
FBpp0297503  iafeqninpiisekmslerskdymnarrvakeleyhtkglnrnlpavpptltkeevkqvelwkrfityeksnplrtedtalvtrr
FBpp0112455  iafeqninpiisekmslerskdymnarrvakeleyhtkglnrnlpavpptltkeevkqvelwkrfityeksnplrtedtalvtrr
FBpp0297502  iafeqninpiisekmslerskdymnarrvakeleyhtkglnrnlpavpptltkeevkqvelwkrfityeksnplrtedtalvtrr
FBpp0070352  .....................................................................................
FBpp0070351  .....................................................................................
FBpp0070402  .....................................................................................
FBpp0080138  slgdlhryfldfridsklsiskeq.............................................................
FBpp0080139  slgdlhryfldfridsklsiskeq.............................................................
FBpp0301685  .....................................................................................
FBpp0074609  .....................................................................................
FBpp0084171  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0305561  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0271718  .....................................................................................
FBpp0290895  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0293601  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0296963  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0305185  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0081607  .....................................................................................
FBpp0304082  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0303945  .....................................................................................
FBpp0303946  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0085344  fallltssrrprealgvvedalhefpdnlqllhvkahlqlhledaetalgtvqhmlavwrdvyeaqlageeekhsdtksgvhlah
FBpp0081552  .....................................................................................
FBpp0297109  fallltssrrprealgvvedalhefpdnlqllhvkahlqlhledaetalgtvqhmlavwrdvyeaqlageeekhsdtksgvhlah
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070573  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0305905  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0076114  .....................................................................................
FBpp0076115  .....................................................................................
FBpp0305988  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0293601  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0303945  .....................................................................................
FBpp0303946  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0085409  .....................................................................................
FBpp0271717  .....................................................................................
FBpp0271719  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0303439  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0300561  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0305561  .....................................................................................
FBpp0071712  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0305602  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0079666  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  .....................................................................................
FBpp0082819  .....................................................................................
FBpp0292061  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0081805  .....................................................................................
FBpp0100021  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0074877  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0297722  .....................................................................................
FBpp0087232  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0075786  .....................................................................................
FBpp0075788  .....................................................................................
FBpp0306229  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0075789  .....................................................................................
FBpp0301715  .....................................................................................
FBpp0301716  .....................................................................................
FBpp0306230  .....................................................................................
FBpp0075785  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076498  .....................................................................................
FBpp0293529  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0297722  .....................................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  pivdvlwlsyiefiqfegvtvpenedenevtaemvakrakrlgkgflrnteldlanrgvrshpsvqlnhrfldlmersdfe....
FBpp0089396  pivdvlwlsyiefiqfegvtvpenedenevtaemvakrakrlgkgflrnteldlanrgvrshpsvqlnhrfldlmersdfe....
FBpp0111789  pivdvlwlsyiefiqfegvtvpenedenevtaemvakrakrlgkgflrnteldlanrgvrshpsvqlnhrfldlmersdfe....
FBpp0086683  .....................................................................................
FBpp0289328  .....................................................................................
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0305185  .....................................................................................
FBpp0112213  .....................................................................................
FBpp0087233  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0303990  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0082112  .....................................................................................
FBpp0086359  .....................................................................................
FBpp0293627  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0303989  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085047  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0082420  .....................................................................................
FBpp0306145  .....................................................................................
FBpp0303989  .....................................................................................
FBpp0305372  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0071288  sdsepliyelfnkiqksmgsealplwrsvilyyrtrqdslgarrldeiyglackaa.............................
FBpp0081398  .....................................................................................
FBpp0301016  .....................................................................................
FBpp0085015  .....................................................................................
FBpp0084188  .....................................................................................
FBpp0293235  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0304708  .....................................................................................
FBpp0305372  .....................................................................................
FBpp0304707  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  .....................................................................................
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075443  .....................................................................................
FBpp0305287  .....................................................................................
FBpp0305288  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0303990  .....................................................................................
FBpp0073018  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0087626  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0085046  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0306202  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................


                                                                                    10        20    
                                                                                     |         |    
d1kt1a1        .............................................................--SWEMDTKEKLEQAAIVKEKGTV
FBpp0112456  ................................vmfateqcllvlthhpavwhqasqfldts---------------------ARV
FBpp0297503  ................................vmfateqcllvlthhpavwhqasqfldts---------------------ARV
FBpp0112455  vmfateqcllvlthhpavwhqasqfldtsarvltekgvrtsvenispilcvpvvnqiewvm---------------------AFA
FBpp0297502  vmfateqcllvlthhpavwhqasqfldtsarvltekgvrtsvenispilcvpvvnqiewvm---------------------AFA
FBpp0070352  .............................................................--CFEVAAKKQPERAEVWQLLGTS
FBpp0070351  .............................................................--CFEVAAKKQPERAEVWQLLGTS
FBpp0070402  .............................................................----------NRMVVSHWIKYAQW
FBpp0080138  .............................................................------------------------
FBpp0080139  .............................................................------------------------
FBpp0301685  .............................................................------------------------
FBpp0074609  .............................................................------------------------
FBpp0084171  .............................................................------------------------
FBpp0085420  .............................................................-DTYRRAIELQPNFPDAYCNLANA
FBpp0085421  .............................................................-DTYRRAIELQPNFPDAYCNLANA
FBpp0085422  .............................................................-DTYRRAIELQPNFPDAYCNLANA
FBpp0085420  .............................................................----TLAIKQNPVLAEAYSNLGNV
FBpp0085421  .............................................................----TLAIKQNPVLAEAYSNLGNV
FBpp0085422  .............................................................----TLAIKQNPVLAEAYSNLGNV
FBpp0077790  .............................................................----------------KEKELGNA
FBpp0082545  .............................................................--LFKSALQVCPDNAKVHYNIARL
FBpp0084693  .............................................................----------HPDKPSLHLMWAAF
FBpp0084691  .............................................................----------HPDKPSLHLMWAAF
FBpp0084692  .............................................................----------HPDKPSLHLMWAAF
FBpp0084694  .............................................................----------HPDKPSLHLMWAAF
FBpp0112211  .............................................................----------HPDKPSLHLMWAAF
FBpp0072096  .............................................................-------------AADEYSKAATA
FBpp0071560  .............................................................---YRQAISMRSDYVQAYINRGDI
FBpp0071561  .............................................................---YRQAISMRSDYVQAYINRGDI
FBpp0077790  .............................................................--------------AEEEKEQGNL
FBpp0076600  .............................................................IKFFKRAVQVDPDFVYSYTLLGHE
FBpp0305561  .............................................................IKFFKRAVQVDPDFVYSYTLLGHE
FBpp0271716  .............................................................------------------------
FBpp0077790  .............................................................---------------NELKEKGNQ
FBpp0271718  .............................................................------------------------
FBpp0290895  .............................................................-----MTLGHRPTMADAHFNLGVV
FBpp0290896  .............................................................-----MTLGHRPTMADAHFNLGVV
FBpp0081673  .............................................................---------------------ANE
FBpp0293601  .............................................................-------------PPKALGNLGSV
FBpp0077614  .............................................................-------------PPKALGNLGSV
FBpp0084692  .............................................................------------------------
FBpp0084694  .............................................................------------------------
FBpp0112211  .............................................................------------------------
FBpp0084691  .............................................................------------------------
FBpp0084693  .............................................................------------------------
FBpp0296980  .............................................................----------------------NA
FBpp0300832  .............................................................----------------------NA
FBpp0080535  .............................................................--------------AESIKNEGNR
FBpp0296963  .............................................................--------------AESIKNEGNR
FBpp0296980  .............................................................----NQAMNDRSAEAATHGNLAVA
FBpp0300832  .............................................................----NQAMNDRSAEAATHGNLAVA
FBpp0072164  .............................................................-------------KANDIKDRGNT
FBpp0084016  .............................................................------------------------
FBpp0296980  .............................................................--------------AAALTSLGHV
FBpp0300832  .............................................................--------------AAALTSLGHV
FBpp0296980  .............................................................-------------RARALGHLGDC
FBpp0300832  .............................................................-------------RARALGHLGDC
FBpp0080894  .............................................................---------------ETCCVIGNY
FBpp0305185  .............................................................---------------ETCCVIGNY
FBpp0081606  .............................................................--------------AEQYKNQGNE
FBpp0081607  .............................................................--------------AEQYKNQGNE
FBpp0304082  .............................................................--------------AEQYKNQGNE
FBpp0084559  .............................................................---------------RACGNLGNT
FBpp0075683  .............................................................----------HPAVAATLNNLAVL
FBpp0303945  .............................................................----------HPAVAATLNNLAVL
FBpp0303946  .............................................................----------HPAVAATLNNLAVL
FBpp0081284  .............................................................-------------DAGSYKDKGNE
FBpp0079468  .............................................................-------------EAKVYKEKGTN
FBpp0087297  .............................................................---------------ESYVRLAEL
FBpp0074835  .............................................................----------------LWMMKGQI
FBpp0079893  .............................................................--DFAEAERLNPENPDVYHQRAQI
FBpp0079894  .............................................................--DFAEAERLNPENPDVYHQRAQI
FBpp0079895  .............................................................--DFAEAERLNPENPDVYHQRAQI
FBpp0082765  .............................................................---------ANKEKADKLKVEGNE
FBpp0079617  .............................................................-----------------LKEQGNC
FBpp0084440  .............................................................-------------FAERHRLRGNE
FBpp0305670  .............................................................--------------AEEKKKLGND
FBpp0080423  .............................................................--------------AEEKKKLGND
FBpp0305671  .............................................................--------------AEEKKKLGND
FBpp0080424  .............................................................---------------EEKKKLGND
FBpp0305672  .............................................................---------------EEKKKLGND
FBpp0085344  ...........ssqmsdkdsnsvyaaslaavsrveqalseaasslssftqrpgprrpwmlq--------------IEIWLLLADV
FBpp0081552  .............................................................-----------PADIENHLELGKE
FBpp0297109  .....................ssqmsdkdsisrveqalseaasslssftqrpgprrpwmlq--------------IEIWLLLADV
FBpp0087646  .............................................................----LKATRLRPHFAECFDYLGKL
FBpp0083769  .............................................................-----KLVDRYPDKAISWYAVGCY
FBpp0070572  .............................................................------ATEEEVEQASELRAQAAS
FBpp0070573  .............................................................------ATEEEVEQASELRAQAAS
FBpp0070575  .............................................................------ATEEEVEQASELRAQAAS
FBpp0305905  .............................................................------ATEEEVEQASELRAQAAS
FBpp0074835  .............................................................----------------TWIDDAEF
FBpp0305670  .............................................................------------------KENGNM
FBpp0080424  .............................................................------------------KENGNM
FBpp0305672  .............................................................------------------KENGNM
FBpp0080423  .............................................................------------------KENGNM
FBpp0305671  .............................................................------------------KENGNM
FBpp0076113  .............................................................---------------------GNH
FBpp0076114  .............................................................---------------------GNH
FBpp0076115  .............................................................---------------------GNH
FBpp0305988  .............................................................---------------------GNH
FBpp0072561  .............................................................--LYKEILKEHPNYIDCYLRLGCM
FBpp0072562  .............................................................--LYKEILKEHPNYIDCYLRLGCM
FBpp0072561  .............................................................---FNFVLNQSPSNIPSLLGKACI
FBpp0072562  .............................................................---FNFVLNQSPSNIPSLLGKACI
FBpp0085923  .............................................................-----------PTEIEVYKKEGND
FBpp0293601  .............................................................-----------------YQRIGDV
FBpp0079893  .............................................................--------------ANNYKTEGNN
FBpp0079894  .............................................................--------------ANNYKTEGNN
FBpp0079895  .............................................................--------------ANNYKTEGNN
FBpp0075683  .............................................................----------------TLHNLVIQ
FBpp0303945  .............................................................----------------TLHNLVIQ
FBpp0303946  .............................................................----------------TLHNLVIQ
FBpp0077614  .............................................................-----------------YQRIGDV
FBpp0085409  .............................................................------------------------
FBpp0271717  .............................................................------------------------
FBpp0271719  .............................................................------------------------
FBpp0086749  .............................................................------------------------
FBpp0073411  .............................................................---------------STLRERGNN
FBpp0070907  .............................................................-------------------ALGKC
FBpp0303439  .............................................................---------------STLRERGNN
FBpp0070908  .............................................................-------------------ALGKC
FBpp0085842  .............................................................------------------KERANF
FBpp0300561  .............................................................-------------NIKLLCDQSNN
FBpp0077718  .............................................................-QLYRLAAKLHPINVESLASIAVG
FBpp0296980  .............................................................----------------ALGNIGDI
FBpp0300832  .............................................................----------------ALGNIGDI
FBpp0076600  .............................................................---------------ETIFLLATS
FBpp0305561  .............................................................---------------ETIFLLATS
FBpp0071712  .............................................................--------------------LGLK
FBpp0086749  .............................................................---------------HLWNSLADY
FBpp0085479  .............................................................---------------LNYKEDGNF
FBpp0112016  .............................................................--------------------LGLK
FBpp0292906  .............................................................------------------------
FBpp0305602  .............................................................------------------------
FBpp0079665  .............................................................------------------------
FBpp0079666  .............................................................------------------------
FBpp0079664  .............................................................------------------------
FBpp0084076  .............................................................---------------ELQRSQGNE
FBpp0111406  .............................................................--------------AQNFRKLGNA
FBpp0074918  .............................................................--------------------WGNH
FBpp0082818  .............................................................--------------LRVMKFKAMR
FBpp0074480  .............................................................------------EHGETLAMKGLT
FBpp0082819  .............................................................---------EFPGSLRVMKFKAMR
FBpp0292061  .............................................................---------------------GIE
FBpp0085279  .............................................................--------------NQLKLNMGNI
FBpp0081805  .............................................................---------------------GIE
FBpp0100021  .............................................................-----------------C------
FBpp0100023  .............................................................-----------------C------
FBpp0074877  .............................................................-----------------C------
FBpp0071879  .............................................................---YKSITKEYSSYHDCYLRLGVM
FBpp0084559  .............................................................---------------AIYSQLGNA
FBpp0075591  .............................................................-----------------LELKAIA
FBpp0076526  .............................................................----------------SCNQLGDF
FBpp0079851  .............................................................---------------------GSV
FBpp0290395  .............................................................--RFEGALQLQPMNFEARYNLGLV
FBpp0072146  .............................................................-------------------LHGKD
FBpp0296980  .............................................................--------------ARALSNLGSV
FBpp0300832  .............................................................--------------ARALSNLGSV
FBpp0083238  .............................................................------------------------
FBpp0111383  .............................................................-----------EDVAETFRRMGNY
FBpp0080424  .............................................................------------------------
FBpp0305672  .............................................................------------------------
FBpp0305670  .............................................................------------------------
FBpp0071560  .............................................................------------------------
FBpp0071561  .............................................................------------------------
FBpp0080423  .............................................................------------------------
FBpp0305671  .............................................................------------------------
FBpp0071879  .............................................................-----------PKNILALIGRACL
FBpp0077738  .............................................................------AIARQSGDRAACYHLARH
FBpp0077934  .............................................................-----------------LVDKGLI
FBpp0292775  .............................................................------AIARQSGDRAACYHLARH
FBpp0087646  .............................................................------------------------
FBpp0292906  .............................................................------------HYVNALCKLGHL
FBpp0079664  .............................................................------------HYVNALCKLGHL
FBpp0086749  .............................................................------------------------
FBpp0082652  .............................................................----------------SFRRLGNE
FBpp0077619  .............................................................---------------------GNV
FBpp0086164  .............................................................--------------VELYMDITEA
FBpp0297722  .............................................................--------------VELYMDITEA
FBpp0087232  .............................................................-----------------IKERATS
FBpp0072561  .............................................................------------------------
FBpp0072562  .............................................................------------------------
FBpp0088148  .............................................................----------------------QA
FBpp0088149  .............................................................----------------------QA
FBpp0075786  .............................................................-------------------EDGNV
FBpp0075788  .............................................................-------------------EDGNV
FBpp0306229  .............................................................-------------------EDGNV
FBpp0075787  .............................................................-------------------EDGNV
FBpp0075789  .............................................................-------------------EDGNV
FBpp0301715  .............................................................-------------------EDGNV
FBpp0301716  .............................................................-------------------EDGNV
FBpp0306230  .............................................................-------------------EDGNV
FBpp0075785  .............................................................-------------------EDGNV
FBpp0083319  .............................................................------------------------
FBpp0076498  .............................................................-------------------EKASS
FBpp0293529  .............................................................-------------------EKASS
FBpp0290580  .............................................................--------------------LGHC
FBpp0290395  .............................................................-----------------FFNLAEQ
FBpp0080720  .............................................................---------------------GQL
FBpp0086164  .............................................................-------------------GEANL
FBpp0297722  .............................................................-------------------GEANL
FBpp0080741  .............................................................----------------TFLERAYF
FBpp0087297  .............................................................-----------------------I
FBpp0070720  .............................................................------------------------
FBpp0089396  .............................................................------------------------
FBpp0111789  .............................................................------------------------
FBpp0086683  .............................................................--------------AHTLFQAGKL
FBpp0289328  .............................................................----------------DLIAMGNS
FBpp0070667  .............................................................-----------PASWKFHTLSSYY
FBpp0082624  .............................................................--------------------LASM
FBpp0081552  .............................................................------------------------
FBpp0086749  .............................................................------------------------
FBpp0087646  .............................................................----------------SLSFQGFL
FBpp0071879  .............................................................---------------------AQM
FBpp0080894  .............................................................---------------YLIAQMALV
FBpp0305185  .............................................................---------------YLIAQMALV
FBpp0112213  .............................................................------------------------
FBpp0087233  .............................................................------------------------
FBpp0070906  .............................................................------------------------
FBpp0303990  .............................................................------------------------
FBpp0087646  .............................................................---CQRLLKSEPENAMGYLLLGAA
FBpp0082112  .............................................................-------------------LKAQQ
FBpp0086359  .............................................................------------------------
FBpp0293627  .............................................................------------------------
FBpp0076526  .............................................................------------------EKLGDG
FBpp0085279  .............................................................-------------------NKALV
FBpp0074835  .............................................................------------------------
FBpp0303989  .............................................................-----------VQTAKHYGNLGRL
FBpp0078887  .............................................................------------------------
FBpp0290580  .............................................................--------------ADTLNDEGCL
FBpp0085047  .............................................................------------------------
FBpp0296980  .............................................................---------------------GQE
FBpp0300832  .............................................................---------------------GQE
FBpp0086380  .............................................................------------------------
FBpp0083435  .............................................................------------------------
FBpp0078891  .............................................................----------------------IV
FBpp0082419  .............................................................------------------------
FBpp0082420  .............................................................------------------------
FBpp0306145  .............................................................------------------------
FBpp0303989  .............................................................------------KYGDALLDYGFF
FBpp0305372  .............................................................------------------------
FBpp0086749  .............................................................------------------------
FBpp0078027  .............................................................----------------IYKDWGTY
FBpp0088148  .............................................................------------------------
FBpp0088149  .............................................................------------------------
FBpp0290863  .............................................................------------------------
FBpp0080720  .............................................................------------------------
FBpp0083319  .............................................................-------------------QLAYV
FBpp0071288  .............................................................------------------------
FBpp0081398  .............................................................-----------------LFSQGSR
FBpp0301016  .............................................................-----------------LFSQGSR
FBpp0085015  .............................................................----------------ECYEIGVQ
FBpp0084188  .............................................................------------------------
FBpp0293235  .............................................................------------------------
FBpp0290580  .............................................................------------------------
FBpp0085012  .............................................................------------------------
FBpp0086380  .............................................................-------------DAYNFYTTGQA
FBpp0304708  .............................................................------------------------
FBpp0305372  .............................................................-------------DAYNFYTTGQA
FBpp0304707  .............................................................------------------------
FBpp0071879  .............................................................------------------------
FBpp0076961  .............................................................------------------------
FBpp0075717  .............................................................------------------------
FBpp0080267  .............................................................------------------------
FBpp0070907  .............................................................------------------------
FBpp0085033  .............................................................------------------------
FBpp0082507  .............................................................--------------ARTHLQMGQI
FBpp0077738  .............................................................------------------AKVAVL
FBpp0292775  .............................................................------------------AKVAVL
FBpp0085676  .............................................................---------------DIYRDWGTY
FBpp0087091  .............................................................-------------------MLGNE
FBpp0082624  .............................................................--------------------MASA
FBpp0070908  .............................................................------------------------
FBpp0070431  .............................................................------------------------
FBpp0075443  .............................................................------------------------
FBpp0305287  .............................................................------------------------
FBpp0305288  .............................................................------------------------
FBpp0070906  .............................................................----------------VLRQAAKA
FBpp0303990  .............................................................----------------VLRQAAKA
FBpp0073018  .............................................................------------------------
FBpp0078634  .............................................................-------------------ELSIV
FBpp0087626  .............................................................------------------------
FBpp0075754  .............................................................------------------------
FBpp0087625  .............................................................------------------------
FBpp0071288  .............................................................------------------------
FBpp0085046  .............................................................------------------------
FBpp0110159  .............................................................------------------------
FBpp0072679  .............................................................------------------------
FBpp0306202  .............................................................------------------------
FBpp0082624  .............................................................------------------------
FBpp0084254  .............................................................---------------MSMYEVARV
FBpp0085032  .............................................................------------------YAMGQI


                     30          40        50                                                       
                      |           |         |                                                       
d1kt1a1        Y.FK.GGK..YVQAVIQYGKIVSWLEMEYGLS.....................................................
FBpp0112456  L.TE.KGD..VQAAKIFADECANILERSIN--.....................................................
FBpp0297503  L.TE.KGD..VQAAKIFADECANILERSIN--.....................................................
FBpp0112455  W.WW.AKD..VQAAKIFADECANILERSIN--.....................................................
FBpp0297502  W.WW.AKD..VQAAKIFADECANILERSIN--.....................................................
FBpp0070352  Q.TE.NEM..DPQAIAALKRAYDLQPDNQQVLmalaacytneglqnnavrmlcnwltvhpkyqhlvaahpelqaegtslasslig
FBpp0070351  Q.TE.NEM..DPQAIAALKRAYDLQPDNQQVLmalaacytneglqnnavrmlcnwltvhpkyqhlvaahpelqaegtslasslig
FBpp0070402  E.EQ.QQE..IQRARSIWERAL----------.....................................................
FBpp0080138  -.--.---..----------------------.....................................................
FBpp0080139  -.--.---..----------------------.....................................................
FBpp0301685  -.--.---..----------------------.....................................................
FBpp0074609  -.--.-NK..VEDAIECYQRAGNMFKMSKNWTkagecfceaatlharagsrhdagtcyvdasncykkvdvesavnclmksidiyt
FBpp0084171  -.--.---..----------------------.....................................................
FBpp0085420  L.KE.KGQ..VKEAEDCYNTALRLCSNHADSLnnlanikreqgyieeatrl..................................
FBpp0085421  L.KE.KGQ..VKEAEDCYNTALRLCSNHADSLnnlanikreqgyieeatrl..................................
FBpp0085422  L.KE.KGQ..VKEAEDCYNTALRLCSNHADSLnnlanikreqgyieeatrl..................................
FBpp0085420  F.KE.RGQ..LQEALDNYRRAVRLKPDFIDGYinlaaalvaardmesavqayitalqynpdlycvrsdlgnllkalgrleeakac
FBpp0085421  F.KE.RGQ..LQEALDNYRRAVRLKPDFIDGYinlaaalvaardmesavqayitalqynpdlycvrsdlgnllkalgrleeakac
FBpp0085422  F.KE.RGQ..LQEALDNYRRAVRLKPDFIDGYinlaaalvaardmesavqayitalqynpdlycvrsdlgnllkalgrleeakac
FBpp0077790  A.YK.KKD..FETALKHYHAAI----------.....................................................
FBpp0082545  A.TD.MGN..NTKAFQHYHRAI----------.....................................................
FBpp0084693  E.EC.QMN..FDDAAEILQRID----------.....................................................
FBpp0084691  E.EC.QMN..FDDAAEILQRID----------.....................................................
FBpp0084692  E.EC.QMN..FDDAAEILQRID----------.....................................................
FBpp0084694  E.EC.QMN..FDDAAEILQRID----------.....................................................
FBpp0112211  E.EC.QMN..FDDAAEILQRID----------.....................................................
FBpp0072096  Y.RI.AKS..YDKSKECFLKAIDAYKNNKSWFhaakayeqiillskdadklhe................................
FBpp0071560  L.MK.LNR..TAQAQEVYEQAL----------.....................................................
FBpp0071561  L.MK.LNR..TAQAQEVYEQAL----------.....................................................
FBpp0077790  F.FK.KGD..YSTAVKHYTEAI----------.....................................................
FBpp0076600  L.VL.TEE..FDKAMDYFRAAV----------.....................................................
FBpp0305561  L.VL.TEE..FDKAMDYFRAAV----------.....................................................
FBpp0271716  -.--.---..----------------------.....................................................
FBpp0077790  A.LS.AEK..FDEAVAAYTEAI----------.....................................................
FBpp0271718  -.--.---..----------------------.....................................................
FBpp0290895  H.QK.QLN..FSSAIPCFRRAIELRPQLAVAYlnlgtslislgdhrqeaisvlrtgarlegsgvrdrgahvearytcylqlsvly
FBpp0290896  H.QK.QLN..FSSAIPCFRRAIELRPQLAVAYlnlgtslislgdhrqeaisvlrtgarlegsgvrdrgahvearytcylqlsvly
FBpp0081673  Y.AK.AGM..YFKAATAYRIAK----------.....................................................
FBpp0293601  L.SS.QGR..YEEAKQVLQEAI----------.....................................................
FBpp0077614  L.SS.QGR..YEEAKQVLQEAI----------.....................................................
FBpp0084692  -.--.---..----------------------.....................................................
FBpp0084694  -.--.---..----------------------.....................................................
FBpp0112211  -.--.---..----------------------.....................................................
FBpp0084691  -.--.---..----------------------.....................................................
FBpp0084693  -.--.---..----------------------.....................................................
FBpp0296980  A.CQ.SGD..FATAVLLYTDAL----------.....................................................
FBpp0300832  A.CQ.SGD..FATAVLLYTDAL----------.....................................................
FBpp0080535  L.MK.ENK..YNEALLQYNRAI----------.....................................................
FBpp0296963  L.MK.ENK..YNEALLQYNRAI----------.....................................................
FBpp0296980  Y.QA.LGA..HDAALTHYRAHLATARSL----.....................................................
FBpp0300832  Y.QA.LGA..HDAALTHYRAHLATARSL----.....................................................
FBpp0072164  Y.VK.QGE..YEKAIVAYSTAI----------.....................................................
FBpp0084016  -.--.---..----------------------.....................................................
FBpp0296980  Y.TA.SGD..YPNALASHKQCVQLFKQL----.....................................................
FBpp0300832  Y.TA.SGD..YPNALASHKQCVQLFKQL----.....................................................
FBpp0296980  Y.AA.LGD..YEEALKCHDRQLQLALGLTSHRdqerayrglgqarralgqlpaalvclekrlv......................
FBpp0300832  Y.AA.LGD..YEEALKCHDRQLQLALGLTSHRdqerayrglgqarralgqlpaalvclekrlv......................
FBpp0080894  Y.SI.RCD..HQVAISYFQRAL----------.....................................................
FBpp0305185  Y.SI.RCD..HQVAISYFQRAL----------.....................................................
FBpp0081606  M.LK.TKE..FSKAIDMYTKAI----------.....................................................
FBpp0081607  M.LK.TKE..FSKAIDMYTKAI----------.....................................................
FBpp0304082  M.LK.TKE..FSKAIDMYTKAI----------.....................................................
FBpp0084559  Y.YL.LGD..FQAAIEHHQERLRIAREF----.....................................................
FBpp0075683  Y.GK.RGK..YKDAEPLCKRALEIREKVLG--.....................................................
FBpp0303945  Y.GK.RGK..YKDAEPLCKRALEIREKVLG--.....................................................
FBpp0303946  Y.GK.RGK..YKDAEPLCKRALEIREKVLG--.....................................................
FBpp0081284  A.FK.ASR..WEEAVEHYGKAI----------.....................................................
FBpp0079468  Y.FK.KEN..WALAIKMYTKCKNILPTTVHTN.....................................................
FBpp0087297  Y.RK.DKQ..YQKAIEILENCLHLTPENSEVLieisvlylkinetqkahdrlaevvsierkcspkgllafgailqsrndidgals
FBpp0074835  E.EQ.QRR..TDDAAATYTLGLKKCPTSIPLWilsanleerkgvltkarsilergrlrnpkvavlwleairvelraglkeiastm
FBpp0079893  L.LL.LEQ..IEPALAEFEKAVSIAPNHAIAFvqkcyaeyrlsllagdqrrlesvmht...........................
FBpp0079894  L.LL.LEQ..IEPALAEFEKAVSIAPNHAIAFvqkcyaeyrlsllagdqrrlesvmht...........................
FBpp0079895  L.LL.LEQ..IEPALAEFEKAVSIAPNHAIAFvqkcyaeyrlsllagdqrrlesvmht...........................
FBpp0082765  L.FK.NDD..AEGAAKTYTEALDICPS-----.....................................................
FBpp0079617  L.FA.ARK..YDDAINCYSKAI----------.....................................................
FBpp0084440  S.FK.AKE..YENAIEEYNCSI----------.....................................................
FBpp0305670  Q.YK.AQN..YQNALKLYTDAI----------.....................................................
FBpp0080423  Q.YK.AQN..YQNALKLYTDAI----------.....................................................
FBpp0305671  Q.YK.AQN..YQNALKLYTDAI----------.....................................................
FBpp0080424  Q.YK.AQN..YQNALKLYTDAI----------.....................................................
FBpp0305672  Q.YK.AQN..YQNALKLYTDAI----------.....................................................
FBpp0085344  Y.LR.IDQ..PNEALNCIHEAS----------.....................................................
FBpp0081552  F.LA.RGQ..LSDALTHYHAAV----------.....................................................
FBpp0297109  Y.LR.IDQ..PNEALNCIHEAS----------.....................................................
FBpp0087646  YpLA.TGD..FSRARKCYEKCISLNPLAEEAVdalsfiyqeqgeeelnetll.................................
FBpp0083769  Y.DM.IGK..SDPARRYLSKAT----------.....................................................
FBpp0070572  A.YG.QQK..FDEAIALYTKAI----------.....................................................
FBpp0070573  A.YG.QQK..FDEAIALYTKAI----------.....................................................
FBpp0070575  A.YG.QQK..FDEAIALYTKAI----------.....................................................
FBpp0305905  A.YG.QQK..FDEAIALYTKAI----------.....................................................
FBpp0074835  C.AK.ENA..FECARAVYAHALQIFPSKKSIWlraayfeknhgtresleal..................................
FBpp0305670  L.FK.SGR..YREAHVIYTDALKIDE------.....................................................
FBpp0080424  L.FK.SGR..YREAHVIYTDALKIDE------.....................................................
FBpp0305672  L.FK.SGR..YREAHVIYTDALKIDE------.....................................................
FBpp0080423  L.FK.SGR..YREAHVIYTDALKIDE------.....................................................
FBpp0305671  L.FK.SGR..YREAHVIYTDALKIDE------.....................................................
FBpp0076113  F.YQ.LGR..YHEARAKYRKANRYYHYLSRQFgwqqlnplkkhlv........................................
FBpp0076114  F.YQ.LGR..YHEARAKYRKANRYYHYLSRQFgwqqlnplkkhlv........................................
FBpp0076115  F.YQ.LGR..YHEARAKYRKANRYYHYLSRQFgwqqlnplkkhlv........................................
FBpp0305988  F.YQ.LGR..YHEARAKYRKANRYYHYLSRQFgwqqlnplkkhlv........................................
FBpp0072561  A.RD.KGL..IFVASDFFKDALNINNDNPDARsllgnlhlakmqfalgqknfetilknpststdayslialgnfslqtlhqpsrd
FBpp0072562  A.RD.KGL..IFVASDFFKDALNINNDNPDARsllgnlhlakmqfalgqknfetilknpststdayslialgnfslqtlhqpsrd
FBpp0072561  A.FN.RKD..YRGAMAFYKKAL----------.....................................................
FBpp0072562  A.FN.RKD..YRGAMAFYKKAL----------.....................................................
FBpp0085923  F.LE.NGK..LVDAIDAYSAAL----------.....................................................
FBpp0293601  L.GR.LQQ..WDEAERHHRAALELQPNQVAAHlsygitlarnssraseaemw.................................
FBpp0079893  C.YR.NGK..YDEAIKFYDKAIDKCPK-----.....................................................
FBpp0079894  C.YR.NGK..YDEAIKFYDKAIDKCPK-----.....................................................
FBpp0079895  C.YR.NGK..YDEAIKFYDKAIDKCPK-----.....................................................
FBpp0075683  Y.AS.QGR..YEVAVPLCKQALEDLERTSG--.....................................................
FBpp0303945  Y.AS.QGR..YEVAVPLCKQALEDLERTSG--.....................................................
FBpp0303946  Y.AS.QGR..YEVAVPLCKQALEDLERTSG--.....................................................
FBpp0077614  L.GR.LQQ..WDEAERHHRAALELQPNQVAAHlsygitlarnssraseaemw.................................
FBpp0085409  -.--.---..----------------------.....................................................
FBpp0271717  -.--.---..----------------------.....................................................
FBpp0271719  -.--.---..----------------------.....................................................
FBpp0086749  -.--.---..FKTCKAVYERII----------.....................................................
FBpp0073411  F.YK.ASR..FTEAETCYREAVGIVEQLMLKEkph..................................................
FBpp0070907  L.YY.NGD..YFQAEDIFSSTLCANPDNVEAIglmavlcgqeggceqdsadmdyl..............................
FBpp0303439  F.YK.ASR..FTEAETCYREAVGIVEQLMLKEkph..................................................
FBpp0070908  L.YY.NGD..YFQAEDIFSSTLCANPDNVEAIglmavlcgqeggceqdsadmdyl..............................
FBpp0085842  F.YK.RSE..FTTAIHLYRRALDFLDNRDGDPdsefdkedlels.........................................
FBpp0300561  H.MK.VRA..YEKALFGYNQAL----------.....................................................
FBpp0077718  Y.FY.DNN..PEMALMYYRRIL----------.....................................................
FBpp0296980  L.IR.TGS..HEEAIKLYQRQLALARAA----.....................................................
FBpp0300832  L.IR.TGS..HEEAIKLYQRQLALARAA----.....................................................
FBpp0076600  Y.FR.SNQ..VHQAYWLLK-------------.....................................................
FBpp0305561  Y.FR.SNQ..VHQAYWLLK-------------.....................................................
FBpp0071712  E.IK.NAN..PENAIHFFCKAL----------.....................................................
FBpp0086749  Y.VR.SGL..FDRARDIYEEAIQTVTTVRDFTqvfdeyaqfeelslnrrmeqvaaneaateeddidvelrlsrfeylmerrllll
FBpp0085479  Y.MK.HKK..FRMAIYSFTEGIKTKT------.....................................................
FBpp0112016  E.IK.NAN..PENAIHFFCKAL----------.....................................................
FBpp0292906  -.--.-ER..EANALNFLQKSI----------.....................................................
FBpp0305602  -.--.---..---ALNFLQKSI----------.....................................................
FBpp0079665  -.--.---..---ALNFLQKSI----------.....................................................
FBpp0079666  -.--.---..---ALNFLQKSI----------.....................................................
FBpp0079664  -.--.---..---ALNFLQKSI----------.....................................................
FBpp0084076  A.FR.SQK..YEKAILHYDKAI----------.....................................................
FBpp0111406  E.YR.KGN..YEAAMKVYTEAI----------.....................................................
FBpp0074918  F.YR.SAD..YAQAMDHFEISL----------.....................................................
FBpp0082818  Y.EA.LEQ..YDEADEVLDAIIAKDETNAAPRkrkiailkargrrleaike..................................
FBpp0074480  L.NG.LGR..REEAYKYVRLGL----------.....................................................
FBpp0082819  Y.EA.LEQ..YDEADEVLDAIIAKDETNAAPRkrkiailkargrrleaike..................................
FBpp0292061  H.FK.NGQ..QVEAFQCLNKAL----------.....................................................
FBpp0085279  Y.YS.MGI..YQKAVKMYRMALDSVPKSLSQLrlkirenigilfirmgsysdaassfefimteranirssihlllcyfalgdvek
FBpp0081805  H.FK.NGQ..QVEAFQCLNKAL----------.....................................................
FBpp0100021  -.--.---..----------------------.....................................................
FBpp0100023  -.--.---..----------------------.....................................................
FBpp0074877  -.--.---..----------------------.....................................................
FBpp0071879  A.IQ.KNN..HTQAIEHLKDILVEDNLNMTARtymgdcfkglsldkfatfnynmilarqskftntyv..................
FBpp0084559  Y.FY.LGD..YNKAMQYHKHDLTLAKSM----.....................................................
FBpp0075591  L.SE.SGE..LDGALELFQQSL----------.....................................................
FBpp0076526  Y.NQ.QGK..YTDAVREYVQEAQIYASMGKELetakakrmvgemytllcdydaakdhindylkiakrlknqveeqrayatlgrvh
FBpp0079851  E.YS.RGR..CDEALKYFQELLSVVDP-----.....................................................
FBpp0290395  A.LA.QND..YELAEERFELLKEQLMLPSSVQhshvfyqlaklqerrlesglisnftpgaalqayl...................
FBpp0072146  S.VK.LGR..YQSAATAFERAVSSLNYCRMAN.....................................................
FBpp0296980  H.ES.LGQ..QAEALKCYERQL----------.....................................................
FBpp0300832  H.ES.LGQ..QAEALKCYERQL----------.....................................................
FBpp0083238  -.--.-GN..NRKALQESEKLL----------.....................................................
FBpp0111383  E.YR.KLN..FSLAKDYYSKGI----------.....................................................
FBpp0080424  -.--.-KS..YRNVVFYLDSAL----------.....................................................
FBpp0305672  -.--.-KS..YRNVVFYLDSAL----------.....................................................
FBpp0305670  -.--.-KS..YRNVVFYLDSAL----------.....................................................
FBpp0071560  -.--.---..--LAILLLTHALKTHQRNLDWRteysl................................................
FBpp0071561  -.--.---..--LAILLLTHALKTHQRNLDWRteysl................................................
FBpp0080423  -.--.-KS..YRNVVFYLDSAL----------.....................................................
FBpp0305671  -.--.-KS..YRNVVFYLDSAL----------.....................................................
FBpp0071879  A.YN.RQD..YIGALGYFKSVL----------.....................................................
FBpp0077738  Y.EN.VGK..FQEAIMFFTRAQTFSNAIRICKendfqeelwtvasssrqrdkaiaaayfeecgnfkhavelyhragmlhkalema
FBpp0077934  A.VA.KND..FPEAYVIFQKAL----------.....................................................
FBpp0292775  Y.EN.VGK..FQEAIMFFTRAQTFSNAIRICKendfqeelwtvasssrqrdkaiaaayfeecgnfkhavelyhragmlhkalema
FBpp0087646  -.--.-GH..LETATKACKMAI----------.....................................................
FBpp0292906  H.LL.LGE..YSEALSAYQKYLRFRE------.....................................................
FBpp0079664  H.LL.LGE..YSEALSAYQKYLRFRE------.....................................................
FBpp0086749  -.--.---..YEEVNSAFERAL----------.....................................................
FBpp0082652  E.YR.RTN..YEKAVYFYSKAI----------.....................................................
FBpp0077619  E.FQ.RGN..LEEAALYYESALTLPPPEV---.....................................................
FBpp0086164  L.MQ.EHK..YAEAIALMSPIT----------.....................................................
FBpp0297722  L.MQ.EHK..YAEAIALMSPIT----------.....................................................
FBpp0087232  A.FK.AKK..WLEAMMLYTRSYVALPS-----.....................................................
FBpp0072561  -.--.---..----------------------.....................................................
FBpp0072562  -.--.---..----------------------.....................................................
FBpp0088148  H.MD.WGK..FREAIEFSHQQLGISEEL----.....................................................
FBpp0088149  H.MD.WGK..FREAIEFSHQQLGISEEL----.....................................................
FBpp0075786  L.YR.KNR..FQEAAHRYQYALRKISGLEQLL.....................................................
FBpp0075788  L.YR.KNR..FQEAAHRYQYALRKISGLEQLL.....................................................
FBpp0306229  L.YR.KNR..FQEAAHRYQYALRKISGLEQLL.....................................................
FBpp0075787  L.YR.KNR..FQEAAHRYQYALRKISGLEQLL.....................................................
FBpp0075789  L.YR.KNR..FQEAAHRYQYALRKISGLEQLL.....................................................
FBpp0301715  L.YR.KNR..FQEAAHRYQYALRKISGLEQLL.....................................................
FBpp0301716  L.YR.KNR..FQEAAHRYQYALRKISGLEQLL.....................................................
FBpp0306230  L.YR.KNR..FQEAAHRYQYALRKISGLEQLL.....................................................
FBpp0075785  L.YR.KNR..FQEAAHRYQYALRKISGLEQLL.....................................................
FBpp0083319  -.-N.NQE..FDKAVKAVNRIL----------.....................................................
FBpp0076498  C.MH.LNL..LDDALKFCNASL----------.....................................................
FBpp0293529  C.MH.LNL..LDDALKFCNASL----------.....................................................
FBpp0290580  Y.YH.AQK..YEEAATCYEQLC----------.....................................................
FBpp0290395  Y.ER.SEM..HIEALNTYSIMAKN--------.....................................................
FBpp0080720  L.MK.QGK..YLEAKNLFKEAFDTLINVYG--.....................................................
FBpp0086164  S.FV.YGR..YETAERICMEIIRQNPLASEPFytlaeiyenrdevkflnf...................................
FBpp0297722  S.FV.YGR..YETAERICMEIIRQNPLASEPFytlaeiyenrdevkflnf...................................
FBpp0080741  L.ME.IGN..FNSAQQCLEQIKTQILACTEY-.....................................................
FBpp0087297  D.--.---..----------------------.....................................................
FBpp0070720  -.--.---..--L-------------------.....................................................
FBpp0089396  -.--.---..--L-------------------.....................................................
FBpp0111789  -.--.---..--L-------------------.....................................................
FBpp0086683  W.MR.RMR..YHDAQRAFEKAITRLKTCKTSS.....................................................
FBpp0289328  M.YQ.QSD..YQTAAKWYRIACKRELENPEQL.....................................................
FBpp0070667  W.RM.RGN..AREALPCARLAA----------.....................................................
FBpp0082624  H.YM.RAH..YQEAIDVYKRVL----------.....................................................
FBpp0081552  -.--.-KH..FAECIAAGEAVLRNEP------.....................................................
FBpp0086749  -.--.---..----------------------.....................................................
FBpp0087646  Y.AR.KNL..YRQAIEAFTRACKLC-------.....................................................
FBpp0071879  Y.LH.EGE..LNRSKAFLESFL----------.....................................................
FBpp0080894  Y.HN.KRD..VDKAIELYQALL----------.....................................................
FBpp0305185  Y.HN.KRD..VDKAIELYQALL----------.....................................................
FBpp0112213  -.--.---..----------------------.....................................................
FBpp0087233  -.--.---..----------------------.....................................................
FBpp0070906  -.-S.TGD..FSCAQDHVDKAVNIMQHLVPSNhlmlasakrvkallleeialdkmadgideedlllqseelhnfallls......
FBpp0303990  -.-S.TGD..FSCAQDHVDKAVNIMQHLVPSNhlmlasakrvkallleeialdkmadgideedlllqseelhnfallls......
FBpp0087646  Y.QN.IDK..A-EAAKNLRQCIKCTDGPAPAAllglancapsnelpeiydqladlqpeqslnyweklfnlasdsnvapfcftvlk
FBpp0082112  Y.YI.MKD..FQMAAKQLMRINNECTQAGT--.....................................................
FBpp0086359  -.--.LGH..HRQATTIHELLI----------.....................................................
FBpp0293627  -.--.LGH..HRQATTIHELLI----------.....................................................
FBpp0076526  C.CH.LMN..YEKALTYYQKMLENAELNQ---.....................................................
FBpp0085279  Y.LR.QND..VHQAIETLQMYD----------.....................................................
FBpp0074835  -.--.---..----------------------.....................................................
FBpp0303989  Y.QT.MNR..FEEAERMHKKAIKIKSELLG--.....................................................
FBpp0078887  -.--.---..--------TEAE----------.....................................................
FBpp0290580  L.FQ.ADQ..HEAAVQRFQAAL----------.....................................................
FBpp0085047  -.--.---..----------------------.....................................................
FBpp0296980  L.LQ.ATQ..YSAAVTVLEAALRIGS------.....................................................
FBpp0300832  L.LQ.ATQ..YSAAVTVLEAALRIGS------.....................................................
FBpp0086380  -.--.-SL..YSFANGHVGMSLKLLYRARYLM.....................................................
FBpp0083435  -.--.---..----------------------.....................................................
FBpp0078891  Y.CH.DGQ..FENALKILHGSTNLESMALSVQcllrlqrvdlakql.......................................
FBpp0082419  -.--.---..----------------------.....................................................
FBpp0082420  -.--.---..----------------------.....................................................
FBpp0306145  -.--.---..----------------------.....................................................
FBpp0303989  L.LN.VDS..VFQSVNIYKEALAVRRGIFG--.....................................................
FBpp0305372  -.--.---..----------------------.....................................................
FBpp0086749  -.--.---..----------------------.....................................................
FBpp0078027  Y.SR.RRR..ENLGMYYFDKAL----------.....................................................
FBpp0088148  -.--.---..----------------------.....................................................
FBpp0088149  -.--.---..----------------------.....................................................
FBpp0290863  -.--.---..----------------------.....................................................
FBpp0080720  -.--.REQ..YDKAEQMLHLALRMAQDI----.....................................................
FBpp0083319  L.QL.QGK..TKEASSIYADCLRHKPKDAALVavasnnlvvvnkdqnvfdskkkiraaladacesrltsr...............
FBpp0071288  -.--.---..----------------------.....................................................
FBpp0081398  N.FL.VKS..YDEAADELSQVCQLYEEVYGELadelgqplllyakaliamaldenkvidvpdeaaddddedvdddeeesaedgaa
FBpp0301016  N.FL.VKS..YDEAADELSQVCQLYEEVYGELadelgqplllyakaliamaldenkvidvpdeaaddddedvdddeeesaedgaa
FBpp0085015  L.FD.LGE..YQRSLEWLQVAFILLRNSPRE-.....................................................
FBpp0084188  -.--.---..----------------------.....................................................
FBpp0293235  -.--.---..----------------------.....................................................
FBpp0290580  -.--.---..--DALKDYEQALE---------.....................................................
FBpp0085012  -.--.---..----------------------.....................................................
FBpp0086380  K.IQ.QGL..FKEGYELISGALNLLNNVFG--.....................................................
FBpp0304708  -.ME.MKD..YNKSKEWLNVAISMLESSAYW-.....................................................
FBpp0305372  K.IQ.QGL..FKEGYELISGALNLLNNVFG--.....................................................
FBpp0304707  -.-E.MKD..YNKSKEWLNVAISMLESSAYW-.....................................................
FBpp0071879  -.--.---..----------------------.....................................................
FBpp0076961  -.--.---..----------------------.....................................................
FBpp0075717  -.--.---..----------------------.....................................................
FBpp0080267  Y.RK.ERH..PLKASDLFTEAI----------.....................................................
FBpp0070907  -.YK.ERN..YRAALRHFDEIIHKRRLMMRHKnav..................................................
FBpp0085033  -.--.---..----------------------.....................................................
FBpp0082507  L.MAyTKN..IDLARQHLEKAWSISEPL----.....................................................
FBpp0077738  A.IE.LGM..IEEAKDLYRRCK----------.....................................................
FBpp0292775  A.IE.LGM..IEEAKDLYRRCK----------.....................................................
FBpp0085676  Y.SR.RRR..ENFALHYLNKAL----------.....................................................
FBpp0087091  Q.FS.LKNrnYFQALELYNKSICYAE------.....................................................
FBpp0082624  F.FL.YEQ..FEEVLVYMNSIR----------.....................................................
FBpp0070908  -.--.---..-SEAVLAYKEVIRECPMALQVIeallelgvngneins......................................
FBpp0070431  -.--.---..----------------------.....................................................
FBpp0075443  -.VR.RRS..WARAVALYDQLIAPSPGQGSGG.....................................................
FBpp0305287  -.VR.RRS..WARAVALYDQLIAPSPGQGSGG.....................................................
FBpp0305288  -.VR.RRS..WARAVALYDQLIAPSPGQGSGG.....................................................
FBpp0070906  C.VV.KRD..FARANLLICQAVRRAREYFG--.....................................................
FBpp0303990  C.VV.KRD..FARANLLICQAVRRAREYFG--.....................................................
FBpp0073018  -.--.VRD..YYNALSALHRALDRSPVRLM--.....................................................
FBpp0078634  L.AS.KEE..YNKGLEILLEAEKIYEDFKASGlkplaiqdvfnppeegqqsh.................................
FBpp0087626  -.--.---..--KACRLYSEAV----------.....................................................
FBpp0075754  -.--.---..----------------------.....................................................
FBpp0087625  -.--.---..--KACRLYSEAV----------.....................................................
FBpp0071288  -.--.---..-------YREAL----------.....................................................
FBpp0085046  -.--.---..----------------------.....................................................
FBpp0110159  -.--.---..----------------------.....................................................
FBpp0072679  -.--.-GE..FEEAEKLYLDADRRDLAIELRMtlcdwfrvvqlyr........................................
FBpp0306202  -.--.-GE..FEEAEKLYLDADRRDLAIELRMtlcdwfrvvqlyr........................................
FBpp0082624  -.--.---..----------------------.....................................................
FBpp0084254  A.MH.KEN..FDEALLILLEADELFSQCDSKL.....................................................
FBpp0085032  L.FD.QKN..YLAAASWIYQSVVLMEAFSMAA.....................................................


                                                                                                    
                                                                                                    
d1kt1a1        .....................................................................................
FBpp0112456  .....................................................................................
FBpp0297503  .....................................................................................
FBpp0112455  .....................................................................................
FBpp0297502  .....................................................................................
FBpp0070352  psklrdlqqi...........................................................................
FBpp0070351  psklrdlqqi...........................................................................
FBpp0070402  .....................................................................................
FBpp0080138  .....................................................................................
FBpp0080139  .....................................................................................
FBpp0301685  .....................................................................................
FBpp0074609  dmgrftmaakhhqsiaemyesdpnnlaksiqhyeqaad...............................................
FBpp0084171  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0305561  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0271718  .....................................................................................
FBpp0290895  rsdgrlqdaaaalreslkalpllpqkqravlhlrlgeilaelqdwneaehqqrlamqlqpeqgaayvtygqtlarngsrlaeaes
FBpp0290896  rsdgrlqdaaaalreslkalpllpqkqravlhlrlgeilaelqdwneaehqqrlamqlqpeqgaayvtygqtlarngsrlaeaes
FBpp0081673  .....................................................................................
FBpp0293601  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0296963  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0305185  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0081607  .....................................................................................
FBpp0304082  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0303945  .....................................................................................
FBpp0303946  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  k....................................................................................
FBpp0074835  maral................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0085344  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0297109  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070573  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0305905  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0076114  .....................................................................................
FBpp0076115  .....................................................................................
FBpp0305988  .....................................................................................
FBpp0072561  kekerkhqekalai.......................................................................
FBpp0072562  kekerkhqekalai.......................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0293601  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0303945  .....................................................................................
FBpp0303946  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0085409  .....................................................................................
FBpp0271717  .....................................................................................
FBpp0271719  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0303439  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0300561  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0305561  .....................................................................................
FBpp0071712  .....................................................................................
FBpp0086749  nsvllrqnphnvhewhkrvtlyedkpaeiistyteavq...............................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0305602  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0079666  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  .....................................................................................
FBpp0082819  .....................................................................................
FBpp0292061  .....................................................................................
FBpp0085279  vklafrrlcdvqteaiesdmesetniiklqqqaepiqqigetdgyqslnnepvtgsvikaegggklnetvkfaatvkhryvvqal
FBpp0081805  .....................................................................................
FBpp0100021  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0074877  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  llhgqsladssasgsmeqlklaeknflrslllikdlsg...............................................
FBpp0079851  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0077738  fesqqpeil............................................................................
FBpp0077934  .....................................................................................
FBpp0292775  fesqqpeil............................................................................
FBpp0087646  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0297722  .....................................................................................
FBpp0087232  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0075786  .....................................................................................
FBpp0075788  .....................................................................................
FBpp0306229  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0075789  .....................................................................................
FBpp0301715  .....................................................................................
FBpp0301716  .....................................................................................
FBpp0306230  .....................................................................................
FBpp0075785  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076498  .....................................................................................
FBpp0293529  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0297722  .....................................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  .....................................................................................
FBpp0089396  .....................................................................................
FBpp0111789  .....................................................................................
FBpp0086683  .....................................................................................
FBpp0289328  .....................................................................................
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0305185  .....................................................................................
FBpp0112213  .....................................................................................
FBpp0087233  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0303990  .....................................................................................
FBpp0087646  krvqdtengnftkiqeylgriwvsndfeiapedtqlykttmeallqnsepsarsvvykrylkwlykkqdyetcvrhacnmteshp
FBpp0082112  .....................................................................................
FBpp0086359  .....................................................................................
FBpp0293627  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0303989  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085047  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0082420  .....................................................................................
FBpp0306145  .....................................................................................
FBpp0303989  .....................................................................................
FBpp0305372  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0081398  kkeekkdtkeaangasssngkeldtikegsdeadstgeaeqaqsdekpskkvptgvdevsssnggggaavndderpstsngevta
FBpp0301016  kkeekkdtkeaangasssngkeldtikegsdeadstgeaeqaqsdekpskkvptgvdevsssnggggaavndderpstsngevta
FBpp0085015  .....................................................................................
FBpp0084188  .....................................................................................
FBpp0293235  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0304708  .....................................................................................
FBpp0305372  .....................................................................................
FBpp0304707  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  .....................................................................................
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075443  .....................................................................................
FBpp0305287  .....................................................................................
FBpp0305288  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0303990  .....................................................................................
FBpp0073018  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0087626  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0085046  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0306202  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................


                                                                                                    
                                                                                                    
d1kt1a1        .....................................................................................
FBpp0112456  .....................................................................................
FBpp0297503  .....................................................................................
FBpp0112455  .....................................................................................
FBpp0297502  .....................................................................................
FBpp0070352  .....................................................................................
FBpp0070351  .....................................................................................
FBpp0070402  .....................................................................................
FBpp0080138  .....................................................................................
FBpp0080139  .....................................................................................
FBpp0301685  .....................................................................................
FBpp0074609  .....................................................................................
FBpp0084171  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0305561  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0271718  .....................................................................................
FBpp0290895  w....................................................................................
FBpp0290896  w....................................................................................
FBpp0081673  .....................................................................................
FBpp0293601  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0296963  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0305185  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0081607  .....................................................................................
FBpp0304082  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0303945  .....................................................................................
FBpp0303946  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0085344  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0297109  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070573  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0305905  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0076114  .....................................................................................
FBpp0076115  .....................................................................................
FBpp0305988  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0293601  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0303945  .....................................................................................
FBpp0303946  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0085409  .....................................................................................
FBpp0271717  .....................................................................................
FBpp0271719  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0303439  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0300561  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0305561  .....................................................................................
FBpp0071712  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0305602  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0079666  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  .....................................................................................
FBpp0082819  .....................................................................................
FBpp0292061  .....................................................................................
FBpp0085279  kkdelavyrnerrnavkrsitmivdlispfiednyndgynwcieiiktsnlawlanelelnkalvylrqndvhqaietlqmydrk
FBpp0081805  .....................................................................................
FBpp0100021  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0074877  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0297722  .....................................................................................
FBpp0087232  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0075786  .....................................................................................
FBpp0075788  .....................................................................................
FBpp0306229  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0075789  .....................................................................................
FBpp0301715  .....................................................................................
FBpp0301716  .....................................................................................
FBpp0306230  .....................................................................................
FBpp0075785  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076498  .....................................................................................
FBpp0293529  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0297722  .....................................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  .....................................................................................
FBpp0089396  .....................................................................................
FBpp0111789  .....................................................................................
FBpp0086683  .....................................................................................
FBpp0289328  .....................................................................................
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0305185  .....................................................................................
FBpp0112213  .....................................................................................
FBpp0087233  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0303990  .....................................................................................
FBpp0087646  kdvygfewicktycehheqseivswqqelrhpiqvy.................................................
FBpp0082112  .....................................................................................
FBpp0086359  .....................................................................................
FBpp0293627  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0303989  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085047  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0082420  .....................................................................................
FBpp0306145  .....................................................................................
FBpp0303989  .....................................................................................
FBpp0305372  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0081398  scsngaapaveeepeeeegvsgslqlaweileaaaqif...............................................
FBpp0301016  scsngaapaveeepeeeegvsgslqlaweileaaaqif...............................................
FBpp0085015  .....................................................................................
FBpp0084188  .....................................................................................
FBpp0293235  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0304708  .....................................................................................
FBpp0305372  .....................................................................................
FBpp0304707  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  .....................................................................................
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075443  .....................................................................................
FBpp0305287  .....................................................................................
FBpp0305288  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0303990  .....................................................................................
FBpp0073018  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0087626  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0085046  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0306202  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................


                                                                                 60             70  
                                                                                  |              |  
d1kt1a1        ............................................................EKESKASESFL.....LAAFLNLAM
FBpp0112456  ............................................................-----GVLNRN.....ALLYFAYAD
FBpp0297503  ............................................................-----GVLNRN.....ALLYFAYAD
FBpp0112455  ............................................................-----GVLNRN.....ALLYFAYAD
FBpp0297502  ............................................................-----GVLNRN.....ALLYFAYAD
FBpp0070352  ............................................................YLEAVRQHPSEvd...AEVQDALGV
FBpp0070351  ............................................................YLEAVRQHPSEvd...AEVQDALGV
FBpp0070402  ............................................................-----DNEHRN.....VTLWLKYAE
FBpp0080138  ............................................................-----------.....---------
FBpp0080139  ............................................................-----------.....---------
FBpp0301685  ............................................................-----------.....---------
FBpp0074609  ............................................................YFKGEESVSSA.....NKCMLKVAQ
FBpp0084171  ............................................................-----------.....---------
FBpp0085420  ............................................................YLKALEVFPDF.....AAAHSNLAS
FBpp0085421  ............................................................YLKALEVFPDF.....AAAHSNLAS
FBpp0085422  ............................................................YLKALEVFPDF.....AAAHSNLAS
FBpp0085420  ............................................................YLKAIETCPGF.....AVAWSNLGC
FBpp0085421  ............................................................YLKAIETCPGF.....AVAWSNLGC
FBpp0085422  ............................................................YLKAIETCPGF.....AVAWSNLGC
FBpp0077790  ............................................................-----EHDPTD.....ITFYNNIAA
FBpp0082545  ............................................................-----ELYPNY.....ESALMNLGN
FBpp0084693  ............................................................-----QRCPNL.....LQLSYRRIN
FBpp0084691  ............................................................-----QRCPNL.....LQLSYRRIN
FBpp0084692  ............................................................-----QRCPNL.....LQLSYRRIN
FBpp0084694  ............................................................-----QRCPNL.....LQLSYRRIN
FBpp0112211  ............................................................-----QRCPNL.....LQLSYRRIN
FBpp0072096  ............................................................V----------.....EEYANKSAS
FBpp0071560  ............................................................-----LYDNEN.....ADIYYNLGV
FBpp0071561  ............................................................-----LYDNEN.....ADIYYNLGV
FBpp0077790  ............................................................-----KRNPDD.....PKLYSNRAA
FBpp0076600  ............................................................-----VRDPRH.....YNAWYGIGT
FBpp0305561  ............................................................-----VRDPRH.....YNAWYGIGT
FBpp0271716  ............................................................----------R.....RDYIYYLAF
FBpp0077790  ............................................................-----ALDDQN.....HVLYSNRSA
FBpp0271718  ............................................................---------GR.....RDYIYYLAF
FBpp0290895  ............................................................FKRALQLAPLE.....PSSHHHYAD
FBpp0290896  ............................................................FKRALQLAPLE.....PSSHHHYAD
FBpp0081673  ............................................................------SFDKR.....KDCLLKAID
FBpp0293601  ............................................................-----RFRPNM.....ADVHFNLGI
FBpp0077614  ............................................................-----RFRPNM.....ADVHFNLGI
FBpp0084692  ............................................................-----KEDSTD.....FTGWTYLLQ
FBpp0084694  ............................................................-----KEDSTD.....FTGWTYLLQ
FBpp0112211  ............................................................-----KEDSTD.....FTGWTYLLQ
FBpp0084691  ............................................................-----KEDSTD.....FTGWTYLLQ
FBpp0084693  ............................................................-----KEDSTD.....FTGWTYLLQ
FBpp0296980  ............................................................-----QLDPGN.....HILYSNRSA
FBpp0300832  ............................................................-----QLDPGN.....HILYSNRSA
FBpp0080535  ............................................................-----AFDPKN.....PIFYCNRAA
FBpp0296963  ............................................................-----AFDPKN.....PIFYCNRAA
FBpp0296980  ............................................................-----KDTAGE.....ACALLNLGN
FBpp0300832  ............................................................-----KDTAGE.....ACALLNLGN
FBpp0072164  ............................................................-----AVYPHD.....PIYHINRAL
FBpp0084016  ............................................................LTTVLNKFKTE.....LRVWPVAAE
FBpp0296980  ............................................................-----GDRLQE.....AREIGNVGA
FBpp0300832  ............................................................-----GDRLQE.....AREIGNVGA
FBpp0296980  ............................................................VAHELHSPEIK.....ALAYGDLGH
FBpp0300832  ............................................................VAHELHSPEIK.....ALAYGDLGH
FBpp0080894  ............................................................-----KLNPKY.....LAAWTLMGH
FBpp0305185  ............................................................-----KLNPKY.....LAAWTLMGH
FBpp0081606  ............................................................-----ELHPNS.....AIYYANRSL
FBpp0081607  ............................................................-----ELHPNS.....AIYYANRSL
FBpp0304082  ............................................................-----ELHPNS.....AIYYANRSL
FBpp0084559  ............................................................-----GDRAAE.....RRANSNLGN
FBpp0075683  ............................................................-----KDHPDV.....AKQLNNLAL
FBpp0303945  ............................................................-----KDHPDV.....AKQLNNLAL
FBpp0303946  ............................................................-----KDHPDV.....AKQLNNLAL
FBpp0081284  ............................................................--KAGSKHKEL.....AVFYKNRAA
FBpp0079468  ............................................................E----EVKKIK.....VATHSNIAL
FBpp0087297  ............................................................YSQIANAEPEI.....AELWNNIGL
FBpp0074835  ............................................................Q----------.....---------
FBpp0079893  ............................................................FQNAIERFPSC.....VECYSLTAQ
FBpp0079894  ............................................................FQNAIERFPSC.....VECYSLTAQ
FBpp0079895  ............................................................FQNAIERFPSC.....VECYSLTAQ
FBpp0082765  ............................................................-----ASSKER.....AVLYGNRAA
FBpp0079617  ............................................................-----IKNPTN.....ATYFTNRAL
FBpp0084440  ............................................................-----IYDPENa....VHAYNNRAV
FBpp0305670  ............................................................-----SLCPDS.....AAYYGNRAA
FBpp0080423  ............................................................-----SLCPDS.....AAYYGNRAA
FBpp0305671  ............................................................-----SLCPDS.....AAYYGNRAA
FBpp0080424  ............................................................-----SLCPDS.....AAYYGNRAA
FBpp0305672  ............................................................-----SLCPDS.....AAYYGNRAA
FBpp0085344  ............................................................-----QIYPLS.....HQIMFMRGQ
FBpp0081552  ............................................................-----EGDANN.....YLTLFKRGT
FBpp0297109  ............................................................-----QIYPLS.....HQIMFMRGQ
FBpp0087646  ............................................................LNTLSHLGSNEs....IRLQYKLGL
FBpp0083769  ............................................................-----ALDRLY.....GPAWLAYGH
FBpp0070572  ............................................................-----ELSPGN.....ALFHAKRGQ
FBpp0070573  ............................................................-----ELSPGN.....ALFHAKRGQ
FBpp0070575  ............................................................-----ELSPGN.....ALFHAKRGQ
FBpp0305905  ............................................................-----ELSPGN.....ALFHAKRGQ
FBpp0074835  ............................................................LQRAVAHCPKS.....EILWLMGAK
FBpp0305670  ............................................................-----HNKDIN.....SKLLYNRAL
FBpp0080424  ............................................................-----HNKDIN.....SKLLYNRAL
FBpp0305672  ............................................................-----HNKDIN.....SKLLYNRAL
FBpp0080423  ............................................................-----HNKDIN.....SKLLYNRAL
FBpp0305671  ............................................................-----HNKDIN.....SKLLYNRAL
FBpp0076113  ............................................................DEDLLKVDGFS.....VVNNINAAA
FBpp0076114  ............................................................DEDLLKVDGFS.....VVNNINAAA
FBpp0076115  ............................................................DEDLLKVDGFS.....VVNNINAAA
FBpp0305988  ............................................................DEDLLKVDGFS.....VVNNINAAA
FBpp0072561  ............................................................FKQVLRNDPRN.....IWATNGIGA
FBpp0072562  ............................................................FKQVLRNDPRN.....IWATNGIGA
FBpp0072561  ............................................................-----RTNPNCp....ANVRIGMAH
FBpp0072562  ............................................................-----RTNPNCp....ANVRIGMAH
FBpp0085923  ............................................................-----AKYPQG.....EVLYLNRAT
FBpp0293601  ............................................................FKRALKLAPEQ.....ASVYHHYAE
FBpp0079893  ............................................................-----EHRTDM.....AIFYQNRAA
FBpp0079894  ............................................................-----EHRTDM.....AIFYQNRAA
FBpp0079895  ............................................................-----EHRTDM.....AIFYQNRAA
FBpp0075683  ............................................................-----HDHPDV.....ATMLNILAL
FBpp0303945  ............................................................-----HDHPDV.....ATMLNILAL
FBpp0303946  ............................................................-----HDHPDV.....ATMLNILAL
FBpp0077614  ............................................................FKRALKLAPEQ.....ASVYHHYAE
FBpp0085409  ............................................................-----------.....RDYIYYLAF
FBpp0271717  ............................................................-----------.....RDYIYYLAF
FBpp0271719  ............................................................-----------.....RDYIYYLAF
FBpp0086749  ............................................................-----DLKICT.....PQIIINYGM
FBpp0073411  ............................................................DEEWQELAAIK.....TPLLLNYAQ
FBpp0070907  ............................................................FAKVSSEVKYT.....ASHWFAHAQ
FBpp0303439  ............................................................DEEWQELAAIK.....TPLLLNYAQ
FBpp0070908  ............................................................FAKVSSEVKYT.....ASHWFAHAQ
FBpp0085842  ............................................................NSDTQTLLEDR.....LIVYNNLAM
FBpp0300561  ............................................................-----ELNSTD.....INALISRSK
FBpp0077718  ............................................................-----SLGAQS.....PELYCNIAL
FBpp0296980  ............................................................-----GDRSME.....AAACGALGL
FBpp0300832  ............................................................-----GDRSME.....AAACGALGL
FBpp0076600  ............................................................-----EKARRS.....PQCRFLQAK
FBpp0305561  ............................................................-----EKARRS.....PQCRFLQAK
FBpp0071712  ............................................................-----ELNSTD.....INALISRSK
FBpp0086749  ............................................................TVQPKQAVGKL.....HTLWVEFAK
FBpp0085479  ............................................................---------DNpdvl.AVLYNNRSA
FBpp0112016  ............................................................-----ELNSTD.....INALISRSK
FBpp0292906  ............................................................-----EADPKS.....GQSLYLLGR
FBpp0305602  ............................................................-----EADPKS.....GQSLYLLGR
FBpp0079665  ............................................................-----EADPKS.....GQSLYLLGR
FBpp0079666  ............................................................-----EADPKS.....GQSLYLLGR
FBpp0079664  ............................................................-----EADPKS.....GQSLYLLGR
FBpp0084076  ............................................................-----IKVKDS.....AITYCNRAL
FBpp0111406  ............................................................-----ENIRDS.....HILYINRAL
FBpp0074918  ............................................................-----EINNLQ.....EAILLRCGY
FBpp0082818  ............................................................LNEYLKKFMSD.....QEAWHELCN
FBpp0074480  ............................................................-----RNDLRS.....HVCWHVYGL
FBpp0082819  ............................................................LNEYLKKFMSD.....QEAWHELCN
FBpp0292061  ............................................................-----NIDPRN.....VEALVARGA
FBpp0085279  segsmtasaltnlsfiyikmashcvnqlheigslknnapglinagivelgshnlilaserFEGALQLQPMN.....FEARYNLGL
FBpp0081805  ............................................................-----NIDPRN.....VEALVARGA
FBpp0100021  ............................................................-----------.....----LMLGL
FBpp0100023  ............................................................-----------.....----LMLGL
FBpp0074877  ............................................................-----------.....----LMLGL
FBpp0071879  ............................................................SMAMGNFCLEK.....LQNWIAEGN
FBpp0084559  ............................................................-----NDRLGE.....AKSSGNLGN
FBpp0075591  ............................................................-----NLAQ-R.....ASVLNNRAQ
FBpp0076526  ............................................................QISKLEQLDMQ.....ARCYLNIGV
FBpp0079851  ............................................................-----MDNLLF.....KLSFLRLGQ
FBpp0290395  ............................................................QVVGISASDID.....SRLFEKVGS
FBpp0072146  ............................................................DEEERKQTELL.....TTLNQNLMI
FBpp0296980  ............................................................-----ELSTDRlak..AMACLALGR
FBpp0300832  ............................................................-----ELSTDRlak..AMACLALGR
FBpp0083238  ............................................................-----RKHPNL.....LCARALKGL
FBpp0111383  ............................................................-----QYIKDS.....PVLYVNRAL
FBpp0080424  ............................................................-----KLAPAC.....LKYRLLKAE
FBpp0305672  ............................................................-----KLAPAC.....LKYRLLKAE
FBpp0305670  ............................................................-----KLAPAC.....LKYRLLKAE
FBpp0071560  ............................................................FMSGVHVNQRN.....AKLYNNVGH
FBpp0071561  ............................................................FMSGVHVNQRN.....AKLYNNVGH
FBpp0080423  ............................................................-----KLAPAC.....LKYRLLKAE
FBpp0305671  ............................................................-----KLAPAC.....LKYRLLKAE
FBpp0071879  ............................................................-----LIQPQGm....ADVWVGIGH
FBpp0077738  ............................................................EIIASDLAPDSd....AELINRCAD
FBpp0077934  ............................................................-----HLDTGN.....TMILNNMGV
FBpp0292775  ............................................................EIIASDLAPDSd....AELINRCAD
FBpp0087646  ............................................................-----KECSNR.....WQNWNLLGV
FBpp0292906  ............................................................-----NNYWTN.....HAFIYGIGV
FBpp0079664  ............................................................-----NNYWTN.....HAFIYGIGV
FBpp0086749  ............................................................-----VFMHKM.....PRIWMDYGA
FBpp0082652  ............................................................-----QYVADS.....PVLYCNRAL
FBpp0077619  ............................................................-------NERDff...EVSRLRLGY
FBpp0086164  ............................................................-----DGDTVEcp...AFVWLRQAE
FBpp0297722  ............................................................-----DGDTVEcp...AFVWLRQAE
FBpp0087232  ............................................................-----ENVAEI.....RVVLANRSA
FBpp0072561  ............................................................-----------.....-----GLGQ
FBpp0072562  ............................................................-----------.....-----GLGQ
FBpp0088148  ............................................................-----DSPNMR.....AETYLNLSR
FBpp0088149  ............................................................-----DSPNMR.....AETYLNLSR
FBpp0075786  ............................................................ERNA-IFAQLR.....TNLLLNLSR
FBpp0075788  ............................................................ERNA-IFAQLR.....TNLLLNLSR
FBpp0306229  ............................................................ERNA-IFAQLR.....TNLLLNLSR
FBpp0075787  ............................................................ERNA-IFAQLR.....TNLLLNLSR
FBpp0075789  ............................................................ERNA-IFAQLR.....TNLLLNLSR
FBpp0301715  ............................................................ERNA-IFAQLR.....TNLLLNLSR
FBpp0301716  ............................................................ERNA-IFAQLR.....TNLLLNLSR
FBpp0306230  ............................................................ERNA-IFAQLR.....TNLLLNLSR
FBpp0075785  ............................................................ERNA-IFAQLR.....TNLLLNLSR
FBpp0083319  ............................................................-----GVAPDD.....PTALHCKVV
FBpp0076498  ............................................................-----EKSPAN.....FKSLCLRAE
FBpp0293529  ............................................................-----EKSPAN.....FKSLCLRAE
FBpp0290580  ............................................................-----QLAPKE.....AKYRFYYAQ
FBpp0290395  ............................................................-----KMFPHV.....NQLKLNMGN
FBpp0080720  ............................................................-----AVNDAS.....VTILNNISV
FBpp0086164  ............................................................STLAAHLNPQD.....RDMWIRVSD
FBpp0297722  ............................................................STLAAHLNPQD.....RDMWIRVSD
FBpp0080741  ............................................................-----RFVKLN.....IKYYLIQGQ
FBpp0087297  ............................................................-----------.....---------
FBpp0070720  ............................................................-----------.....---------
FBpp0089396  ............................................................-----------.....---------
FBpp0111789  ............................................................-----------.....---------
FBpp0086683  ............................................................FEQQCRKKDML.....IALFESLMI
FBpp0289328  ............................................................-----------.....---------
FBpp0070667  ............................................................-----LLAPPIfk...DIPLLSLGT
FBpp0082624  ............................................................-----VDNKEY.....QAINVYLAL
FBpp0081552  ............................................................-----EETMIR.....YEGHKVLCT
FBpp0086749  ............................................................-----------.....---------
FBpp0087646  ............................................................-----EPGADR.....DKLYTNLGY
FBpp0071879  ............................................................-----TSEPDE.....PVVMDLLAK
FBpp0080894  ............................................................-----ESDPYR.....LDNVDTYSN
FBpp0305185  ............................................................-----ESDPYR.....LDNVDTYSN
FBpp0112213  ............................................................-----------.....---------
FBpp0087233  ............................................................-----------.....-VVLANRSA
FBpp0070906  ............................................................LQVFGEVNVQT.....AKHYGNLGR
FBpp0303990  ............................................................LQVFGEVNVQT.....AKHYGNLGR
FBpp0087646  ............................................................AEQLLELNPNS.....NLALLVKAL
FBpp0082112  ............................................................-----ITPQLS.....TCIANNMGV
FBpp0086359  ............................................................-----NRLPED.....PRLRNQLSL
FBpp0293627  ............................................................-----NRLPED.....PRLRNQLSL
FBpp0076526  ............................................................-----ESGKSL.....VPIYVSLYQ
FBpp0085279  ............................................................-----RKSEGSmt...ASALTNLSF
FBpp0074835  ............................................................-----------.....---------
FBpp0303989  ............................................................-----HFDYEV.....GLSIGHLAS
FBpp0078887  ............................................................-----QTNIKE.....ALGALRMAQ
FBpp0290580  ............................................................-----QVGGFN.....PLVAYNVAL
FBpp0085047  ............................................................-----------.....---CLAIGL
FBpp0296980  ............................................................-----CSLKLR.....GSVFSALSS
FBpp0300832  ............................................................-----CSLKLR.....GSVFSALSS
FBpp0086380  ............................................................VLICGEDHPEV.....ALIDSNISL
FBpp0083435  ............................................................--------ELF.....IQIQTNLAA
FBpp0078891  ............................................................VAKMQEISDDA.....TLTQLAQAW
FBpp0082419  ............................................................-----------.....---------
FBpp0082420  ............................................................-----------.....---------
FBpp0306145  ............................................................-----------.....---------
FBpp0303989  ............................................................-----NMNFHV.....AIAHEDLSY
FBpp0305372  ............................................................-----EDHPEV.....ALIDSNISL
FBpp0086749  ............................................................-----------.....---------
FBpp0078027  ............................................................-----KLGPAD.....FTTLYRRSQ
FBpp0088148  ............................................................-----------.....--ALLRMAV
FBpp0088149  ............................................................-----------.....--ALLRMAV
FBpp0290863  ............................................................-----------.....---YSDWAM
FBpp0080720  ............................................................-----QSKDGI.....TYVFDLMAN
FBpp0083319  ............................................................QKQVIALNNCL.....LALYTNAG-
FBpp0071288  ............................................................-----------.....---------
FBpp0081398  ............................................................SRQGLSGLPYL.....AEVQTELAN
FBpp0301016  ............................................................SRQGLSGLPYL.....AEVQTELAN
FBpp0085015  ............................................................---EKDADHYL.....SDIREYASM
FBpp0084188  ............................................................-----------.....-------AR
FBpp0293235  ............................................................-----------.....-------AR
FBpp0290580  ............................................................---------LY.....LPVVMARAW
FBpp0085012  ............................................................-----------.....---------
FBpp0086380  ............................................................-----ALHQEN.....GSCLRMLAR
FBpp0304708  ............................................................-----DPIVPS.....ADLYLKLAE
FBpp0305372  ............................................................-----ALHQEN.....GSCLRMLAR
FBpp0304707  ............................................................-----DPIVPS.....ADLYLKLAE
FBpp0071879  ............................................................-----------.....------SAH
FBpp0076961  ............................................................-----------.....-WIYRSWGQ
FBpp0075717  ............................................................---------TL.....ALAYRSRAS
FBpp0080267  ............................................................-----FLAPARntlaaALAHANRSL
FBpp0070907  ............................................................LVAIESSYPEFgd...AEQRRRAAE
FBpp0085033  ............................................................-----------.....-------GA
FBpp0082507  ............................................................-----PNFDVK.....FDTASLLAQ
FBpp0077738  ............................................................-----RFDL--.....---------
FBpp0292775  ............................................................-----RFDL--.....---------
FBpp0085676  ............................................................-----ALEPTD.....HMTLYKRCQ
FBpp0087091  ............................................................-----PNSEHL.....SIGYANRSA
FBpp0082624  ............................................................-----SYFVND.....DVFNYNFAQ
FBpp0070908  ............................................................L----------.....---------
FBpp0070431  ............................................................-----------.....---------
FBpp0075443  ............................................................QSAGSRAQKDQq....IACLLGRCE
FBpp0305287  ............................................................QSAGSRAQKDQq....IACLLGRCE
FBpp0305288  ............................................................QSAGSRAQKDQq....IACLLGRCE
FBpp0070906  ............................................................-----PTHQKY.....GDALLDYGF
FBpp0303990  ............................................................-----PTHQKY.....GDALLDYGF
FBpp0073018  ............................................................-----SQEKGY.....QYFCVNLAV
FBpp0078634  ............................................................EAGPKELESLY.....TLVSFYMAQ
FBpp0087626  ............................................................-FEAENAVEEL.....SLAFANRGI
FBpp0075754  ............................................................-----------.....--------R
FBpp0087625  ............................................................-FEAENAVEEL.....SLAFANRGI
FBpp0071288  ............................................................-----AKFNHD.....RRLWSNWIK
FBpp0085046  ............................................................-----------.....-------GR
FBpp0110159  ............................................................-----------.....-------GR
FBpp0072679  ............................................................MGGSGVSDQQM.....EIAWREIGH
FBpp0306202  ............................................................MGGSGVSDQQM.....EIAWREIGH
FBpp0082624  ............................................................-----------.....------IAF
FBpp0084254  ............................................................L----EGVDNY.....ALINLDIVW
FBpp0085032  ............................................................-----PLEISK.....NEVRMVYAE


                             80        90                                                           
                              |         |                                                           
d1kt1a1        CY.L....KLR...EYTKAVECCDKAL.GL.......................................................
FBpp0112456  FE.E....GRL...KYEKVHTMYNKLL.QL.......................................................
FBpp0297503  FE.E....GRL...KYEKVHTMYNKLL.QL.......................................................
FBpp0112455  FE.E....GRL...KYEKVHTMYNKLL.QL.......................................................
FBpp0297502  FE.E....GRL...KYEKVHTMYNKLL.QL.......................................................
FBpp0070352  LY.N....LSG...EFDKAVDCYQSAL.QV.......................................................
FBpp0070351  LY.N....LSG...EFDKAVDCYQSAL.QV.......................................................
FBpp0070402  ME.M....KNK...QVNHARNLWDRAV.TI.......................................................
FBpp0080138  --.-....---...----VAKYYLEAF.KL.......................................................
FBpp0080139  --.-....---...----VAKYYLEAF.KL.......................................................
FBpp0301685  --.-....---...-------L-----.--.......................................................
FBpp0074609  YA.A....QLE...DYEKAISIYEQVA.AS.......................................................
FBpp0084171  --.-....KAT...DYMEAARYYQRAQ.EL.......................................................
FBpp0085420  VL.Q....QQG...KLKEALMHYKEAI.RI.......................................................
FBpp0085421  VL.Q....QQG...KLKEALMHYKEAI.RI.......................................................
FBpp0085422  VL.Q....QQG...KLKEALMHYKEAI.RI.......................................................
FBpp0085420  VF.N....AQG...EIWLAIHHFEKAV.TL.......................................................
FBpp0085421  VF.N....AQG...EIWLAIHHFEKAV.TL.......................................................
FBpp0085422  VF.N....AQG...EIWLAIHHFEKAV.TL.......................................................
FBpp0077790  VH.F....ERK...EYEECIKQCEKGI.EV.......................................................
FBpp0082545  LY.R....EHG...QLSTAEEYIRLAL.QA.......................................................
FBpp0084693  VE.R....RRG...ALDKCRELYKHYI.ES.......................................................
FBpp0084691  VE.R....RRG...ALDKCRELYKHYI.ES.......................................................
FBpp0084692  VE.R....RRG...ALDKCRELYKHYI.ES.......................................................
FBpp0084694  VE.R....RRG...ALDKCRELYKHYI.ES.......................................................
FBpp0112211  VE.R....RRG...ALDKCRELYKHYI.ES.......................................................
FBpp0072096  LY.Q....QHG...SPEAAASALDKAA.KL.......................................................
FBpp0071560  VF.L....EQG...KSQQAQVYFNKAI.ELypeheqallnsaillqelggeearrvsrsrlykvlen..................
FBpp0071561  VF.L....EQG...KSQQAQVYFNKAI.ELypeheqallnsaillqelggeearrvsrsrlykvlen..................
FBpp0077790  CY.T....KLA...AFDLGLKDCDTCI.KL.......................................................
FBpp0076600  IY.S....KQE...KYELAEIHYVKAL.KI.......................................................
FBpp0305561  IY.S....KQE...KYELAEIHYVKAL.KI.......................................................
FBpp0271716  GN.A....RIK...EYTSGLKYCRAFL.DI.......................................................
FBpp0077790  AF.A....KAG...KFQEALEDAEKTI.QL.......................................................
FBpp0271718  GN.A....RIK...EYTSGLKYCRAFL.DI.......................................................
FBpp0290895  FL.E....QQE...RHHEALGLRLRAA.AL.......................................................
FBpp0290896  FL.E....QQE...RHHEALGLRLRAA.AL.......................................................
FBpp0081673  CY.E....NNK...SWFHAAKSYEQII.LL.......................................................
FBpp0293601  LH.Q....NQQ...VYPAAVECFQRAI.KF.......................................................
FBpp0077614  LH.Q....NQQ...VYPAAVECFQRAI.KF.......................................................
FBpp0084692  YV.D....NES...DAEAAREAYDTFL.SH.......................................................
FBpp0084694  YV.D....NES...DAEAAREAYDTFL.SH.......................................................
FBpp0112211  YV.D....NES...DAEAAREAYDTFL.SH.......................................................
FBpp0084691  YV.D....NES...DAEAAREAYDTFL.SH.......................................................
FBpp0084693  YV.D....NES...DAEAAREAYDTFL.SH.......................................................
FBpp0296980  AL.L....KQG...QFTAALQDATQAR.DL.......................................................
FBpp0300832  AL.L....KQG...QFTAALQDATQAR.DL.......................................................
FBpp0080535  AH.I....RLG...ENERAVTDCKSAL.VY.......................................................
FBpp0296963  AH.I....RLG...ENERAVTDCKSAL.VY.......................................................
FBpp0296980  CL.S....GRQ...EYEEAVPHYESYL.ML.......................................................
FBpp0300832  CL.S....GRQ...EYEEAVPHYESYL.ML.......................................................
FBpp0072164  CY.L....KQE...SFDQCVEDCEAAI.AL.......................................................
FBpp0084016  AY.F....WLG...KSDQVHNLLQRAL.RA.......................................................
FBpp0296980  VY.L....ALG...ECEAALDCHSQHL.RL.......................................................
FBpp0300832  VY.L....ALG...ECEAALDCHSQHL.RL.......................................................
FBpp0296980  VH.A....ALG...NHAQALNCLEHQR.EL.......................................................
FBpp0300832  VH.A....ALG...NHAQALNCLEHQR.EL.......................................................
FBpp0080894  EF.M....ELK...NTNAAIQSYRKAV.EV.......................................................
FBpp0305185  EF.M....ELK...NTNAAIQSYRKAV.EV.......................................................
FBpp0081606  AH.L....RQE...SFGFALQDGVSAV.KA.......................................................
FBpp0081607  AH.L....RQE...SFGFALQDGVSAV.KA.......................................................
FBpp0304082  AH.L....RQE...SFGFALQDGVSAV.KA.......................................................
FBpp0084559  SH.I....FLG...QFEDAAEHYKRTL.AL.......................................................
FBpp0075683  LC.Q....NQG...KYDEVEKYYQRAL.DIyesklgpd...............................................
FBpp0303945  LC.Q....NQG...KYDEVEKYYQRAL.DIyesklgpd...............................................
FBpp0303946  LC.Q....NQG...KYDEVEKYYQRAL.DIyesklgpd...............................................
FBpp0081284  AY.L....KLG...KYENAVEDCTESL.KA.......................................................
FBpp0079468  CH.Q....KSN...DHFEAKQECNEVL.AL.......................................................
FBpp0087297  CF.F....KKQ...KFIVAISSLRKSV.WL.......................................................
FBpp0074835  --.-....---...-------------.-Ecpnagelwaeaifmetkpqrktksvdalkk.........................
FBpp0079893  VL.A....DQQ...QFTQAEEYYKKAM.VL.......................................................
FBpp0079894  VL.A....DQQ...QFTQAEEYYKKAM.VL.......................................................
FBpp0079895  VL.A....DQQ...QFTQAEEYYKKAM.VL.......................................................
FBpp0082765  AK.I....KLE...ANKAAIDDCTKAI.EL.......................................................
FBpp0079617  CN.L....KLK...RWELCCQDSRRAL.DI.......................................................
FBpp0084440  AH.L....KLK...KYFSAISDCQACL.QI.......................................................
FBpp0305670  CY.M....MLL...NYNSALTDARHAI.RI.......................................................
FBpp0080423  CY.M....MLL...NYNSALTDARHAI.RI.......................................................
FBpp0305671  CY.M....MLL...NYNSALTDARHAI.RI.......................................................
FBpp0080424  CY.M....MLL...NYNSALTDARHAI.RI.......................................................
FBpp0305672  CY.M....MLL...NYNSALTDARHAI.RI.......................................................
FBpp0085344  VH.V....YLE...QWFDAKQCFLNAV.AA.......................................................
FBpp0081552  VY.L....ALG...KTRFAVQDFSRVL.EL.......................................................
FBpp0297109  VH.V....YLE...QWFDAKQCFLNAV.AA.......................................................
FBpp0087646  HF.S....HVK...KWDSAIQCFRIAI.KN.......................................................
FBpp0083769  SF.A....NEN...EHEQAMAAYFKAT.QLmrgchlpllyigvecgltknlelaekfflqamniapldvyvlhelgvikyeyeff
FBpp0070572  AF.L....KLK...KPNACIRDCDVAL.EL.......................................................
FBpp0070573  AF.L....KLK...KPNACIRDCDVAL.EL.......................................................
FBpp0070575  AF.L....KLK...KPNACIRDCDVAL.EL.......................................................
FBpp0305905  AF.L....KLK...KPNACIRDCDVAL.EL.......................................................
FBpp0074835  SK.W....MAG...DVPAARGILSLAF.QA.......................................................
FBpp0305670  VN.T....RIG...NLREAVADCNRVL.EL.......................................................
FBpp0080424  VN.T....RIG...NLREAVADCNRVL.EL.......................................................
FBpp0305672  VN.T....RIG...NLREAVADCNRVL.EL.......................................................
FBpp0080423  VN.T....RIG...NLREAVADCNRVL.EL.......................................................
FBpp0305671  VN.T....RIG...NLREAVADCNRVL.EL.......................................................
FBpp0076113  VD.L....KVG...NYTSAREVCNEAI.RL.......................................................
FBpp0076114  VD.L....KVG...NYTSAREVCNEAI.RL.......................................................
FBpp0076115  VD.L....KVG...NYTSAREVCNEAI.RL.......................................................
FBpp0305988  VD.L....KVG...NYTSAREVCNEAI.RL.......................................................
FBpp0072561  VL.A....HKG...CVIEARDIFAQVR.EA.......................................................
FBpp0072562  VL.A....HKG...CVIEARDIFAQVR.EA.......................................................
FBpp0072561  CF.L....KMG...NPEKAKLAFERAL.QLdqqcvgaliglavlklnqlepesnklgvqmlskaytidnanpmvlnhlanhfffk
FBpp0072562  CF.L....KMG...NPEKAKLAFERAL.QLdqqcvgaliglavlklnqlepesnklgvqmlskaytidnanpmvlnhlanhfffk
FBpp0085923  AL.M....RRGwfgDIYAALRDCHEAL.RL.......................................................
FBpp0293601  FL.S....LQS...RHHESAIYHRRAA.EL.......................................................
FBpp0079893  SY.E....MLK...KWSNVKEDCTASL.EF.......................................................
FBpp0079894  SY.E....MLK...KWSNVKEDCTASL.EF.......................................................
FBpp0079895  SY.E....MLK...KWSNVKEDCTASL.EF.......................................................
FBpp0075683  VY.R....DQN...KYKEAANLLNDAL.SIrgktlgen...............................................
FBpp0303945  VY.R....DQN...KYKEAANLLNDAL.SIrgktlgen...............................................
FBpp0303946  VY.R....DQN...KYKEAANLLNDAL.SIrgktlgen...............................................
FBpp0077614  FL.S....LQS...RHHESAIYHRRAA.EL.......................................................
FBpp0085409  GN.A....RIK...EYTSGLKYCRAFL.DI.......................................................
FBpp0271717  GN.A....RIK...EYTSGLKYCRAFL.DI.......................................................
FBpp0271719  GN.A....RIK...EYTSGLKYCRAFL.DI.......................................................
FBpp0086749  FL.E....EHN...YFEEAYRAYEKGI.SLfk.....................................................
FBpp0073411  CR.L....IAG...DFYAVIEHCNEVL.TL.......................................................
FBpp0070907  LL.Y....DEG...KFERGLNFVEKCL.DS.......................................................
FBpp0303439  CR.L....IAG...DFYAVIEHCNEVL.TL.......................................................
FBpp0070908  LL.Y....DEG...KFERGLNFVEKCL.DS.......................................................
FBpp0085842  TQ.I....KIA...AYDAALQSVEHVL.RC.......................................................
FBpp0300561  CY.L....LLG...EASKALQDAETAL.GE.......................................................
FBpp0077718  CC.L....YGG...QIDLVLPCFQRAL.AT.......................................................
FBpp0296980  AH.R....LMR...RWDKALGHHTQEL.TL.......................................................
FBpp0300832  AH.R....LMR...RWDKALGHHTQEL.TL.......................................................
FBpp0076600  CA.Y....ELK...KYAEAESALISTG.FA.......................................................
FBpp0305561  CA.Y....ELK...KYAEAESALISTG.FA.......................................................
FBpp0071712  CY.L....LLG...EASKALQDAETAL.GE.......................................................
FBpp0086749  FY.E....ANG...QVEDARVVFERGT.EVeyvk...................................................
FBpp0085479  AH.F....FIK...NYRSSLSDAQRAL.FY.......................................................
FBpp0112016  CY.L....LLG...EASKALQDAETAL.GE.......................................................
FBpp0292906  CY.A....GIN...KVHDAFLAYRNSV.EK.......................................................
FBpp0305602  CY.A....GIN...KVHDAFLAYRNSV.EK.......................................................
FBpp0079665  CY.A....GIN...KVHDAFLAYRNSV.EK.......................................................
FBpp0079666  CY.A....GIN...KVHDAFLAYRNSV.EK.......................................................
FBpp0079664  CY.A....GIN...KVHDAFLAYRNSV.EK.......................................................
FBpp0084076  CY.I....KLQ...NYKRALKDCQYVL.EKl......................................................
FBpp0111406  CF.I....KSG...KFKRGIVDCDFVL.NKl......................................................
FBpp0074918  CA.I....QLE...RWEPAVKYYLAYT.HL.......................................................
FBpp0082818  MY.L....AEG...EFGKAAFCMEEVL.LH.......................................................
FBpp0074480  LQ.R....SDK...KYDEAIKCYRNAL.KW.......................................................
FBpp0082819  MY.L....AEG...EFGKAAFCMEEVL.LH.......................................................
FBpp0292061  LY.A....NRG...SFLKGLQDFEKAL.HL.......................................................
FBpp0085279  VA.L....AQN...DYELAEERFELLK.EQlmlpssvqhshvfyqlaklqerrlesglisnftpgaalqaylqvvgisa......
FBpp0081805  LY.A....NRG...SFLKGLQDFEKAL.HL.......................................................
FBpp0100021  MY.L....FLK...DYNQSENWLELAL.YH.......................................................
FBpp0100023  MY.L....FLK...DYNQSENWLELAL.YH.......................................................
FBpp0074877  MY.L....FLK...DYNQSENWLELAL.YH.......................................................
FBpp0071879  FR.A....ARK...QQEKALQCFGKIL.DC.......................................................
FBpp0084559  TL.K....VMG...RFDEAAICCERHL.TL.......................................................
FBpp0075591  TL.R....LAK...RDEEALDDLNKAL.EL.......................................................
FBpp0076526  VK.E....HME...AFQESIEYIDKAI.KI.......................................................
FBpp0079851  LA.L....QRK...QYELAEKAFNICL.PA.......................................................
FBpp0290395  LY.E....QIQ...DHQEANQYYNEAY.RI.......................................................
FBpp0072146  VY.N....KMN...KPKRACIMMKALR.HL.......................................................
FBpp0296980  VH.H....QLE...QHNQAVDYLRQGL.AS.......................................................
FBpp0300832  VH.H....QLE...QHNQAVDYLRQGL.AS.......................................................
FBpp0083238  SL.L....RLG...RYDESHGCLQTVA.EE.......................................................
FBpp0111383  CF.I....KLR...EFKLGIIDCDYVL.AKi......................................................
FBpp0080424  CL.A....FLG...RCDEALDIAVSVM.KL.......................................................
FBpp0305672  CL.A....FLG...RCDEALDIAVSVM.KL.......................................................
FBpp0305670  CL.A....FLG...RCDEALDIAVSVM.KL.......................................................
FBpp0071560  AL.E....NEG...KFEEALLYFQQAV.RI.......................................................
FBpp0071561  AL.E....NEG...KFEEALLYFQQAV.RI.......................................................
FBpp0080423  CL.A....FLG...RCDEALDIAVSVM.KL.......................................................
FBpp0305671  CL.A....FLG...RCDEALDIAVSVM.KL.......................................................
FBpp0071879  CF.W....KMG...ELEKAQLSFQIAL.EH.......................................................
FBpp0077738  FF.C....SIE...QFQKAVHLLAKTR.HLeralgicsekgvpvteelsemltpekgefe.........................
FBpp0077934  CL.L....YAG...KLKDAINLYERAI.NL.......................................................
FBpp0292775  FF.C....SIE...QFQKAVHLLAKTR.HLeralgicsekgvpvteelsemltpekgefe.........................
FBpp0087646  IN.M....NSEne.NLPLAQHCFIQAV.VL.......................................................
FBpp0292906  AY.F....KLR...CFKWAIKSFQELL.YL.......................................................
FBpp0079664  AY.F....KLR...CFKWAIKSFQELL.YL.......................................................
FBpp0086749  FM.T....SQC...KITRTRHVFDRAL.RA.......................................................
FBpp0082652  AK.I....KKR...DFKLALFDLDYVIfNL.......................................................
FBpp0077619  IS.Y....ELG...NYNKCIEALSFPF.AG.......................................................
FBpp0086164  CL.R....QLN...RTNEAIQSYEKVV.QL.......................................................
FBpp0297722  CL.R....QLN...RTNEAIQSYEKVV.QL.......................................................
FBpp0087232  TL.Y....HMQ...KYQECLIDIKRAL.DL.......................................................
FBpp0072561  MY.I....YRG...DTENAAQCFEKVL.KI.......................................................
FBpp0072562  MY.I....YRG...DTENAAQCFEKVL.KI.......................................................
FBpp0088148  AH.A....SLG...GLERSLSYARHSL.YN.......................................................
FBpp0088149  AH.A....SLG...GLERSLSYARHSL.YN.......................................................
FBpp0075786  CK.R....KLN...ELDASIDLATQAI.AQ.......................................................
FBpp0075788  CK.R....KLN...ELDASIDLATQAI.AQ.......................................................
FBpp0306229  CK.R....KLN...ELDASIDLATQAI.AQ.......................................................
FBpp0075787  CK.R....KLN...ELDASIDLATQAI.AQ.......................................................
FBpp0075789  CK.R....KLN...ELDASIDLATQAI.AQ.......................................................
FBpp0301715  CK.R....KLN...ELDASIDLATQAI.AQ.......................................................
FBpp0301716  CK.R....KLN...ELDASIDLATQAI.AQ.......................................................
FBpp0306230  CK.R....KLN...ELDASIDLATQAI.AQ.......................................................
FBpp0075785  CK.R....KLN...ELDASIDLATQAI.AQ.......................................................
FBpp0083319  CL.V....QLS...KFEEAYKFIEK--.--.......................................................
FBpp0076498  VL.L....KLS...HYQSSLADIENAL.RT.......................................................
FBpp0293529  VL.L....KLS...HYQSSLADIENAL.RT.......................................................
FBpp0290580  SL.Y....QAG...IFADALRVLKQMG.DQedelreqclqlqsailyssedfagaqsllnqr.......................
FBpp0290395  IY.Y....SMG...IYQKAVKMYRMAL.DS.......................................................
FBpp0080720  AY.V....NLE...KYAEARETLLEAM.EL.......................................................
FBpp0086164  LL.V....QQG...NLARARLIYTKAI.KM.......................................................
FBpp0297722  LL.V....QQG...NLARARLIYTKAI.KM.......................................................
FBpp0080741  CS.E....IFE...HVEKATSCYKRAL.RL.......................................................
FBpp0087297  --.R....EEG...NHIEALRHLQKSA.EL.......................................................
FBpp0070720  --.-....---...-------------.--.......................................................
FBpp0089396  --.-....---...-------------.--.......................................................
FBpp0111789  --.-....---...-------------.--.......................................................
FBpp0086683  CF.N....KMR...QSRCVCYVMKELR.LL.......................................................
FBpp0289328  --.-....---...-------------.--.......................................................
FBpp0070667  IL.F....RMG...RLADADLILTAAV.EH.......................................................
FBpp0082624  CF.Y....KLD...YYDMSQEVLDVYL.SQhgdstiainlkacnrfrlfngrvaeqeikniadngtfgadllrhnlvvfrngega
FBpp0081552  CY.T....GDE...QFGKALQQCKEAL.DI.......................................................
FBpp0086749  --.-....---...-------------.--.......................................................
FBpp0087646  LY.L....KID...QPEQAAHALNTVA.HA.......................................................
FBpp0071879  IY.L....EYKcpeKIDKAIEMLVKVV.ES.......................................................
FBpp0080894  LL.F....VKE...MKTEMAQLAHKAV.SI.......................................................
FBpp0305185  LL.F....VKE...MKTEMAQLAHKAV.SI.......................................................
FBpp0112213  --.-....---...----------RAV.KE.......................................................
FBpp0087233  TL.Y....HMQ...KYQECLIDIKRAL.DL.......................................................
FBpp0070906  LY.Q....TMN...RFEEAERMHKKAI.KI.......................................................
FBpp0303990  LY.Q....TMN...RFEEAERMHKKAI.KI.......................................................
FBpp0087646  DL.F....AEG...QVVASRQLALQAQ.KS.......................................................
FBpp0082112  IH.L....RVR...HYAIAAKFFQNAL.NF.......................................................
FBpp0086359  TY.L....MVN...NLQQVEKVAVETL.KL.......................................................
FBpp0293627  TY.L....MVN...NLQQVEKVAVETL.KL.......................................................
FBpp0076526  TY.R....DNG...QFDKALEYLWKEF.EL.......................................................
FBpp0085279  IY.I....KM-...----ASHCVNQLH.EIgs.....................................................
FBpp0074835  --.-....-LE...NPDDARILLSRAV.EC.......................................................
FBpp0303989  LYnY....QMK...KYRDAEQLYMRSI.DIslrlfgns...............................................
FBpp0078887  DL.Y....LAG...KDDKAARLFEHAL.AL.......................................................
FBpp0290580  AH.F....QKK...QRAQALDYTSEIV.ERgmrnhpelgigaqmdipdggarsvgnpitma........................
FBpp0085047  HL.M....NNS...RWYAAEQWISASI.EAydqkssqtdmellr.........................................
FBpp0296980  AH.W....ALN...QLDQAIGYMQQDL.AV.......................................................
FBpp0300832  AH.W....ALN...QLDQAIGYMQQDL.AV.......................................................
FBpp0086380  IL.H....ALG...EYELSLRFIEHAL.KL.......................................................
FBpp0083435  CL.L....QEK...RYEHVIYHTQFVE.TE.......................................................
FBpp0078891  VA.L....AQGte.QMQDAFHIYQEFC.EK.......................................................
FBpp0082419  --.-....---...-------------.--.......................................................
FBpp0082420  --.-....---...-------------.--.......................................................
FBpp0306145  --.-....---...-------------.--.......................................................
FBpp0303989  AY.YvheySTG...DFSCAQDHVDKAV.NImqhlvpsnhlmlasakrvkallleeialdkmadgideedlllqseelhnfallls
FBpp0305372  IL.H....ALG...EYELSLRFIEHAL.KL.......................................................
FBpp0086749  --.-....---...-------------.--.......................................................
FBpp0078027  SK.R....KNA...QADGALKDSLEAK.RL.......................................................
FBpp0088148  SL.R....KQG...ELGDAQDYCKEAT.KLslisgd.................................................
FBpp0088149  SL.R....KQG...ELGDAQDYCKEAT.KLslisgd.................................................
FBpp0290863  FF.F....TQQ...RYANGLRYFNSAL.DL.......................................................
FBpp0080720  LA.M....ERE...QFKKAEKIFTDVM.KRlfaeghteespkilhisskiahmsqlqgdleksfqgftwtlqqlakllekmpd..
FBpp0083319  --.-....---...--DQVQQLSQKLA.QT.......................................................
FBpp0071288  --.-....---...-------------.--.......................................................
FBpp0081398  IE.F....ENG...ILEAAREDYEKAL.KI.......................................................
FBpp0301016  IE.F....ENG...ILEAAREDYEKAL.KI.......................................................
FBpp0085015  AN.F....ELG...NPKKAARLLSQIL.ES.......................................................
FBpp0084188  LY.M....KVQ...EYPKAIEYLNGYL.RV.......................................................
FBpp0293235  LY.M....KVQ...EYPKAIEYLNGYL.RV.......................................................
FBpp0290580  IS.W....RDD...DFVGAEREFHASA.EF.......................................................
FBpp0085012  --.-....---...-------------.--.......................................................
FBpp0086380  LS.Y....LLG...DAQDALAIQQRAV.IMservngmd...............................................
FBpp0304708  VY.V....KQQ...NWTLALETVEFAL.KS.......................................................
FBpp0305372  LS.Y....LLG...DAQDALAIQQRAV.IMservngmd...............................................
FBpp0304707  VY.V....KQQ...NWTLALETVEFAL.KS.......................................................
FBpp0071879  IA.L....VSG...QYRLAIQTYERCL.KDh......................................................
FBpp0076961  YF.A....RMR...KNTFAQKYFDKCI.TE.......................................................
FBpp0075717  IL.I....RLG...EGEAALNDLKLAI.NF.......................................................
FBpp0080267  VL.F....DCG...LYAESYDDCLCAL.DLgyp....................................................
FBpp0070907  CY.R....QIG...NTDMAIETLLQVP.PTlrsprinlmlarlqhhgsrhgttkkseavlaykevirecpmalqvieallelgvn
FBpp0085033  YL.F....MKN...RPSDAIQWLQEVP.QRlqeelli................................................
FBpp0082507  LH.L....QTDr..NSHQAKAMLRRAV.EL.......................................................
FBpp0077738  --.-....-LN...KLLQSIGHLDEAV.EL.......................................................
FBpp0292775  --.-....-LN...KLLQSIGHLDEAV.EL.......................................................
FBpp0085676  SK.R....KAA...QMLGALDDSRAAA.KL.......................................................
FBpp0087091  VL.F....EWK...RYRQCLDNIKLAR.Q-.......................................................
FBpp0082624  AK.C....ATG...YYKEAEELLMQIS.DM.......................................................
FBpp0070908  --.-....---...-------------.-Vmhaatvpdhfdwlskwikalaqmfnfkhsdasqtflmlh................
FBpp0070431  --.I....EVG...KWSDALDYGQRLL.PG.......................................................
FBpp0075443  CL.L....ELG...KFEGCLADAYKVL.TL.......................................................
FBpp0305287  CL.L....ELG...KFEGCLADAYKVL.TL.......................................................
FBpp0305288  CL.L....ELG...KFEGCLADAYKVL.TL.......................................................
FBpp0070906  FL.L....NVD...SVFQSVNIYKEAL.AV.......................................................
FBpp0303990  FL.L....NVD...SVFQSVNIYKEAL.AV.......................................................
FBpp0073018  LH.A....TFG...HRDEALAALRESI.ML.......................................................
FBpp0078634  MY.G....HLG...EPEKSAKCCHRTL.HR.......................................................
FBpp0087626  AL.Q....EYG...YYREAYDDCSNAL.ECg......................................................
FBpp0075754  VH.S....LLG...DYYQAIKVLEPIE.IH.......................................................
FBpp0087625  AL.Q....EYG...YYREAYDDCSNAL.ECg......................................................
FBpp0071288  FS.R....K-S...NPVEVAGIYEKML.LY.......................................................
FBpp0085046  HL.M....NQS...RWTIAEQWILAGI.KAqdrkgpqtemillr.........................................
FBpp0110159  HL.M....NQS...RWTIAEQWILAGI.KAqdrkgpqtemillr.........................................
FBpp0072679  HF.A....NLR...SWESAREYYEKSH.YL.......................................................
FBpp0306202  HF.A....NLR...SWESAREYYEKSH.YL.......................................................
FBpp0082624  CN.F....HLG...DYQQALAQYKAIQ.QG.......................................................
FBpp0084254  CY.L....RLK...NITQ-LPDAQRRL.DIcergfvksygeqfirlfsikgps................................
FBpp0085032  TL.L....KLN...QHADALKVVNIAL.TD.......................................................


                                                                                       100       110
                                                                                         |         |
d1kt1a1        ...................................................DSAN.................EKGLYRRGEAQLL
FBpp0112456  ...................................................PDIDp................TLVYVQYMKFARR
FBpp0297503  ...................................................PDIDp................TLVYVQYMKFARR
FBpp0112455  ...................................................PDIDp................TLVYVQYMKFARR
FBpp0297502  ...................................................PDIDp................TLVYVQYMKFARR
FBpp0070352  ...................................................DPQN.................AKTWNRLGASLAN
FBpp0070351  ...................................................DPQN.................AKTWNRLGASLAN
FBpp0070402  ...................................................MPRV.................NQFWYKYTYMEEM
FBpp0080138  ...................................................NPAI.................GMAQNQLGTLHYG
FBpp0080139  ...................................................NPAI.................GMAQNQLGTLHYG
FBpp0301685  ...................................................----.................-------------
FBpp0074609  ...................................................SLESsllkys...........AKEYFFRAALCHL
FBpp0084171  ...................................................VPGN.................GAPFNQLAVISIY
FBpp0085420  ...................................................QPTF.................ADAYSNMGNTLKE
FBpp0085421  ...................................................QPTF.................ADAYSNMGNTLKE
FBpp0085422  ...................................................QPTF.................ADAYSNMGNTLKE
FBpp0085420  ...................................................DPNF.................LDAYINLGNVLKE
FBpp0085421  ...................................................DPNF.................LDAYINLGNVLKE
FBpp0085422  ...................................................DPNF.................LDAYINLGNVLKE
FBpp0077790  ...................................................GRESradfkli..........AKSFARIGNTYRK
FBpp0082545  ...................................................YPAF.................PAAWMNLGIVQSA
FBpp0084693  ...................................................TKNKgia..............GSLAIKYARFLNK
FBpp0084691  ...................................................TKNKgia..............GSLAIKYARFLNK
FBpp0084692  ...................................................TKNKgia..............GSLAIKYARFLNK
FBpp0084694  ...................................................TKNKgia..............GSLAIKYARFLNK
FBpp0112211  ...................................................TKNKgia..............GSLAIKYARFLNK
FBpp0072096  ...................................................----.................-----------TE
FBpp0071560  ...................................................DDQN.................EKVYFNLGMLAMD
FBpp0071561  ...................................................DDQN.................EKVYFNLGMLAMD
FBpp0077790  ...................................................DEKF.................IKGYIRKGKILQG
FBpp0076600  ...................................................NPQN.................SVILVHIGAMQFY
FBpp0305561  ...................................................NPQN.................SVILVHIGAMQFY
FBpp0271716  ...................................................ESND.................-------------
FBpp0077790  ...................................................NPTW.................PKGYSRKGAAAAG
FBpp0271718  ...................................................ESND.................-------------
FBpp0290895  ...................................................APQD.................YTLQSCVADALRL
FBpp0290896  ...................................................APQD.................YTLQSCVADALRL
FBpp0081673  ...................................................AKETdklse............VEDYANRACCLYQ
FBpp0293601  ...................................................RPNL.................AVAYLNLGISFIA
FBpp0077614  ...................................................RPNL.................AVAYLNLGISFIA
FBpp0084692  ...................................................YPYC.................YGYWRKYADYEKR
FBpp0084694  ...................................................YPYC.................YGYWRKYADYEKR
FBpp0112211  ...................................................YPYC.................YGYWRKYADYEKR
FBpp0084691  ...................................................YPYC.................YGYWRKYADYEKR
FBpp0084693  ...................................................YPYC.................YGYWRKYADYEKR
FBpp0296980  ...................................................CPQW.................PKAYFRQGVALQC
FBpp0300832  ...................................................CPQW.................PKAYFRQGVALQC
FBpp0080535  ...................................................NNNY.................SKAYCRLGVAYSN
FBpp0296963  ...................................................NNNY.................SKAYCRLGVAYSN
FBpp0296980  ...................................................AQELgdvaae...........GKACHLLGYAHFS
FBpp0300832  ...................................................AQELgdvaae...........GKACHLLGYAHFS
FBpp0072164  ...................................................DKLC.................VKAYYRRMQANES
FBpp0084016  ...................................................LPNQeh...............IPCIVSFAKLYAK
FBpp0296980  ...................................................ARKLhdqvee...........ARAYSNLGSAHHQ
FBpp0300832  ...................................................ARKLhdqvee...........ARAYSNLGSAHHQ
FBpp0296980  ...................................................AQGLqdrale...........SDAMCALGQVQQR
FBpp0300832  ...................................................AQGLqdrale...........SDAMCALGQVQQR
FBpp0080894  ...................................................NKRD.................YRAWYGLGQAYEI
FBpp0305185  ...................................................NKRD.................YRAWYGLGQAYEI
FBpp0081606  ...................................................DPAY.................LKGYYRRAAAHMS
FBpp0081607  ...................................................DPAY.................LKGYYRRAAAHMS
FBpp0304082  ...................................................DPAY.................LKGYYRRAAAHMS
FBpp0084559  ...................................................AVELgereve...........AQSCYSLGNTYTL
FBpp0075683  ...................................................DPNV.................AKTKNNLAGCYLK
FBpp0303945  ...................................................DPNV.................AKTKNNLAGCYLK
FBpp0303946  ...................................................DPNV.................AKTKNNLAGCYLK
FBpp0081284  ...................................................APGD.................PKALFRRAQAYEA
FBpp0079468  ...................................................DKNN.................VKALYRRGQCNLT
FBpp0087297  ...................................................SPLN.................YNALYNLSLIYIA
FBpp0074835  ...................................................CEHD.................PHVLLAVSKLFWS
FBpp0079893  ...................................................APTNp................ALIVHQAIMVLQW
FBpp0079894  ...................................................APTNp................ALIVHQAIMVLQW
FBpp0079895  ...................................................APTNp................ALIVHQAIMVLQW
FBpp0082765  ...................................................WPEY.................VRVLLRRAKLYEQ
FBpp0079617  ...................................................DGNL.................LKGHFFLGQGLME
FBpp0084440  ...................................................DPMN.................IKAHLRMAEAHNA
FBpp0305670  ...................................................DPGF.................EKAYVRVAKCCLA
FBpp0080423  ...................................................DPGF.................EKAYVRVAKCCLA
FBpp0305671  ...................................................DPGF.................EKAYVRVAKCCLA
FBpp0080424  ...................................................DPGF.................EKAYVRVAKCCLA
FBpp0305672  ...................................................DPGF.................EKAYVRVAKCCLA
FBpp0085344  ...................................................NPNH.................TEALRALGEAHLV
FBpp0081552  ...................................................KPDF.................MAARIQRGVVHMK
FBpp0297109  ...................................................NPNH.................TEALRALGEAHLV
FBpp0087646  ...................................................DSRC.................ISYWESLGDAYAG
FBpp0083769  ..........................dgaatifqctvdivkqraksnneeiSSRW.................EPLFINLGHSLRK
FBpp0070572  ...................................................NSDL.................AAGYKFRGRARRL
FBpp0070573  ...................................................NSDL.................AAGYKFRGRARRL
FBpp0070575  ...................................................NSDL.................AAGYKFRGRARRL
FBpp0305905  ...................................................NSDL.................AAGYKFRGRARRL
FBpp0074835  ...................................................NPNS.................EDIWLAAVKLESE
FBpp0305670  ...................................................NSQY.................LKALLLRARCYND
FBpp0080424  ...................................................NSQY.................LKALLLRARCYND
FBpp0305672  ...................................................NSQY.................LKALLLRARCYND
FBpp0080423  ...................................................NSQY.................LKALLLRARCYND
FBpp0305671  ...................................................NSQY.................LKALLLRARCYND
FBpp0076113  ...................................................DPKC.................SKAFYRRAQAQRG
FBpp0076114  ...................................................DPKC.................SKAFYRRAQAQRG
FBpp0076115  ...................................................DPKC.................SKAFYRRAQAQRG
FBpp0305988  ...................................................DPKC.................SKAFYRRAQAQRG
FBpp0072561  ...................................................TADF.................CDVWLNIAHVYVE
FBpp0072562  ...................................................TADF.................CDVWLNIAHVYVE
FBpp0072561  ....................................kdyqkvhhlalhafhNTENeamr.............AESCYQLARSFHA
FBpp0072562  ....................................kdyqkvhhlalhafhNTENeamr.............AESCYQLARSFHA
FBpp0085923  ...................................................DPSY.................VKAHFRLARALLE
FBpp0293601  ...................................................APND.................YTLVVAAATAMRL
FBpp0079893  ...................................................NPRY.................AKAYYRRARAHEA
FBpp0079894  ...................................................NPRY.................AKAYYRRARAHEA
FBpp0079895  ...................................................NPRY.................AKAYYRRARAHEA
FBpp0075683  ...................................................HPAV.................AATLNNLAVLYGK
FBpp0303945  ...................................................HPAV.................AATLNNLAVLYGK
FBpp0303946  ...................................................HPAV.................AATLNNLAVLYGK
FBpp0077614  ...................................................APND.................YTLVVAAATAMRL
FBpp0085409  ...................................................ESND.................-------------
FBpp0271717  ...................................................ESND.................-------------
FBpp0271719  ...................................................ESND.................-------------
FBpp0086749  ...................................................W--Pnvydi............WNSYLTKFLERYG
FBpp0073411  ...................................................DPRN.................VKALFRRAKAHAG
FBpp0070907  ...................................................EPRN.................HEALILRGRLLIA
FBpp0303439  ...................................................DPRN.................VKALFRRAKAHAG
FBpp0070908  ...................................................EPRN.................HEALILRGRLLIA
FBpp0085842  ...................................................QPNN.................SKALYRKGRILEG
FBpp0300561  ...................................................DKNN.................IRAIYQKAESLYY
FBpp0077718  ...................................................ATQPgqk..............SDIWYNLSFVAVT
FBpp0296980  ...................................................RQELgdlsge...........CRAHGHLGAVHMA
FBpp0300832  ...................................................RQELgdlsge...........CRAHGHLGAVHMA
FBpp0076600  ...................................................DAKNcdelqrdfgdla.....CFAYQLMAQICMR
FBpp0305561  ...................................................DAKNcdelqrdfgdla.....CFAYQLMAQICMR
FBpp0071712  ...................................................DKNN.................IRAIYQKAESLYY
FBpp0086749  ...................................................VEDL.................AAVWCEWAEMELR
FBpp0085479  ...................................................KPDY.................TKARWRSAQCAYE
FBpp0112016  ...................................................DKNN.................IRAIYQKAESLYY
FBpp0292906  ...................................................SEGN.................ADTWCSIGVLYQQ
FBpp0305602  ...................................................SEGN.................ADTWCSIGVLYQQ
FBpp0079665  ...................................................SEGN.................ADTWCSIGVLYQQ
FBpp0079666  ...................................................SEGN.................ADTWCSIGVLYQQ
FBpp0079664  ...................................................SEGN.................ADTWCSIGVLYQQ
FBpp0084076  ...................................................QESN.................LRAWLYQAHAYKG
FBpp0111406  ...................................................DEKN.................LRAWMYRAMAYKG
FBpp0074918  ...................................................EPNG.................FESWNNLAKALIK
FBpp0082818  ...................................................NPHS.................HLIHQRLAEIRYT
FBpp0074480  ...................................................EKDN.................LQILKDLSLLQIQ
FBpp0082819  ...................................................NPHS.................HLIHQRLAEIRYT
FBpp0292061  ...................................................NKYHvnarkym..........GETLVALGRSYEE
FBpp0085279  ...................................................SDID.................SRLFEKVGSLYEQ
FBpp0081805  ...................................................NKYHvnarkym..........GETLVALGRSYEE
FBpp0100021  ...................................................YDDNvspevlkiklwny....PNLLESLVEANKG
FBpp0100023  ...................................................YDDNvspevlkiklwny....PNLLESLVEANKG
FBpp0074877  ...................................................YDDNvspevlkiklwny....PNLLESLVEANKG
FBpp0071879  ...................................................NPKN.................LWAANGIGAVLSS
FBpp0084559  ...................................................ARQLgdrlse...........GRALYNLGNVYHA
FBpp0075591  ...................................................ANDQqtrtk............CHAHCQRGVLYRK
FBpp0076526  ...................................................SKTHelwdlt...........HLCYISMSLLYIC
FBpp0079851  ...................................................RRKN.................FIANYGMGLTLYH
FBpp0290395  ...................................................NMSD.................IGIASSIGSYYIK
FBpp0072146  ...................................................TMGNps...............CKALFQEGRALAA
FBpp0296980  ...................................................AQTTgkseee...........AKIRHQLGLALRS
FBpp0300832  ...................................................AQTTgkseee...........AKIRHQLGLALRS
FBpp0083238  ...................................................KPTD.................DSTLQVLSFCYRE
FBpp0111383  ...................................................DEHY.................LRAWLYRAAAYKR
FBpp0080424  ...................................................DTTS.................ADAIYVRGLCLYY
FBpp0305672  ...................................................DTTS.................ADAIYVRGLCLYY
FBpp0305670  ...................................................DTTS.................ADAIYVRGLCLYY
FBpp0071560  ...................................................QTDD.................IGAHINVGRTFNN
FBpp0071561  ...................................................QTDD.................IGAHINVGRTFNN
FBpp0080423  ...................................................DTTS.................ADAIYVRGLCLYY
FBpp0305671  ...................................................DTTS.................ADAIYVRGLCLYY
FBpp0071879  ...................................................NGQC.................LNAALALALVKFE
FBpp0077738  ...................................................EATR.................VHILVQLGEFLQQ
FBpp0077934  ...................................................NPQKsln..............ESLLVNLSTLYEL
FBpp0292775  ...................................................EATR.................VHILVQLGEFLQQ
FBpp0087646  ...................................................EKKC.................YTAWTNLGVLYIK
FBpp0292906  ...................................................SPNFtca..............NEVHLRLGLMLKH
FBpp0079664  ...................................................SPNFtca..............NEVHLRLGLMLKH
FBpp0086749  ...................................................LPITqh...............GRIWPLYLQFVRR
FBpp0082652  ...................................................DPIH.................LRAWLYRAGALAR
FBpp0077619  ...................................................QLLS.................IVANYMIGKSYYK
FBpp0086164  ...................................................APFC.................YDARFTLSALLKQ
FBpp0297722  ...................................................APFC.................YDARFTLSALLKQ
FBpp0087232  ...................................................SYSKdli..............YKLYERQARCYMA
FBpp0072561  ...................................................QPGN.................YETMKILGSLYAH
FBpp0072562  ...................................................QPGN.................YETMKILGSLYAH
FBpp0088148  ...................................................ECGTkcrs.............GLVHLTVARVYLE
FBpp0088149  ...................................................ECGTkcrs.............GLVHLTVARVYLE
FBpp0075786  ...................................................KPHS.................YEGYYARAKARME
FBpp0075788  ...................................................KPHS.................YEGYYARAKARME
FBpp0306229  ...................................................KPHS.................YEGYYARAKARME
FBpp0075787  ...................................................KPHS.................YEGYYARAKARME
FBpp0075789  ...................................................KPHS.................YEGYYARAKARME
FBpp0301715  ...................................................KPHS.................YEGYYARAKARME
FBpp0301716  ...................................................KPHS.................YEGYYARAKARME
FBpp0306230  ...................................................KPHS.................YEGYYARAKARME
FBpp0075785  ...................................................KPHS.................YEGYYARAKARME
FBpp0083319  ...................................................-NRL.................SSLFFEKAYCEYQ
FBpp0076498  ...................................................RCTS.................PKAHYLRALALSG
FBpp0293529  ...................................................RCTS.................PKAHYLRALALSG
FBpp0290580  ...................................................AGGT.................ADTLNDEGCLLFQ
FBpp0290395  ...................................................VPKSlsqlr............LKIRENIGILFIR
FBpp0080720  ...................................................TKELkdatqe...........GILQANLGLVYLR
FBpp0086164  ...................................................LPKV.................YQLRLRKAQLLQK
FBpp0297722  ...................................................LPKV.................YQLRLRKAQLLQK
FBpp0080741  ...................................................SRLYthrdle...........AEILLHLGKIFAK
FBpp0087297  ...................................................NPRN.................IETYKEIGRTLYI
FBpp0070720  ...................................................----.................-------------
FBpp0089396  ...................................................----.................-------------
FBpp0111789  ...................................................----.................-------------
FBpp0086683  ...................................................TINNps...............ALALCQHGRALSD
FBpp0289328  ...................................................----.................-------------
FBpp0070667  ...................................................APNV.................AENHVVLASALAM
FBpp0082624  ................................................lrvLPGLlnii.............PEARLNLAIYYLK
FBpp0081552  ...................................................MKD-.................AQVYCDRADALLG
FBpp0086749  ...................................................----.................-------------
FBpp0087646  ...................................................T---.................FKPIIGLAQAYYL
FBpp0071879  ...................................................ASYHqn...............TNSWLNLAFAYEQ
FBpp0080894  ...................................................NKYR.................PETCCVIGNYYSI
FBpp0305185  ...................................................NKYR.................PETCCVIGNYYSI
FBpp0112213  ...................................................DSTD.................FTGWTYLLQYVDN
FBpp0087233  ...................................................SYSKdli..............YKLYERQARCYMA
FBpp0070906  ...................................................KSELlghfdyevg........LSIGHLASLYNYQ
FBpp0303990  ...................................................KSELlghfdyevg........LSIGHLASLYNYQ
FBpp0087646  ...................................................QPAY.................KVTLELLARIHME
FBpp0082112  ...................................................DQQLarnlrqstlqtmssarsCEILYNLGVAMLH
FBpp0086359  ...................................................WPNN.................AVAQLHYGLALRQ
FBpp0293627  ...................................................WPNN.................AVAQLHYGLALRQ
FBpp0076526  ...................................................NQDApsea.............FT-----------
FBpp0085279  ...................................................LKNN.................APGLINAGIVELG
FBpp0074835  ...................................................CNTS.................VELWLA----LAR
FBpp0303989  ...................................................YSGL.................EYDYLGLCHVYET
FBpp0078887  ...................................................APRH.................PEVLLRYGEFLEH
FBpp0290580  ...................................................ISGI.................TQALNLKAAIEFQ
FBpp0085047  ...................................................GPKL.................ADLCRILGQVQMK
FBpp0296980  ...................................................AKSLgdtage...........CRAHGNLGSAYFS
FBpp0300832  ...................................................AKSLgdtage...........CRAHGNLGSAYFS
FBpp0086380  ...................................................NLKYfgdkdmhv.........ALSYHLMARTQSC
FBpp0083435  ...................................................ESPS.................EKSIYRRALAYYH
FBpp0078891  ...................................................FKPT.................PALLNGQAVVHLG
FBpp0082419  ...................................................----.................-----------VM
FBpp0082420  ...................................................----.................-----------VM
FBpp0306145  ...................................................----.................-----------VM
FBpp0303989  ............................................lqvfgevNVQT.................AKHYGNLGRLYQT
FBpp0305372  ...................................................NLKYfgdkdmhv.........ALSYHLMARTQSC
FBpp0086749  ...................................................----.................-------------
FBpp0078027  ...................................................LKNLqryd.............APINLEVCDALYE
FBpp0088148  ...................................................QATY.................TRSIRVMGDIYRN
FBpp0088149  ...................................................QATY.................TRSIRVMGDIYRN
FBpp0290863  ...................................................NPFN.................ERALMRRSQLKRS
FBpp0080720  ...................................................D-KDilely............GLTKNWFGQLLMK
FBpp0083319  ...................................................YPQVe................FEALLIRCTQLAK
FBpp0071288  ...................................................----.................-------------
FBpp0081398  ...................................................HGELptrnrral.........AELHYKIGLTYLM
FBpp0301016  ...................................................HGELptrnrral.........AELHYKIGLTYLM
FBpp0085015  ...................................................QPTH.................-------------
FBpp0084188  ...................................................RDD-.................AVGHNMIATCYSR
FBpp0293235  ...................................................RDD-.................AVGHNMIATCYSR
FBpp0290580  ...................................................CSEN.................SIWRLNAGHVLFM
FBpp0085012  ...................................................---Nhtqsftk..........ADILEYLAFSTYK
FBpp0086380  ...................................................HPST.................ILEYTHLSLYSFA
FBpp0304708  ...................................................NPRN.................AQ-----------
FBpp0305372  ...................................................HPST.................ILEYTHLSLYSFA
FBpp0304707  ...................................................NPRN.................AQ-----------
FBpp0071879  ...................................................LPKNr................VDVMHCLAKALYD
FBpp0076961  ...................................................NESTd................HKALYLRSKFKRS
FBpp0075717  ...................................................GLELkss..............VDYYLKMAKAYAV
FBpp0080267  ...................................................EEYL.................PLIKLRQAACALK
FBpp0070907  gneinslvmhaatvpdhfdwlskwikalaqmfnfkhsdasqtflmlhdnttLRCN.................EHLMMALGKCLYY
FBpp0085033  ...................................................QPRHlpike............VDALRLLAEAQIK
FBpp0082507  ...................................................SQNNvywh.............CKLLLQLAQIHAS
FBpp0077738  ...................................................AEAEdrihl............KHTYYQKAQELRE
FBpp0292775  ...................................................AEAEdrihl............KHTYYQKAQELRE
FBpp0085676  ...................................................ARSKdgeek............AIINLDICDVLYE
FBpp0087091  ...................................................----.................-------------
FBpp0082624  ...................................................DIKNq................HTYCMILAKCHIH
FBpp0070908  ...................................................DNTTlrcn.............EHLMMALGKCLYY
FBpp0070431  ...................................................FRKYhgpwnpll.........GLLHMKLGKIQLY
FBpp0075443  ...................................................LSEQteclasv..........SRARRWLVHALFK
FBpp0305287  ...................................................LSEQteclasv..........SRARRWLVHALFK
FBpp0305288  ...................................................LSEQteclasv..........SRARRWLVHALFK
FBpp0070906  ...................................................RRGIfgnmnfhv.........AIAHEDLSYAYYV
FBpp0303990  ...................................................RRGIfgnmnfhv.........AIAHEDLSYAYYV
FBpp0073018  ...................................................AQEHg................DKRSLNLANTWY-
FBpp0078634  ...................................................QLESktydpidf.........ALNTATLSQFYIG
FBpp0087626  ...................................................Y-PErlr..............HKVIMRQAFCAWK
FBpp0075754  ...................................................KKSAyshipacq.........ISTSYYVGFAYMM
FBpp0087625  ...................................................Y-PErlr..............HKVIMRQAFCAWK
FBpp0071288  ...................................................HGDS.................PDLWVDAALWLYE
FBpp0085046  ...................................................GPTK.................AELFRTLGKVRFE
FBpp0110159  ...................................................GPTK.................AELFRTLGKVRFE
FBpp0072679  ...................................................E---.................-----GYMEALYH
FBpp0306202  ...................................................E---.................-----GYMEALYH
FBpp0082624  ...................................................SSTPd................GKLDLNLAVCMFY
FBpp0084254  ...................................................SPERali..............MRLHLLQGVLLFH
FBpp0085032  ...................................................NPHD.................IKLLLK-------


                                             120                  130                140       150  
                                               |                    |                  |         |  
d1kt1a1        M....................N...EFESAKGDFEKVLEV...........NPQN.........KAARLQIFMCQKKAKEHNERD
FBpp0112456  A....................E...GIKSARSIFKKARED...........VRSR.........YHIFVAA--------------
FBpp0297503  A....................E...GIKSARSIFKKARED...........VRSR.........YHIFVAA--------------
FBpp0112455  A....................E...GIKSARSIFKKARED...........VRSR.........YHIFVAAALM-----------
FBpp0297502  A....................E...GIKSARSIFKKARED...........VRSR.........YHIFVAAALM-----------
FBpp0070352  G....................S...RSVEAVEAYQQALQL...........QPGF.........IRVRYNVGVCCMNLKAYKEAV
FBpp0070351  G....................S...RSVEAVEAYQQALQL...........QPGF.........IRVRYNVGVCCMNLKAYKEAV
FBpp0070402  L....................E...NVAGARQVFERWMEW...........QPE-.........EQAWQTYVNFELRYKEIDRAR
FBpp0080138  Q....................N...H--------------...........----.........---------------------
FBpp0080139  Q....................N...H--------------...........----.........---------------------
FBpp0301685  -....................-...--------YESLVNV...........FPTT.........ARYWKLYIEMEMRSRYYERVE
FBpp0074609  S....................V...DLLNAQHAIEKYAQQ...........YPAF.........---------------------
FBpp0084171  H....................H...KRFDAVYYYVRSLLT...........SNSI.........QSAKESLL-------------
FBpp0085420  L....................Q...DVSGALQCYTRAIQI...........NPAF.........ADAHSNLASIHKDSGNIPEAI
FBpp0085421  L....................Q...DVSGALQCYTRAIQI...........NPAF.........ADAHSNLASIHKDSGNIPEAI
FBpp0085422  L....................Q...DVSGALQCYTRAIQI...........NPAF.........ADAHSNLASIHKDSGNIPEAI
FBpp0085420  A....................R...IFDRAVAAYLRALNL...........SPNN.........AVVHGNLACVYYEQGLIDLAI
FBpp0085421  A....................R...IFDRAVAAYLRALNL...........SPNN.........AVVHGNLACVYYEQGLIDLAI
FBpp0085422  A....................R...IFDRAVAAYLRALNL...........SPNN.........AVVHGNLACVYYEQGLIDLAI
FBpp0077790  L....................E...NYKQAKVYYEKAMSE...........HRT-.........PEIKTSLSEVE----------
FBpp0082545  Q....................G...KYDKALASYEKALKY...........RANF.........AVCYYNMGNLYLEQKRYAEAL
FBpp0084693  Ic...................H...DLDAGLAALQQALER...........DPAN.........TRVALQMIDLCLQRPKVDE--
FBpp0084691  Ic...................H...DLDAGLAALQQALER...........DPAN.........TRVALQMIDLCLQRPKVDE--
FBpp0084692  Ic...................H...DLDAGLAALQQALER...........DPAN.........TRVALQMIDLCLQRPKVDE--
FBpp0084694  Ic...................H...DLDAGLAALQQALER...........DPAN.........TRVALQMIDLCLQRPKVDE--
FBpp0112211  Ic...................H...DLDAGLAALQQALER...........DPAN.........TRVALQMIDLCLQRPKVDE--
FBpp0072096  S....................K...HPDMALRFYQHALEVimieds.....VRQA.........AEYASKVSRILVKLRRYDEAT
FBpp0071560  E....................S...SFDEAEQFFKRAIHL...........KADF.........RSALFNLALLLADTKRPLDAV
FBpp0071561  E....................S...SFDEAEQFFKRAIHL...........KADF.........RSALFNLALLLADTKRPLDAV
FBpp0077790  M....................Q...QQSKAQAAYQKALEL...........DPNN.........AEAIEGYRQC-----------
FBpp0076600  M....................K...KKDLSLQTLNTAATL...........DPKN.........PLTRFHRGSIYFSLGKYQEAL
FBpp0305561  M....................K...KKDLSLQTLNTAATL...........DPKN.........PLTRFHRGSIYFSLGKYQEAL
FBpp0271716  -....................-...---------------...........----.........---------------------
FBpp0077790  L....................N...DFMKAFEAYNEGLKY...........DPTN.........AILLQGR--------------
FBpp0271718  -....................-...---------------...........----.........---------------------
FBpp0290895  L....................N...RLAEAELWYRKAVTL...........QPMA.........AHAHANLGAILQMRGLRKEAV
FBpp0290896  L....................N...RLAEAELWYRKAVTL...........QPMA.........AHAHANLGAILQMRGLRKEAV
FBpp0081673  QhgspeaaaaaldkaakmtesK...HPDLALGFYKRALAVvlig.......DSTHqa.......SEFASKVSRILVRLKKYEEAT
FBpp0293601  L....................G...KRQQAIEILQAGSNLdgaavrdrtahDQAR.........SSAYLQLGALYVEQGKLQRAL
FBpp0077614  L....................G...KRQQAIEILQAGSNLdgaavrdrtahDQAR.........SSAYLQLGALYVEQGKLQRAL
FBpp0084692  K....................G...IKANCYKVFERGLEA...........IPLS.........VDLWIHY--------------
FBpp0084694  K....................G...IKANCYKVFERGLEA...........IPLS.........VDLWIHY--------------
FBpp0112211  K....................G...IKANCYKVFERGLEA...........IPLS.........VDLWIHY--------------
FBpp0084691  K....................G...IKANCYKVFERGLEA...........IPLS.........VDLWIHY--------------
FBpp0084693  K....................G...IKANCYKVFERGLEA...........IPLS.........VDLWIHY--------------
FBpp0296980  L....................G...RYGEALAAFASGLAQ...........EPSN.........KQLMAGLV-------------
FBpp0300832  L....................G...RYGEALAAFASGLAQ...........EPSN.........KQLMAGLV-------------
FBpp0080535  M....................G...NFEKAEQAYAKAIEL...........EPDN.........EVYKSNLEAAR----------
FBpp0296963  M....................G...NFEKAEQAYAKAIEL...........EPDN.........EVYKSNLEAAR----------
FBpp0296980  L....................G...NYRAAVRYYDQDLALakdaqh.....RPNM.........GRAYCNLGLAHLALGHTAAAL
FBpp0300832  L....................G...NYRAAVRYYDQDLALakdaqh.....RPNM.........GRAYCNLGLAHLALGHTAAAL
FBpp0072164  L....................G...NNMEALKDCTTVLAI...........EPKN.........IEAKRSLARINDRLRK-----
FBpp0084016  H....................D...NNDMAQTLLDDVVTS...........YPKR.........IDIWSVYVDMLIKAGLIDSAR
FBpp0296980  R....................R...QFTQAAACHEQVLRI...........AQALgdrsme...AAAYAGLGHAARCAGDASAS-
FBpp0300832  R....................R...QFTQAAACHEQVLRI...........AQALgdrsme...AAAYAGLGHAARCAGDASAS-
FBpp0296980  M....................G...QHAQALELHRQDLEI...........CTELsapalq...ARALSNLGSVHESLGQQAEAL
FBpp0300832  M....................G...QHAQALELHRQDLEI...........CTELsapalq...ARALSNLGSVHESLGQQAEAL
FBpp0080894  I....................K...MHYYSLYYFKIAHQL...........RPYD.........SRMLVALGETYEKLDKCENAV
FBpp0305185  I....................K...MHYYSLYYFKIAHQL...........RPYD.........SRMLVALGETYEKLDKCENAV
FBpp0081606  L....................G...KFKQALCDFEFVAKC...........RPND.........KDAKLKFTEC-----------
FBpp0081607  L....................G...KFKQALCDFEFVAKC...........RPND.........KDAKLKFTEC-----------
FBpp0304082  L....................G...KFKQALCDFEFVAKC...........RPND.........KDAKLKFTEC-----------
FBpp0084559  L....................H...EFNTAIEYHNRHLAI...........AQELgdrige...ARACWSLGNAHSAIGGHERAL
FBpp0075683  Q....................G...RYTEAEILYKQVLTR...........----.........---------------------
FBpp0303945  Q....................G...RYTEAEILYKQVLTR...........----.........---------------------
FBpp0303946  Q....................G...RYTEAEILYKQVLTR...........----.........---------------------
FBpp0081284  L....................E...KFEEAYKDATALFKA...........DPGN.........KTVQPMLQRL-----------
FBpp0079468  I....................N...ELEDALEDFQKVIQL...........EPGN.........KAAANQVIICKQKLKESKNKE
FBpp0087297  S....................E...QYASAFHTLAAAINL...........RKDN.........AECYMLLGLCLRKLDDMENAF
FBpp0074835  E....................H...KFSKCRDWFNRTVKI...........DPDL.........GDAWAYF--------------
FBpp0079893  R....................G...DINLAVQLLNKAIEV...........DPKC.........ELAYETLGTVEVQRAQLTRAV
FBpp0079894  R....................G...DINLAVQLLNKAIEV...........DPKC.........ELAYETLGTVEVQRAQLTRAV
FBpp0079895  R....................G...DINLAVQLLNKAIEV...........DPKC.........ELAYETLGTVEVQRAQLTRAV
FBpp0082765  E....................D...KPDEALEDYKKVTEI...........DPGQ.........QEAREAQIRLPPIINERNEKL
FBpp0079617  I....................D...NFDEAIKHLQRAYDL...........SK--.........---------------------
FBpp0084440  E....................G...KHLESLNVYKKLLDF...........EPDN.........AIAKKAVEKLTSMLGE-----
FBpp0305670  L....................G...DI-------------...........----.........---------------------
FBpp0080423  L....................G...DI-------------...........----.........---------------------
FBpp0305671  L....................G...DI-------------...........----.........---------------------
FBpp0080424  L....................G...DI-------------...........----.........---------------------
FBpp0305672  L....................G...DI-------------...........----.........---------------------
FBpp0085344  L....................G...EPRLAEKMLKDAAKL...........DPSC.........PKIWFALGKVMEILGDFHASA
FBpp0081552  S....................G...EYEQAIQDFDQVLQE...........EPNN.........GLVLEHYSRLAPAQE------
FBpp0297109  L....................G...EPRLAEKMLKDAAKL...........DPSC.........PKIWFALGKVMEILGDFHASA
FBpp0087646  R....................G...SYNSAIRVFQKILEL...........SPEN.........NYALLQIASVKTTIRMYTESI
FBpp0083769  V....................H...KYEEALYNFQYALLL...........KPQS.........PTTYTSIGFIHALLGNLDPAI
FBpp0070572  L....................G...DFELAAHDLRQACKL...........D---.........---------------------
FBpp0070573  L....................G...DFELAAHDLRQACKL...........D---.........---------------------
FBpp0070575  L....................G...DFELAAHDLRQACKL...........D---.........---------------------
FBpp0305905  L....................G...DFELAAHDLRQACKL...........D---.........---------------------
FBpp0074835  N....................S...EYERARRLLAKARGS...........APT-.........PRVMMKSARLEWALEKFDEAL
FBpp0305670  L....................E...KFEESVADYETALQL...........EKT-.........PEIKRMLREAKFALK------
FBpp0080424  L....................E...KFEESVADYETALQL...........EKT-.........PEIKRMLREAKFALK------
FBpp0305672  L....................E...KFEESVADYETALQL...........EKT-.........PEIKRMLREAKFALK------
FBpp0080423  L....................E...KFEESVADYETALQL...........EKT-.........PEIKRMLREAKFALK------
FBpp0305671  L....................E...KFEESVADYETALQL...........EKT-.........PEIKRMLREAKFALK------
FBpp0076113  L....................R...NYEEAINDLKTAHNL...........LPEN.........KQILNELNSTKQLLAQYN---
FBpp0076114  L....................R...NYEEAINDLKTAHNL...........LPEN.........KQILNELNSTKQLLAQYN---
FBpp0076115  L....................R...NYEEAINDLKTAHNL...........LPEN.........KQILNELNSTKQLLAQYN---
FBpp0305988  L....................R...NYEEAINDLKTAHNL...........LPEN.........KQILNELNSTKQLLAQYN---
FBpp0072561  Q....................K...QYISAIQMYENCMKKfy.........KHNN.........VEVMQYLARAYLRANKLVDAK
FBpp0072562  Q....................K...QYISAIQMYENCMKKfy.........KHNN.........VEVMQYLARAYLRANKLVDAK
FBpp0072561  Q....................S...DYDQAFQYYYQSTQI...........APANf........VLPHYGLGQMYIYRGDTENAA
FBpp0072562  Q....................S...DYDQAFQYYYQSTQI...........APANf........VLPHYGLGQMYIYRGDTENAA
FBpp0085923  L....................H...RPQDADQCLQALIQR...........FPDF.........AN-------------------
FBpp0293601  L....................D...RKVDAEMWYRKAVAL...........RPGD.........AHAHTNLGAILHLLGRTNHAA
FBpp0079893  T....................K...DMNECLDD-------...........----.........---------------------
FBpp0079894  T....................K...DMNECLDD-------...........----.........---------------------
FBpp0079895  T....................K...DMNECLDD-------...........----.........---------------------
FBpp0075683  R....................G...KYKDAEPLCKRALEI...........----.........---------------------
FBpp0303945  R....................G...KYKDAEPLCKRALEI...........----.........---------------------
FBpp0303946  R....................G...KYKDAEPLCKRALEI...........----.........---------------------
FBpp0077614  L....................D...RKVDAEMWYRKAVAL...........RPGD.........AHAHTNLGAILHLLGRTNHAA
FBpp0085409  -....................-...---------------...........----.........---------------------
FBpp0271717  -....................-...---------------...........----.........---------------------
FBpp0271719  -....................-...---------------...........----.........---------------------
FBpp0086749  G....................T...KLERARDLFEQCLDQ...........CPPE.........HAKYFYL--------------
FBpp0073411  A....................W...NPAQARRDFLDALAL...........D---.........---------------------
FBpp0070907  L....................E...RHTQAVCAFRTAQMV...........APYR.........FEIYRGLFHSYLAQKRFKEAN
FBpp0303439  A....................W...NPAQARRDFLDALAL...........D---.........---------------------
FBpp0070908  L....................E...RHTQAVCAFRTAQMV...........APYR.........FEIYRGLFHSYLAQKRFKEAN
FBpp0085842  K....................A...DTQGAIKLLQKVATL...........EPEN.........RAVQSDLARLFIKARREEHNE
FBpp0300561  L....................G...QFEQSLMFFHRGLRA...........RPEL.........ALFRLG---------------
FBpp0077718  S....................G...DFNLAKRCLQLCLTS...........DAQN.........GAALNNLAVLAAQSGDILGAK
FBpp0296980  L....................C...SWTNAVKCYQEQLER...........AQEQrdaave...AQAHGNLGIARLNMAHYEAAI
FBpp0300832  L....................C...SWTNAVKCYQEQLER...........AQEQrdaave...AQAHGNLGIARLNMAHYEAAI
FBpp0076600  T....................E...RNKLAVSALRRALKL...........NPFM.........WHAFADLCL------------
FBpp0305561  T....................E...RNKLAVSALRRALKL...........NPFM.........WHAFADLCL------------
FBpp0071712  L....................G...QFEQSLMFFHRGLRA...........RPEL.........ALFRLG---------------
FBpp0086749  Q....................Q...QFEAALKLMQRATAM...........----.........---------------------
FBpp0085479  L....................E...RFDLCTQMCEELLEV...........DVDN.........EVA------------------
FBpp0112016  L....................G...QFEQSLMFFHRGLRA...........RPEL.........ALFRLG---------------
FBpp0292906  Q....................N...QPTDALQAYICAVQL...........DKDH.........KAAWTNLGILYESCGQLRDAY
FBpp0305602  Q....................N...QPTDALQAYICAVQL...........DKDH.........KAAWTNLGILYESCGQLRDAY
FBpp0079665  Q....................N...QPTDALQAYICAVQL...........DKDH.........KAAWTNLGILYESCGQLRDAY
FBpp0079666  Q....................N...QPTDALQAYICAVQL...........DKDH.........KAAWTNLGILYESCGQLRDAY
FBpp0079664  Q....................N...QPTDALQAYICAVQL...........DKDH.........KAAWTNLGILYESCGQLRDAY
FBpp0084076  L....................K...QDDKFEESVVKAREH...........NPKQ.........---------------------
FBpp0111406  L....................N...DESNFENCVKYARKF...........N---.........---------------------
FBpp0074918  L....................G...DKQRAHRVLGEALKC...........NYSN.........WKVWENYMLVSVDTSHWDDAM
FBpp0082818  M....................GgveNMESARTYYSQALKL...........NPHN.........LRALYGIYLCCNHLD------
FBpp0074480  M....................R...DLEGYKETRHHLFTL...........RPSQ.........HASWIGFAMSYHLLGDYDMAN
FBpp0082819  M....................GgveNMESARTYYSQALKL...........NPHN.........LRALY----------------
FBpp0292061  E....................N...RIAEAVKAYSDCLNL...........LPLH.........EEARQSL--------------
FBpp0085279  I....................Q...DHQEANQYYNEAYRI...........NMSD.........IGIASSIGSYYIKLQATERAL
FBpp0081805  E....................N...RIAEAVKAYSDCLNL...........LPLH.........EEARQSL--------------
FBpp0100021  L....................G...HYFEAKKYANELLSI...........NPNH.........TYMLTQ---------------
FBpp0100023  L....................G...HYFEAKKYANELLSI...........NPNH.........TYMLTQ---------------
FBpp0074877  L....................G...HYFEAKKYANELLSI...........NPNH.........TYMLT----------------
FBpp0071879  C....................N...NLSAGGAIFKQIIEC...........GNKC.........IPAIINSAHIALVSGQYRLAI
FBpp0084559  K....................G...---------------...........----.........---------------------
FBpp0075591  L....................D...NLEAARADFEAAAQL...........GSK-.........---------------------
FBpp0076526  K....................Kn..DATAALRFCNMALEV...........A---.........---------------------
FBpp0079851  L....................N...RLEEAIPYLSRCTEV...........DIFI.........PDVWGYLATINLRLSRNKTAL
FBpp0290395  L....................Q...ATERALFYYERAVLA...........DPND.........PNLMLRIASCF----------
FBpp0072146  L....................G...EYNLARNAYLQAQAK...........QPAN.........KEISDEIISMNKRISKYEEAS
FBpp0296980  S....................G...DAEGAHIQLETAAQLlesvrheqr..SPET.........RQALYDLQTTCYQ--------
FBpp0300832  S....................G...DAEGAHIQLETAAQLlesvrheqr..SPET.........RQALYDLQTTCYQ--------
FBpp0083238  M....................E...QLDKIVELYQHAVKQ...........NPGN.........EELLAHLFISHVRVEDYKAQQ
FBpp0111383  L....................N...DEPNFEYSVDRARRF...........NRSD.........A--------------------
FBpp0080424  T....................D...NLDKGILHFERALTL...........DPDH.........YKSKQMRSKCK----------
FBpp0305672  T....................D...NLDKGILHFERALTL...........DPDH.........YKSKQMRSKCK----------
FBpp0305670  T....................D...NLDKGILHFERALTL...........DPDH.........YKSKQMRSKCK----------
FBpp0071560  L....................K...RYAEAEQAYVQAKAL...........FPQ-.........---------------------
FBpp0071561  L....................K...RYAEAEQAYVQAKAL...........FPQ-.........---------------------
FBpp0080423  T....................D...NLDKGILHFERALTL...........DPDH.........YKSKQMRSKCK----------
FBpp0305671  T....................D...NLDKGILHFERALTL...........DPDH.........YKSKQMRSKCK----------
FBpp0071879  H....................NdeqSYQDGKMLLTAAYKE...........NNKN.........PDLLSILAGMYYADGNHK---
FBpp0077738  Q....................G...DYHSATKKFTQA---...........----.........---------------------
FBpp0077934  E....................S...NNSKAKKY-------...........----.........---------------------
FBpp0292775  Q....................G...DYHSATKKFTQA---...........----.........---------------------
FBpp0087646  L....................N...EVRLANEAFTRAQQS...........SPVY.........ANAWIGQAMVAELIGDREEAF
FBpp0292906  C....................G...EFHIALKHLQLALLYt..........YPSTfse......LQVKFQIAHLYEVQNKHKAAK
FBpp0079664  C....................G...EFHIALKHLQLALLYt..........YPSTfse......LQVKFQIAHLYEVQNKHKAAK
FBpp0086749  F....................E...MPETALRVYRRYLKL...........FPED.........TEEYVD---YLQEADRLDEA-
FBpp0082652  L....................N...NESE-----------...........----.........---------------------
FBpp0077619  L....................D...LLDLALESFANATHM...........DTHV.........PNVWGFLALINLRLGENYKAI
FBpp0086164  Q....................G...RHEEAVQALEQPGEAeg.........QPLI.........ARLLYERCVMLQQIGRIEE--
FBpp0297722  Q....................G...RHEEAVQALEQPGEAeg.........QPLI.........ARLLYERCVMLQQIGRIEE--
FBpp0087232  L....................K...DYPHTIDSFKKCITA...........MDDS.........TLASDKRAKL-----------
FBpp0072561  S....................NsqtKRDMAKTHLKKVTEQ...........FPED.........IEAWIELAQILEQ--------
FBpp0072562  S....................NsqtKRDMAKTHLKKVTEQ...........FPED.........IEAWIELAQILEQ--------
FBpp0088148  M....................G...GFSRALEGLQGAYKIataig......DPSLe........LQVYVALSELFGRLQDNDKSA
FBpp0088149  M....................G...GFSRALEGLQGAYKIataig......DPSLe........LQVYVALSELFGRLQDNDKSA
FBpp0075786  L....................G...ALNEALVDANEAMQ-...........----.........---------------------
FBpp0075788  L....................G...ALNEALVDANEAMQ-...........----.........---------------------
FBpp0306229  L....................G...ALNEALVDANEAMQ-...........----.........---------------------
FBpp0075787  L....................G...ALNEALVDANEAMQ-...........----.........---------------------
FBpp0075789  L....................G...ALNEALVDANEAMQ-...........----.........---------------------
FBpp0301715  L....................G...ALNEALVDANEAMQ-...........----.........---------------------
FBpp0301716  L....................G...ALNEALVDANEAMQ-...........----.........---------------------
FBpp0306230  L....................G...ALNEALVDANEAMQ-...........----.........---------------------
FBpp0075785  L....................G...ALNEALVDANEAMQ-...........----.........---------------------
FBpp0083319  L....................N...KQQQALKTIDDA-GL...........QPLP.........PNLKELRTQVLYRLERYDECL
FBpp0076498  L....................G...RLEEALYNGFLAICL...........D---.........---------------------
FBpp0293529  L....................G...RLEEALYNGFLAICL...........D---.........---------------------
FBpp0290580  A....................D...QHEAAVQRFQAALQV...........GGFN.........PLVAYNVALAHFQKKQ-----
FBpp0290395  M....................G...SYSDAASSFEFIMTE...........-RAN.........IRSSIHLLLCYFALGDVEKVK
FBpp0080720  E....................G...LMSQAENACRLAWKLgk.........QHQN.........P--------------------
FBpp0086164  M....................G...ETNASMFTYLKMLPL...........MPPDewkmc....LNTAKNVARYFHVLEKHSLAL
FBpp0297722  M....................G...ETNASMFTYLKMLPL...........MPPDewkmc....LNTAKNVARYFHVLEKHSLAL
FBpp0080741  Dt...................Q...MTSIAKKCYEHAKRI...........YVDF.........NDLH-----------------
FBpp0087297  M....................G...RFSQALGVFREAEQRs..........SRQD.........HEIYHYLGELLYR--------
FBpp0070720  -....................-...---------------...........----.........---------------------
FBpp0089396  -....................-...---------------...........----.........---------------------
FBpp0111789  -....................-...---------------...........----.........---------------------
FBpp0086683  L....................G...KYHPSRLCYIKALKK...........RPRD.........QGIKDKITRISKRITELE---
FBpp0289328  -....................-...---------------...........----.........---------------------
FBpp0070667  K....................H...DFNRSLQHFDEAERL...........DPS-.........---------------------
FBpp0082624  Q....................G...DVQEAHALMK---EL...........QPTS.........PHEYILKGVVHAALGQQ----
FBpp0081552  T....................E...MYDDAIHSFQAALDL...........EESN.........TRAKEGIQRAKKLQKQ-----
FBpp0086749  -....................-...------EIYEKAIES...........LPEQnm.......RHMCVKFAELETKLGEVDRAR
FBpp0087646  A....................G...QLQESYSIYNSVLGN...........----.........---------------------
FBpp0071879  K....................R...LWAHGVNAYQKAIDI...........YLSQghqip....IEWLNNLASSQLMAKMPEKAL
FBpp0080894  R....................C...DHQVAISYFQRALKL...........NPKY.........LAAWTLMGH------------
FBpp0305185  R....................C...DHQVAISYFQRALKL...........NPKY.........LAAWTLMGH------------
FBpp0112213  E....................S...DAEAAREAYDTFLSH...........YPYC.........YGYWRKYADYEKRKG------
FBpp0087233  L....................K...DYPHTIDSFKKCITA...........MDDS.........TLASDKRAKL-----------
FBpp0070906  M....................K...KYRDAEQLYMRSIDIslrlfgns...YSGL.........EYDYLGLCHVYETLHNF----
FBpp0303990  M....................K...KYRDAEQLYMRSIDIslrlfgns...YSGL.........EYDYLGLCHVYETLHNF----
FBpp0087646  L....................G...AYKLALQLWQEIGQE...........ND--.........---------------------
FBpp0082112  L....................R...RPKEAFQCFLVPVKQ...........FHSN.........PRLWLRMAEACI---------
FBpp0086359  F....................Ha..DYAKALPYLKYAVESgee........GTQE.........AFFYLSLGETMQRLSMKSEAL
FBpp0293627  F....................Ha..DYAKALPYLKYAVESgee........GTQE.........AFFYLSLGETMQRLSMKSEAL
FBpp0076526  -....................-...---------------...........----.........---------------------
FBpp0085279  S....................H...NLILASERFEGALQL...........QPMN.........FEARYNLGLVALAQNDYELAE
FBpp0074835  L....................E...TYENARKVLNKAREN...........IPTD.........RQIWTTAAKLEEANGNIHMVE
FBpp0303989  L....................H...NFE------------...........----.........---------------------
FBpp0078887  N....................Qr..NIVLADQYYFQALTI...........SPSN.........SEALANRQR------------
FBpp0290580  D....................G...NEEAARDAL------...........----.........---------------------
FBpp0085047  Q....................R...NHEGALQAYQVALKL...........SPHD.........PEIYEEYRILE----------
FBpp0296980  Q....................G...AHKEALTA-------...........----.........---------------------
FBpp0300832  Q....................G...AHKEALTA-------...........----.........---------------------
FBpp0086380  M....................G...DFRSALN--------...........----.........---------------------
FBpp0083435  L....................K...EFAKAQATIER----...........----.........---------------------
FBpp0078891  L....................E...RYEEADSVLRESLLK...........KHND.........YDTLINLMVHAHLTGKPTEAI
FBpp0082419  L....................K...DYKKALKYCKLILQY...........EPDN.........ATAKEFYPLIL----------
FBpp0082420  L....................K...DYKKALKYCKLILQY...........EPDN.........ATAKEFYPLIL----------
FBpp0306145  L....................K...DYKKALKYCKLILQY...........EPDN.........ATAKEFYPLIL----------
FBpp0303989  M....................N...RFEEAERMHKKAIKI...........KSELlghfdyevgLSIGHLASLYNYQMKKYRDAE
FBpp0305372  M....................G...DFRSALN--------...........----.........---------------------
FBpp0086749  -....................-...-------VYERALKE...........LPGS.........YKIWHNYLR------------
FBpp0078027  L....................N...QLENAKAELHD----...........----.........---------------------
FBpp0088148  K....................M...DMDRAFRQYEQAMG-...........----.........---------------------
FBpp0088149  K....................M...DMDRAFRQYEQAMG-...........----.........---------------------
FBpp0290863  M....................G...LASEALKDCSRAE--...........----.........---------------------
FBpp0080720  Q....................G...KYLEAKNLF------...........----.........---------------------
FBpp0083319  D....................R...KHKEAIEQLQKFAAA...........HKSHe........FVSKFAIIQLQLLQGNRKDAI
FBpp0071288  -....................-...---------------...........WPEF.........GELRSDYLRYLWQERSVEEAR
FBpp0081398  Q....................Q...LNKEGATAL------...........----.........---------------------
FBpp0301016  Q....................Q...LNKEGATAL------...........----.........---------------------
FBpp0085015  -....................-...---------------...........----.........---------------------
FBpp0084188  L....................Npp.DVTEALQHYQRSIQI...........DPRQ.........SEVVIDACELL----------
FBpp0293235  L....................Npp.DVTEALQHYQRSIQI...........DPRQ.........SEVVIDACELL----------
FBpp0290580  Q....................Gd..KYNEAAAFYEPIVRQ...........HSDDimsvs....AAVLANLCVSYIMTFQNEEAE
FBpp0085012  E....................G...NIESALTMTNELLQL...........LPHH.........ERANGN---------------
FBpp0086380  N....................G...HV-------------...........----.........---------------------
FBpp0304708  -....................-...---------------...........----.........---------------------
FBpp0305372  N....................G...HV-------------...........----.........---------------------
FBpp0304707  -....................-...---------------...........----.........---------------------
FBpp0071879  N....................G...DARKAKMWLLKVRHL...........VPHD.........PFVIFNLGLAIKKE-------
FBpp0076961  V....................A...LTQDALEDSLRAMEVr..........QAWD.........ANVSMELGDALYDLNRFEENK
FBpp0075717  M....................G...EPARAEISLKIAEK-...........----.........---------------------
FBpp0080267  L....................R...NFALCEEHLHELLHI...........----.........---------------------
FBpp0070907  N....................G...DYFQAEDIFSSTLCA...........NPDN.........VEAIGLMAVLC----------
FBpp0085033  D....................Q...NYSEALPLLHNCLKL...........QPHD.........ARVLR----------------
FBpp0082507  D....................R...EYSLASELLAVGAES...........----.........---------------------
FBpp0077738  R....................G...DIKGALEYFEK----...........----.........---------------------
FBpp0292775  R....................G...DIKGALEYFEK----...........----.........---------------------
FBpp0085676  L....................N...QFEN-----------...........----.........---------------------
FBpp0087091  -....................-...---------------...........----.........---------------------
FBpp0082624  C....................G...HPELAW---------...........----.........---------------------
FBpp0070908  N....................G...DYFQAEDIFSSTLCA...........NPDN.........VEAIGLMAVLC----------
FBpp0070431  E....................G...HSKEALHHLEEAQRI...........----.........---------------------
FBpp0075443  M....................H...KYGDAEIFLSKWI--...........----.........---------------------
FBpp0305287  M....................H...KYGDAEIFLSKWI--...........----.........---------------------
FBpp0305288  M....................H...KYGDAEIFLSKWI--...........----.........---------------------
FBpp0070906  Heyst................G...DFSCAQDHVDKAVNI...........----.........---------------------
FBpp0303990  Heyst................G...DFSCAQDHVDKAVNI...........----.........---------------------
FBpp0073018  -....................-...---------------...........----.........---------------------
FBpp0078634  E....................K...RFEEARHHLAAA---...........----.........---------------------
FBpp0087626  L....................K...K--------------...........----.........---------------------
FBpp0075754  M....................R...RYADAIRTFSDILLY...........IQRT.........K--------------------
FBpp0087625  L....................K...K--------------...........----.........---------------------
FBpp0071288  F....................Nrl.NIDRVKDILLRGLQR...........HPDS.........EA-------------------
FBpp0085046  R....................R...NEEGALKAYQAALKH...........SPHD.........LEIFQEY--------------
FBpp0110159  R....................R...NEEGALKAYQAALKH...........SPHD.........LEIFQEY--------------
FBpp0072679  L....................E...QFDD----LEKCVER...........LPEK.........SP-------------------
FBpp0306202  L....................E...QFDD----LEKCVER...........LPEK.........SP-------------------
FBpp0082624  L....................G...LYEEAQQLMAN----...........AADN.........PLKQRLLFHLAHKLGNEE---
FBpp0084254  Q....................N...RRDEAYEKLEVAT--...........----.........---------------------
FBpp0085032  -....................-...---------------...........----.........---------------------


                    160                                                                             
                      |                                                                             
d1kt1a1        RRTYANMFKKF-----aeqda................................................................
FBpp0112456  ----------------almeyycskdkeiafrifelglkrfggspeyvmcyidylshlnednntrvlfervlssgglsphksvev
FBpp0297503  ----------------almeyycskdkeiafrifelglkrfggspeyvmcyidylshlnednntrvlfervlssgglsphksvev
FBpp0112455  ----------------eyycskdkeiafrifelglkrfggspeyvmcyidylshlnednntrvlfervlssgglsphksvevwnr
FBpp0297502  ----------------eyycskdkeiafrifelglkrfggspeyvmcyidylshlnednntrvlfervlssgglsphksvevwnr
FBpp0070352  EHLLTALTM-------qahtnaarelpnaamaatfrgqnqmsesiwstlkmvislmgrsdlqsyvsdrnlaalneafk.......
FBpp0070351  EHLLTALTM-------qahtnaarelpnaamaatfrgqnqmsesiwstlkmvislmgrsdlqsyvsdrnlaalneafk.......
FBpp0070402  EIYERFVYVHPD----vknwikfarfeeshgfihgsrrvferaveffgddyieerlfiafarfeegqkehdrariiykyaldhlp
FBpp0080138  ----------------dldstyhylyslvciipfelsennlnklfakhteylermdpekldfniedffarfylivdifffdkevp
FBpp0080139  ----------------dldstyhylyslvciipfelsennlnklfakhteylermdpekldfniedffarfylivdifffdkevp
FBpp0301685  KLFQRC----------lvkilnidlwklyltyvketksglsthkekmaqaydfalekigmdlhsfsiwqdyiyflrgveavgnya
FBpp0074609  ----------------qdsrefklikvlcenleeqniegfteavkdydsisrldqwyttillrikkaaded..............
FBpp0084171  ----------------dlfdeirrkyeetemkqspmhyaagsknqkskqmrkevwiypdgirrlhrtddkgnkakgnkatmaevn
FBpp0085420  QSYRTALKLKPD----fpdaycnlahclqivcdwtdydirmkklvsi......................................
FBpp0085421  QSYRTALKLKPD----fpdaycnlahclqivcdwtdydirmkklvsi......................................
FBpp0085422  QSYRTALKLKPD----fpdaycnlahclqivcdwtdydirmkklvsi......................................
FBpp0085420  DTYRRAIELQP-----n....................................................................
FBpp0085421  DTYRRAIELQP-----n....................................................................
FBpp0085422  DTYRRAIELQP-----n....................................................................
FBpp0077790  ----------------akike................................................................
FBpp0082545  HHWQHAVALNPR----qpkawaniltmldnkglqddalrisnqalqhlpndvsilfiranvlgklkhyteaeaiykrvielephn
FBpp0084693  ----------------qevveimdkfmaradiepdqkvlfaqrkvefledfgstarglqdaqralqqaltkakeaqkks......
FBpp0084691  ----------------qevveimdkfmaradiepdqkvlfaqrkvefledfgstarglqdaqralqqaltkakeaqkks......
FBpp0084692  ----------------qevveimdkfmaradiepdqkvlfaqrkvefledfgstarglqdaqralqqaltkakeaqkks......
FBpp0084694  ----------------qevveimdkfmaradiepdqkvlfaqrkvefledfgstarglqdaqralqqaltkakeaqkks......
FBpp0112211  ----------------qevveimdkfmaradiepdqkvlfaqrkvefledfgstarglqdaqralqqaltkakeaqkks......
FBpp0072096  NALKKEIS--------lnqqtesygqigrlvvalvmvqlargdsveaektfrewgnccepeevstlqtllqafddedpela....
FBpp0071560  PFLNQLIRHHP-----shvkglillgdiyinhmkdldeaekcyrsilhydphntqglhnlcvvfverkrlakaaaclqyaqrlap
FBpp0071561  PFLNQLIRHHP-----shvkglillgdiyinhmkdldeaekcyrsilhydphntqglhnlcvvfverkrlakaaaclqyaqrlap
FBpp0077790  ----------------s....................................................................
FBpp0076600  RELEE-----------lkevvpkesvvfyligkihktlgnmdlalmhfswatdldpkg...........................
FBpp0305561  RELEE-----------lkevvpkesvvfyligkihktlgnmdlalmhfswatdldpkg...........................
FBpp0271716  ----------------qvrsleeyikkeidkevakgmvvaggaalvlggilglgiamarnkq.......................
FBpp0077790  ----------------met..................................................................
FBpp0271718  ----------------qvrsleeyikkeidkevakgmvvaggaalvlggilglgiamar..........................
FBpp0290895  ACYHKALELQPG----haisranlarm..........................................................
FBpp0290896  ACYHKALELQPG----haisranlarm..........................................................
FBpp0081673  KALKKEIS--------lnlqtksygqvgrlvvalilvqltledyvdakktfkkwgnrcdpqevntlqnllkafddedpelatkm.
FBpp0293601  AIYREAL---------sslpglpqqreilyqrigdvlgrlqqwdeaerhhraalelqpnqvaahlsygitla.............
FBpp0077614  AIYREAL---------sslpglpqqreilyqrigdvlgrlqqwdeaerhhraalelqpnqvaahlsygitla.............
FBpp0084692  ----------------lmhvksnhgddetfvrsqyeravkacglefrsdklwdayirweneskryhrvvqiydrllaiptqgyng
FBpp0084694  ----------------lmhvksnhgddetfvrsqyeravkacglefrsdklwdayirweneskryhrvvqiydrllaiptqgyng
FBpp0112211  ----------------lmhvksnhgddetfvrsqyeravkacglefrsdklwdayirweneskryhrvvqiydrllaiptqgyng
FBpp0084691  ----------------lmhvksnhgddetfvrsqyeravkacglefrsdklwdayirweneskryhrvvqiydrllaiptqgyng
FBpp0084693  ----------------lmhvksnhgddetfvrsqyeravkacglefrsdklwdayirweneskryhrvvqiydrllaiptqgyng
FBpp0296980  ----------------ea...................................................................
FBpp0300832  ----------------ea...................................................................
FBpp0080535  ----------------narnqpp..............................................................
FBpp0296963  ----------------narnqpp..............................................................
FBpp0296980  ECQ-------------qlfla................................................................
FBpp0300832  ECQ-------------qlfla................................................................
FBpp0072164  ----------------i....................................................................
FBpp0084016  NVLERAVVQK------lkpnkmqviykkylqleenhgtdatvakvkqqaeqwvknyak...........................
FBpp0296980  ----------------krfherqlamalaardklgegracsnlgivyqmlgshdaalklhqahlgiarsl...............
FBpp0300832  ----------------krfherqlamalaardklgegracsnlgivyqmlgshdaalklhqahlgiarsl...............
FBpp0296980  KCYERQ----------lelst................................................................
FBpp0300832  KCYERQ----------lelst................................................................
FBpp0080894  KCYWKAI---------dvgdiegiamyklanlheklgdhetavhcyimy....................................
FBpp0305185  KCYWKAI---------dvgdiegiamyklanlheklgdhetavhcyimy....................................
FBpp0081606  ----------------n....................................................................
FBpp0081607  ----------------n....................................................................
FBpp0304082  ----------------n....................................................................
FBpp0084559  KYAEQHL---------qlakelhdpvgestar.....................................................
FBpp0075683  ----------------aherefgaidsknkpiwqvaeereehkfdnrentpygeyggwhkaakvdsptvtttlknlgalyrrqgm
FBpp0303945  ----------------aherefgaidsknkpiwqvaeereehkfdnrentpygeyggwhkaakvdsptvtttlknlgalyrrqgm
FBpp0303946  ----------------aherefgaidsknkpiwqvaeereehkfdnrentpygeyggwhkaakvdsptvtttlknlgalyrrqgm
FBpp0081284  ----------------hv...................................................................
FBpp0079468  KKLYANMF--------tk...................................................................
FBpp0087297  V---------------alera................................................................
FBpp0074835  ----------------ykfellhgteaqqqevldrcisaepthgeswcrv...................................
FBpp0079893  ELFEKA----------l....................................................................
FBpp0079894  ELFEKA----------l....................................................................
FBpp0079895  ELFEKA----------l....................................................................
FBpp0082765  ----------------k....................................................................
FBpp0079617  ----------------eqk..................................................................
FBpp0084440  ----------------va...................................................................
FBpp0305670  ----------------igteqavkmvn..........................................................
FBpp0080423  ----------------igteqavkmvn..........................................................
FBpp0305671  ----------------igteqavkmvn..........................................................
FBpp0080424  ----------------igteqavkmvn..........................................................
FBpp0305672  ----------------igteqavkmvn..........................................................
FBpp0085344  DCFATSLQ--------lepscpvl.............................................................
FBpp0081552  ----------------qwvlvqqliqysdhqnaipmitqlleispwavpfrqarsdayiaindpllaiadlrqvnrltqdstegh
FBpp0297109  DCFATSLQ--------lepscpvl.............................................................
FBpp0087646  EDYDTLLQRNP-----tylp.................................................................
FBpp0083769  EAFHKSLALN------rdci.................................................................
FBpp0070572  ----------------fd...................................................................
FBpp0070573  ----------------fd...................................................................
FBpp0070575  ----------------fd...................................................................
FBpp0305905  ----------------fd...................................................................
FBpp0074835  RLLEEAVE--------vfpdfpklwm...........................................................
FBpp0305670  ----------------ks...................................................................
FBpp0080424  ----------------ks...................................................................
FBpp0305672  ----------------ks...................................................................
FBpp0080423  ----------------ks...................................................................
FBpp0305671  ----------------ks...................................................................
FBpp0076113  ----------------rqq..................................................................
FBpp0076114  ----------------rqq..................................................................
FBpp0076115  ----------------rqq..................................................................
FBpp0305988  ----------------rqq..................................................................
FBpp0072561  AVLLKARRV-------apqdtvllfniavvlsr....................................................
FBpp0072562  AVLLKARRV-------apqdtvllfniavvlsr....................................................
FBpp0072561  QCFEKVLKIQPG----nyetmkilgsly.........................................................
FBpp0072562  QCFEKVLKIQPG----nyetmkilgsly.........................................................
FBpp0085923  ----------------nhg..................................................................
FBpp0293601  ASYKAALRLQP-----gdaitlgnlak..........................................................
FBpp0079893  ----------------v....................................................................
FBpp0079894  ----------------v....................................................................
FBpp0079895  ----------------v....................................................................
FBpp0075683  ----------------re...................................................................
FBpp0303945  ----------------re...................................................................
FBpp0303946  ----------------re...................................................................
FBpp0077614  ASYKAALRLQP-----gdaitlgnlak..........................................................
FBpp0085409  ----------------qvrsleeyikkeidkevakgmvvaggaalvlggilglgiamarnkq.......................
FBpp0271717  ----------------qvrsleeyikkeidkevakgmvvaggaalvlggilglgiamar..........................
FBpp0271719  ----------------qvrsleeyikkeidkevakgmvvaggaalvlggilglgiamar..........................
FBpp0086749  ----------------lyakleeehglarhamsvydratsavkedemfdmynifikk............................
FBpp0073411  ----------------as...................................................................
FBpp0070907  AL--------------cnwtirlfqnsprsftmfgrtlflfpdprmrrtarkfaekslkinhiytpavnliadicqvegptkaii
FBpp0303439  ----------------as...................................................................
FBpp0070908  AL--------------cnwtirlfqnsprsftmfgrtlflfpdprmrrtarkfaekslkinhiytpavnliadicqvegptkaii
FBpp0085842  KEMYQ-----------km...................................................................
FBpp0300561  ----------------vqktqea..............................................................
FBpp0077718  SY--------------lnaakdvmpdaaevttnl...................................................
FBpp0296980  GCL-------------eaqlgtlervs..........................................................
FBpp0300832  GCL-------------eaqlgtlervs..........................................................
FBpp0076600  ----------------lgqdtdaaaifqihstdvfntcqgssvnanamvlfgaeqqgqqhqerqslitnlsnvsnyilttpvdqq
FBpp0305561  ----------------lgqdtdaaaifqihstdvfntcqgssvnanamvlfgaeqqgqqhqerqslitnlsnvsnyilttpvdqq
FBpp0071712  ----------------vqktqea..............................................................
FBpp0086749  ----------------pkrkiayyddtetvqarlhrslkvw............................................
FBpp0085479  ----------------ia...................................................................
FBpp0112016  ----------------vqktqea..............................................................
FBpp0292906  ACYLN-----------a....................................................................
FBpp0305602  ACYLN-----------a....................................................................
FBpp0079665  ACYLN-----------a....................................................................
FBpp0079666  ACYLN-----------a....................................................................
FBpp0079664  ACYLN-----------a....................................................................
FBpp0084076  ----------------layidky..............................................................
FBpp0111406  ----------------skq..................................................................
FBpp0074918  RAYQRMAELK------qhyldq...............................................................
FBpp0082818  ----------------n....................................................................
FBpp0074480  SI--------------letfsqsqtsieahdyrhselllyqnqiliesnrlqqavdhltkyqgqivdklavretmgdlyiklqqq
FBpp0082819  ----------------.....................................................................
FBpp0292061  ----------------dal..................................................................
FBpp0085279  FYYERAVLADPND---pnlmlriascfrn........................................................
FBpp0081805  ----------------dal..................................................................
FBpp0100021  ----------------lpk..................................................................
FBpp0100023  ----------------lpk..................................................................
FBpp0074877  ----------------qlp..................................................................
FBpp0071879  QTY-------------erclk................................................................
FBpp0084559  ----------------k....................................................................
FBpp0075591  ----------------far..................................................................
FBpp0076526  ----------------krfpnkvkk............................................................
FBpp0079851  ECW-------------kva..................................................................
FBpp0290395  ----------------rn...................................................................
FBpp0072146  R---------------di...................................................................
FBpp0296980  ----------------llqvllvalnrnedal.....................................................
FBpp0300832  ----------------llqvllvalnrnedal.....................................................
FBpp0083238  A---------------valqlykaqpknayyf.....................................................
FBpp0111383  ----------------df...................................................................
FBpp0080424  ----------------ql...................................................................
FBpp0305672  ----------------ql...................................................................
FBpp0305670  ----------------ql...................................................................
FBpp0071560  ----------------a....................................................................
FBpp0071561  ----------------a....................................................................
FBpp0080423  ----------------ql...................................................................
FBpp0305671  ----------------ql...................................................................
FBpp0071879  ----------------lvwsfagnaikftankhiesrnyfqiaksyhatgqfesakkyyllsaksap..................
FBpp0077738  ----------------.....................................................................
FBpp0077934  ----------------.....................................................................
FBpp0292775  ----------------.....................................................................
FBpp0087646  DLFRHC----------qqfdyh...............................................................
FBpp0292906  ----------------dg...................................................................
FBpp0079664  ----------------dg...................................................................
FBpp0086749  ----------------aqqlahiv.............................................................
FBpp0082652  ----------------feiaianarllnr........................................................
FBpp0077619  ECW-------------.....................................................................
FBpp0086164  ----------------.....................................................................
FBpp0297722  ----------------.....................................................................
FBpp0087232  ----------------nldamtmikmlqndprtakqeakqqkqkialdqakpvklenefvsplvridsnrqegrfarasadvkpg
FBpp0072561  ----------------ndlqaslsaygtassilrdkakyeipaeiqnnvaslhyrlgnlkmakltlesalkhatsemd.......
FBpp0072562  ----------------ndlqaslsaygtassilrdkakyeipaeiqnnvaslhyrlgnlkmakltlesalkhatsemd.......
FBpp0088148  TY--------------askaydlsrslql........................................................
FBpp0088149  TY--------------askaydlsrslql........................................................
FBpp0075786  ----------------q....................................................................
FBpp0075788  ----------------q....................................................................
FBpp0306229  ----------------q....................................................................
FBpp0075787  ----------------q....................................................................
FBpp0075789  ----------------q....................................................................
FBpp0301715  ----------------q....................................................................
FBpp0301716  ----------------q....................................................................
FBpp0306230  ----------------q....................................................................
FBpp0075785  ----------------q....................................................................
FBpp0083319  DSYRDIIK--------ntsdeyeeerrtnlsavaanlavdqtkevpevpedtyeqyfnsaciqanrqkyaeaerklrtsek....
FBpp0076498  ----------------kkt..................................................................
FBpp0293529  ----------------kkt..................................................................
FBpp0290580  ----------------r....................................................................
FBpp0290395  ----------------lafrrlcdvqteaiesdmesetniiklqqqaepiqqigetdgyqslnnepvtgsvikaegggklnetvk
FBpp0080720  ----------------daveqaeycl...........................................................
FBpp0086164  EAME------------gaysvcgarftlediniylellilnkqyakvlrclrertnfelendqeesleliyfceipddyvpelra
FBpp0297722  EAME------------gaysvcgarftlediniylellilnkqyakvlrclrertnfelendqeesleliyfceipddyvpelra
FBpp0080741  ----------------srkmanylqaklm........................................................
FBpp0087297  ----------------aattqsqkdvasqqqdeartyfelavqs.........................................
FBpp0070720  ----------------aevdeeirlilqrivtdmdmtvelhldylayrirntnasdeqqvaslraafnhaweeltvlygdqadtr
FBpp0089396  ----------------aevdeeirlilqrivtdmdmtvelhldylayrirntnasdeqqvaslraafnhaweeltvlygdqadtr
FBpp0111789  ----------------aevdeeirlilqrivtdmdmtvelhldylayrirntnasdeqqvaslraafnhaweeltvlygdqadtr
FBpp0086683  ----------------dtn..................................................................
FBpp0289328  ----------------fiqilgdpsehlhrqyikslfkygsttsepsksieeafimvqasqeeldnimsdlnepqndvevekdly
FBpp0070667  ----------------tl...................................................................
FBpp0082624  ----------------lgskehiktaqq.........................................................
FBpp0081552  ----------------se...................................................................
FBpp0086749  AIYA------------hcsqvcdpritadfwqtwkefevrhgnedtmremlr.................................
FBpp0087646  ----------------vvdhgddkaatilvamasmiydfqgea..........................................
FBpp0071879  NTLD------------dalskcrv.............................................................
FBpp0080894  ----------------efmel................................................................
FBpp0305185  ----------------efmel................................................................
FBpp0112213  ----------------ikancy...............................................................
FBpp0087233  ----------------nldamtmikmlqndprtakqeakqqkqkialdqakpvklenefvsplvridsnrqegrfarasadvkpg
FBpp0070906  ----------------ek...................................................................
FBpp0303990  ----------------ek...................................................................
FBpp0087646  ----------------ayalclshekgvsklreavtilqtlensegnikslarcyfklge.........................
FBpp0082112  ----------------meh..................................................................
FBpp0086359  EVYGK-----------gvakg................................................................
FBpp0293627  EVYGK-----------gvakg................................................................
FBpp0076526  ----------------tlctiaeiceqqshpfwtvhdvyqkalrqadkag...................................
FBpp0085279  ERF-------------.....................................................................
FBpp0074835  KII-------------drsltsltvng..........................................................
FBpp0303989  ----------------k....................................................................
FBpp0078887  ----------------tad..................................................................
FBpp0290580  ----------------ldlppraeseldpvtlhnmaltdvegpvaglrklafllelgapscpketfanilliccknelyetaadi
FBpp0085047  ----------------krdltlsdiepieqdk.....................................................
FBpp0296980  ----------------hry..................................................................
FBpp0300832  ----------------hry..................................................................
FBpp0086380  ----------------nekety...............................................................
FBpp0083435  ----------------m....................................................................
FBpp0078891  ----------------trn..................................................................
FBpp0082419  ----------------dkl..................................................................
FBpp0082420  ----------------dkl..................................................................
FBpp0306145  ----------------dkl..................................................................
FBpp0303989  QLYMRS----------idi..................................................................
FBpp0305372  ----------------nekety...............................................................
FBpp0086749  ----------------trrk.................................................................
FBpp0078027  ----------------ntrlftgnktkmfeqrlvvvdeniedacgpsmtqyisdkeklivhlkevqnkykpdtrplwkilkeqek
FBpp0088148  ----------------tsaslgdrmaqmeamdgaarcletlrlqnkicncrplefntrllevassigakflvrkircrlaliyra
FBpp0088149  ----------------tsaslgdrmaqmeamdgaarcletlrlqnkicncrplefntrllevassigakflvrkircrlaliyra
FBpp0290863  ----------------dl...................................................................
FBpp0080720  ----------------kea..................................................................
FBpp0083319  ETLL------------slgeakykpgvvsalvslylgtdnktaasallksavdwykknevssgdlsdmwrqaaefhlrggaseta
FBpp0071288  KEYAKL----------ailppmslalhrqmvqlessaaacdqaslkywrmcydfmacyfgktqprvwveylaferdhgeaknisl
FBpp0081398  ----------------rq...................................................................
FBpp0301016  ----------------rq...................................................................
FBpp0085015  ----------------saqqtqk..............................................................
FBpp0084188  ----------------vkenn................................................................
FBpp0293235  ----------------vkenn................................................................
FBpp0290580  ELMRK-----------v....................................................................
FBpp0085012  ----------------krfyekeiaq...........................................................
FBpp0086380  ----------------gmslkllyra...........................................................
FBpp0304708  ----------------l....................................................................
FBpp0305372  ----------------gmslkllyra...........................................................
FBpp0304707  ----------------l....................................................................
FBpp0071879  ----------------teqalal..............................................................
FBpp0076961  SLLH------------dnvrrhagtalksfenrlvvvdenlkdctgfslanffmehsaqlpgfyahqqeelrradrrplwkilke
FBpp0075717  ----------------m....................................................................
FBpp0080267  ----------------elnq.................................................................
FBpp0070907  ----------------gqeg.................................................................
FBpp0085033  ----------------lwkkt................................................................
FBpp0082507  ----------------adeasatylkvlfllsramilmierktndvlallnsagqiidnn.........................
FBpp0077738  ----------------tqn..................................................................
FBpp0292775  ----------------tqn..................................................................
FBpp0085676  ----------------skaemhn..............................................................
FBpp0087091  ----------------an...................................................................
FBpp0082624  ----------------nv...................................................................
FBpp0070908  ----------------gqeg.................................................................
FBpp0070431  ----------------ltvthgrdhrllteqlymlvlqar.............................................
FBpp0075443  ----------------ne...................................................................
FBpp0305287  ----------------ne...................................................................
FBpp0305288  ----------------ne...................................................................
FBpp0070906  ----------------mqhlvp...............................................................
FBpp0303990  ----------------mqhlvp...............................................................
FBpp0073018  ----------------cl...................................................................
FBpp0078634  ----------------tlima................................................................
FBpp0087626  ----------------ia...................................................................
FBpp0075754  ----------------qlystrsyqndqinkqae...................................................
FBpp0087625  ----------------ia...................................................................
FBpp0071288  ----------------lnkcffdimlkeaalasnernlaentlseqdiklerveavyrnsmanitq...................
FBpp0085046  ----------------qnl..................................................................
FBpp0110159  ----------------qnl..................................................................
FBpp0072679  ----------------llpklaemlasvgmcseavqahlrfgdqkaavatcvnlrqw............................
FBpp0306202  ----------------llpklaemlasvgmcseavqahlrfgdqkaavatcvnlrqw............................
FBpp0082624  ----------------e....................................................................
FBpp0084254  ----------------k....................................................................
FBpp0085032  ----------------ks...................................................................


                                                                                                    
                                                                                                    
d1kt1a1        .....................................................................................
FBpp0112456  wnrflefesnigdlssivkverrrsavfenlkeyegketaqlvdrykfldlypctstelksigyae...................
FBpp0297503  wnrflefesnigdlssivkverrrsavfenlkeyegketaqlvdrykfldlypctstelksigyae...................
FBpp0112455  flefesnigdlssivkverrrsavfenlkeyegketaqlvdrykfldlypctstelksigyae......................
FBpp0297502  flefesnigdlssivkverrrsavfenlkeyegketaqlvdrykfldlypctstelksigyae......................
FBpp0070352  .....................................................................................
FBpp0070351  .....................................................................................
FBpp0070402  kdrtqelfkaytkhekkygdragiedvivskrkyqyeqevaanptnydawfdylrlieaegdrdqiretyeraisnvppaneknf
FBpp0080138  dfnalchcvlidlrkilcsqqlrvpepsifkivsilffclsklkminspkvyslhaflvaacsdlmdacivsieqtilaraqdne
FBpp0080139  dfnalchcvlidlrkilcsqqlrvpepsifkivsilffclsklkminspkvyslhaflvaacsdlmdacivsieqtilaraqdne
FBpp0301685  enqkitavrrvyqkavvtpivgieqlwkdyiafeqninpiisekmslerskdymnarrvakeleyhtkglnrnlpavpptltkee
FBpp0074609  .....................................................................................
FBpp0084171  ryeemppeeilprivslylyllgklytgtdvdslypllrklqiqigvalrhenllsrskllkivalnlfvvehnkpktsrremry
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  tlyhtnlgvlyhrwdktqeaieayrtaisisaarattarenlskllkrlereaqvm.............................
FBpp0084693  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  aedyigrhlqivlarlqki..................................................................
FBpp0071561  aedyigrhlqivlarlqki..................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0305561  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0271718  .....................................................................................
FBpp0290895  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0293601  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084692  hfdnfqdlinqhdvtitlaneevirlrkdfherqq..................................................
FBpp0084694  hfdnfqdlinqhdvtitlaneevirlrkdfherqq..................................................
FBpp0112211  hfdnfqdlinqhdvtitlaneevirlrkdfherqq..................................................
FBpp0084691  hfdnfqdlinqhdvtitlaneevirlrkdfherqq..................................................
FBpp0084693  hfdnfqdlinqhdvtitlaneevirlrkdfherqq..................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0296963  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0305185  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0081607  .....................................................................................
FBpp0304082  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  feaa.................................................................................
FBpp0303945  feaa.................................................................................
FBpp0303946  feaa.................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0085344  .....................................................................................
FBpp0081552  ykiaqllytighatnalkeireclkfdpeh.......................................................
FBpp0297109  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070573  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0305905  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0076114  .....................................................................................
FBpp0076115  .....................................................................................
FBpp0305988  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0293601  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0303945  .....................................................................................
FBpp0303946  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0085409  .....................................................................................
FBpp0271717  .....................................................................................
FBpp0271719  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070907  kllekhviifpkvnllnhlgdimrkqkepvkameyyykalrqdpks.......................................
FBpp0303439  .....................................................................................
FBpp0070908  kllekhviifpkvnllnhlgdimrkqkepvkameyyykalrqdpks.......................................
FBpp0085842  .....................................................................................
FBpp0300561  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0076600  qqqinqnqnqhhnsnmvtpinnnnnnnnlnssismlrgglvqnssmlamledtpmgapqdpagqyqqnqqlydmssgtpfrkqfk
FBpp0305561  qqqinqnqnqhhnsnmvtpinnnnnnnnlnssismlrgglvqnssmlamledtpmgapqdpagqyqqnqqlydmssgtpfrkqfk
FBpp0071712  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0305602  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0079666  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  ekavpifeslirrnpenvlyyeqyiaarqvtdssavvsiyrvfqeqypralcprrlplniangdefrvvtdeylrrglrkgippl
FBpp0082819  .....................................................................................
FBpp0292061  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0081805  .....................................................................................
FBpp0100021  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0074877  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0297722  .....................................................................................
FBpp0087232  eellverpfvsvllekfakthcencfmrtvvpvacprcadvlycseqcreeaskkyhkyecgivpiiwrsgasinnhialriias
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0075786  .....................................................................................
FBpp0075788  .....................................................................................
FBpp0306229  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0075789  .....................................................................................
FBpp0301715  .....................................................................................
FBpp0301716  .....................................................................................
FBpp0306230  .....................................................................................
FBpp0075785  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076498  .....................................................................................
FBpp0293529  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0290395  faatvkhryvvqalkkdelavyrnerrnavkrsitmivdlispfiednyndgynwcieiiktsnlawlanelelnkalvylrqnd
FBpp0080720  .....................................................................................
FBpp0086164  klcvslihmrahhllgyliqnvqehitltadrvelymditealmqehkyaeaial..............................
FBpp0297722  klcvslihmrahhllgyliqnvqehitltadrvelymditealmqehkyaeaial..............................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  yevlqlwaqveytqlgspdngreiwrqimgypgssirgllwlnfaqmeseyngghgtrdvlrkalsqpvlenglmvqeffrryer
FBpp0089396  yevlqlwaqveytqlgspdngreiwrqimgypgssirgllwlnfaqmeseyngghgtrdvlrkalsqpvlenglmvqeffrryer
FBpp0111789  yevlqlwaqveytqlgspdngreiwrqimgypgssirgllwlnfaqmeseyngghgtrdvlrkalsqpvlenglmvqeffrryer
FBpp0086683  .....................................................................................
FBpp0289328  qvkrspsncelgcrglyrqktnlvcrykstantflrlaplkleeisldpfmamyhevlydseirelkgqsmnmvngyasqrngte
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0305185  .....................................................................................
FBpp0112213  .....................................................................................
FBpp0087233  eellverpfvsvllekfakthcencfmrtvvpvacprcadvlycseqcreeaskkyhkyecgivpiiwrsgasinnhialriias
FBpp0070906  .....................................................................................
FBpp0303990  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0082112  .....................................................................................
FBpp0086359  .....................................................................................
FBpp0293627  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0303989  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  laehtdltykylsqylyelldslitaqtsaelaekklgtlasslagklrslaakvqevratneqqalrdalkdyeqalel.....
FBpp0085047  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0082420  .....................................................................................
FBpp0306145  .....................................................................................
FBpp0303989  .....................................................................................
FBpp0305372  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  cdvlsipeieeemlspleiarrsrafdvfnqmfidrswhdviflkhvrknpnlllnqcknsteylqtlstkkydeiksflkilea
FBpp0088148  lgdedq...............................................................................
FBpp0088149  lgdedq...............................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  assleellklnpndtkv....................................................................
FBpp0071288  ltqralstlepqyvaaf....................................................................
FBpp0081398  .....................................................................................
FBpp0301016  .....................................................................................
FBpp0085015  .....................................................................................
FBpp0084188  .....................................................................................
FBpp0293235  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0304708  .....................................................................................
FBpp0305372  .....................................................................................
FBpp0304707  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  rkecdvqsridrkevmlsplererrrrktkifyqnylgrswtdffflktlrrhpnclldnhfgssadrtkyleyafqrlktftrm
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075443  .....................................................................................
FBpp0305287  .....................................................................................
FBpp0305288  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0303990  .....................................................................................
FBpp0073018  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0087626  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0085046  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0306202  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................


                                                                                                    
                                                                                                    
d1kt1a1        .....................................................................................
FBpp0112456  .....................................................................................
FBpp0297503  .....................................................................................
FBpp0112455  .....................................................................................
FBpp0297502  .....................................................................................
FBpp0070352  .....................................................................................
FBpp0070351  .....................................................................................
FBpp0070402  wrryiylwinyalyeeleaedaertrqiyktcleliphkqftfsklwllyaqfeirckelqrarkalglaigmcprdklfrgyid
FBpp0080138  rfqaeyeerfqefdtvvrksrneyknwlaavgecerkdkklmprphslkdcssdsrdsqhsgeeaktqeaadgdkigeavstrss
FBpp0080139  rfqaeyeerfqefdtvvrksrneyknwlaavgecerkdkklmprphslkdcssdsrdsqhsgeeaktqeaadgdkigeavstrss
FBpp0301685  vkqvelwkrfityeksnplrtedtalvtrrvmfateqcllvlthhpavwhqasqfldtsarvltekgvrts..............
FBpp0074609  .....................................................................................
FBpp0084171  hsfnfansffglmmkktnqllagfvedstnvqclpeedfatvntylqfvnvyvrwlsisldvwepvrseehsfidcwaeltilfe
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0305561  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0271718  .....................................................................................
FBpp0290895  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0293601  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0296963  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0305185  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0081607  .....................................................................................
FBpp0304082  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0303945  .....................................................................................
FBpp0303946  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0085344  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0297109  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070573  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0305905  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0076114  .....................................................................................
FBpp0076115  .....................................................................................
FBpp0305988  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0293601  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0303945  .....................................................................................
FBpp0303946  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0085409  .....................................................................................
FBpp0271717  .....................................................................................
FBpp0271719  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0303439  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0300561  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0076600  ylsaispptpsfgimpltspctgndgsfignhtpvmnisyspmpqmlvevnqepkmmgkklkthvgglinrkegslnkpavftqa
FBpp0305561  ylsaispptpsfgimpltspctgndgsfignhtpvmnisyspmpqmlvevnqepkmmgkklkthvgglinrkegslnkpavftqa
FBpp0071712  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0305602  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0079666  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  fvnvrtlhqiperaavieelalqyfenltrsghfsredadagipvepasalvwtalflaqhydymrdtdraleyinvaidhtptl
FBpp0082819  .....................................................................................
FBpp0292061  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0081805  .....................................................................................
FBpp0100021  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0074877  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0297722  .....................................................................................
FBpp0087232  kpldyflklkptideeltpeqlislpkddfrrvaqlerhqgerqpsnffqhvlmarfltnclraggyfgsepkpdevsiicslvl
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0075786  .....................................................................................
FBpp0075788  .....................................................................................
FBpp0306229  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0075789  .....................................................................................
FBpp0301715  .....................................................................................
FBpp0301716  .....................................................................................
FBpp0306230  .....................................................................................
FBpp0075785  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076498  .....................................................................................
FBpp0293529  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0290395  vhqaietlq............................................................................
FBpp0080720  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0297722  .....................................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  cygtyesiaacq.........................................................................
FBpp0089396  cygtyesiaacq.........................................................................
FBpp0111789  cygtyesiaacq.........................................................................
FBpp0086683  .....................................................................................
FBpp0289328  irdtvvrydwwsntslvrerinqriidmtgfnflkdeklqianyglgtyfqphfdyssdgfetpnittlgdrlasilfyasevpq
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0305185  .....................................................................................
FBpp0112213  .....................................................................................
FBpp0087233  kpldyflklkptideeltpeqlislpkddfrrvaqlerhqgerqpsnffqhvlmarfltnclraggyfgsepkpdevsiicslvl
FBpp0070906  .....................................................................................
FBpp0303990  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0082112  .....................................................................................
FBpp0086359  .....................................................................................
FBpp0293627  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0303989  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085047  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0082420  .....................................................................................
FBpp0306145  .....................................................................................
FBpp0303989  .....................................................................................
FBpp0305372  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  rspmyniryqkftnkklmdkfrqeylfrvqyqtrrnmisalrsirylrktksltkltsyveevmgdyvvkktnrimpwkfefine
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0081398  .....................................................................................
FBpp0301016  .....................................................................................
FBpp0085015  .....................................................................................
FBpp0084188  .....................................................................................
FBpp0293235  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0304708  .....................................................................................
FBpp0305372  .....................................................................................
FBpp0304707  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  lqarrpmykeyfhrnpqiearmrdanlfriqyqtrrnmvsilrtikvlrgrndikrlrkfveevmgsyvviktnrlmpwkaefmn
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075443  .....................................................................................
FBpp0305287  .....................................................................................
FBpp0305288  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0303990  .....................................................................................
FBpp0073018  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0087626  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0085046  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0306202  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................


                                                                                                    
                                                                                                    
d1kt1a1        .....................................................................................
FBpp0112456  .....................................................................................
FBpp0297503  .....................................................................................
FBpp0112455  .....................................................................................
FBpp0297502  .....................................................................................
FBpp0070352  .....................................................................................
FBpp0070351  .....................................................................................
FBpp0070402  leiqlrefercrmlyekflefgpencvtwmkfaelenllgdtdraraifelavqqprldm.........................
FBpp0080138  deakesdlktplsckskrrgmrlrrrrrkiaqsddsscydseseldtdfysdeedytdlssnfdtdfsdidaadpgepcgeerya
FBpp0080139  deakesdlktplsckskrrgmrlrrrrrkiaqsddsscydseseldtdfysdeedytdlssnfdtdfsdidaadpgepcgeerya
FBpp0301685  .....................................................................................
FBpp0074609  .....................................................................................
FBpp0084171  yieclmgkhklekneilldedvalrgftplgretlsmdylkrgserlqffervrrigqfqeyyvqhqealqqplessftvehln.
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0305561  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0271718  .....................................................................................
FBpp0290895  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0293601  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0296963  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0305185  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0081607  .....................................................................................
FBpp0304082  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0303945  .....................................................................................
FBpp0303946  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0085344  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0297109  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070573  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0305905  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0076114  .....................................................................................
FBpp0076115  .....................................................................................
FBpp0305988  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0293601  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0303945  .....................................................................................
FBpp0303946  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0085409  .....................................................................................
FBpp0271717  .....................................................................................
FBpp0271719  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0303439  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0300561  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0076600  gnitprtpnnnnvgnngnmnvppnpnaavrrssrlfsnsysvkennkspniankfvqprspprkaksrmtkiclnneliedkshh
FBpp0305561  gnitprtpnnnnvgnngnmnvppnpnaavrrssrlfsnsysvkennkspniankfvqprspprkaksrmtkiclnneliedkshh
FBpp0071712  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0305602  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0079666  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  iellitkgrifkhagdpveayvwleeaqsmdtadryi................................................
FBpp0082819  .....................................................................................
FBpp0292061  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0081805  .....................................................................................
FBpp0100021  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0074877  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0297722  .....................................................................................
FBpp0087232  rslqfiqfnthevaelhkfsssgreksifiggaiyptlalfnhscdpgvvryfrgttihinsvrpieaglpinenygpmytqder
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0075786  .....................................................................................
FBpp0075788  .....................................................................................
FBpp0306229  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0075789  .....................................................................................
FBpp0301715  .....................................................................................
FBpp0301716  .....................................................................................
FBpp0306230  .....................................................................................
FBpp0075785  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076498  .....................................................................................
FBpp0293529  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0297722  .....................................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  .....................................................................................
FBpp0089396  .....................................................................................
FBpp0111789  .....................................................................................
FBpp0086683  .....................................................................................
FBpp0289328  ggatvfpeinvtvfpqkgsmlywfnlhddgkpdi...................................................
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0305185  .....................................................................................
FBpp0112213  .....................................................................................
FBpp0087233  rslqfiqfnthevaelhkfsssgreksifiggaiyptlalfnhscdpgvvryfrgttihinsvrpieaglpinenygpmytqder
FBpp0070906  .....................................................................................
FBpp0303990  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0082112  .....................................................................................
FBpp0086359  .....................................................................................
FBpp0293627  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0303989  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085047  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0082420  .....................................................................................
FBpp0306145  .....................................................................................
FBpp0303989  .....................................................................................
FBpp0305372  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  vynilalayvdqytlpknfrfseknallrllrfpmdkskevkhfvfgdrtthqgsetvdpaltksrlmgnrlenrmnfakypiek
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0081398  .....................................................................................
FBpp0301016  .....................................................................................
FBpp0085015  .....................................................................................
FBpp0084188  .....................................................................................
FBpp0293235  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0304708  .....................................................................................
FBpp0305372  .....................................................................................
FBpp0304707  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  evynnlalslcegyrlpptrvtpydksamcqllnipvakplehtelifgdrstysyagadkqstdrladqnqieylekrllfarl
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075443  .....................................................................................
FBpp0305287  .....................................................................................
FBpp0305288  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0303990  .....................................................................................
FBpp0073018  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0087626  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0085046  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0306202  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................


                                                                                                    
                                                                                                    
d1kt1a1        .....................................................................................
FBpp0112456  .....................................................................................
FBpp0297503  .....................................................................................
FBpp0112455  .....................................................................................
FBpp0297502  .....................................................................................
FBpp0070352  .....................................................................................
FBpp0070351  .....................................................................................
FBpp0070402  .....................................................................................
FBpp0080138  aanyskkerkagggggggvggvvysdnedvvieeekivypneverrsnsqeadseellrsfevlqlnfksaedaqskpvapppvs
FBpp0080139  aanyskkerkagggggggvggvvysdnedvvieeekivypneverrsnsqeadseellrsfevlqlnfksaedaqskpvapppvs
FBpp0301685  .....................................................................................
FBpp0074609  .....................................................................................
FBpp0084171  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0305561  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0271718  .....................................................................................
FBpp0290895  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0293601  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0296963  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0305185  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0081607  .....................................................................................
FBpp0304082  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0303945  .....................................................................................
FBpp0303946  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0085344  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0297109  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070573  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0305905  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0076114  .....................................................................................
FBpp0076115  .....................................................................................
FBpp0305988  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0293601  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0303945  .....................................................................................
FBpp0303946  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0085409  .....................................................................................
FBpp0271717  .....................................................................................
FBpp0271719  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0303439  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0300561  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0076600  lsekrkekvetitssgannnsggrsaaeeakvllnnslnnaqtmahqlmglkkqsadglmallrglaeayqllsnfqckaaikql
FBpp0305561  lsekrkekvetitssgannnsggrsaaeeakvllnnslnnaqtmahqlmglkkqsadglmallrglaeayqllsnfqckaaikql
FBpp0071712  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0305602  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0079666  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  .....................................................................................
FBpp0082819  .....................................................................................
FBpp0292061  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0081805  .....................................................................................
FBpp0100021  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0074877  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0297722  .....................................................................................
FBpp0087232  serqarlkdlywfecscdacidnwpkfddlprdvirfrcdapnncsavievppscndfmvkcvtcgeitnilkglkvmqdtemmt
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0075786  .....................................................................................
FBpp0075788  .....................................................................................
FBpp0306229  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0075789  .....................................................................................
FBpp0301715  .....................................................................................
FBpp0301716  .....................................................................................
FBpp0306230  .....................................................................................
FBpp0075785  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076498  .....................................................................................
FBpp0293529  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0297722  .....................................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  .....................................................................................
FBpp0089396  .....................................................................................
FBpp0111789  .....................................................................................
FBpp0086683  .....................................................................................
FBpp0289328  .....................................................................................
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0305185  .....................................................................................
FBpp0112213  .....................................................................................
FBpp0087233  serqarlkdlywfecscdacidnwpkfddlprdvirfrcdapnncsavievppscndfmvkcvtcgeitnilkglkvmqdtemmt
FBpp0070906  .....................................................................................
FBpp0303990  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0082112  .....................................................................................
FBpp0086359  .....................................................................................
FBpp0293627  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0303989  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085047  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0082420  .....................................................................................
FBpp0306145  .....................................................................................
FBpp0303989  .....................................................................................
FBpp0305372  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  syllhqmaeihlkshrfdeccfsarksieeakkcnsyiwqflcylliikanaalhkvertsealdlalkiskelkekhihnflta
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0081398  .....................................................................................
FBpp0301016  .....................................................................................
FBpp0085015  .....................................................................................
FBpp0084188  .....................................................................................
FBpp0293235  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0304708  .....................................................................................
FBpp0305372  .....................................................................................
FBpp0304707  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  piersyllheladrhmqknhfvqslsyaqkaieearvcnsliweflstmlmakshavlhkyerqtevlnsayelaaqlkspqlct
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075443  .....................................................................................
FBpp0305287  .....................................................................................
FBpp0305288  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0303990  .....................................................................................
FBpp0073018  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0087626  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0085046  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0306202  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................


                                                                                                    
                                                                                                    
d1kt1a1        .....................................................................................
FBpp0112456  .....................................................................................
FBpp0297503  .....................................................................................
FBpp0112455  .....................................................................................
FBpp0297502  .....................................................................................
FBpp0070352  .....................................................................................
FBpp0070351  .....................................................................................
FBpp0070402  .....................................................................................
FBpp0080138  fseppkklvyrnkytkinpnividclhneptiralkmlfdwlrinpeiligcyhsnpefvhkimkllnycnidiftrkvyferdl
FBpp0080139  fseppkklvyrnkytkinpnividclhneptiralkmlfdwlrinpeiligcyhsnpefvhkimkllnycnidiftrkvyferdl
FBpp0301685  .....................................................................................
FBpp0074609  .....................................................................................
FBpp0084171  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0305561  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0271718  .....................................................................................
FBpp0290895  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0293601  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0296963  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0305185  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0081607  .....................................................................................
FBpp0304082  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0303945  .....................................................................................
FBpp0303946  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0085344  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0297109  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070573  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0305905  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0076114  .....................................................................................
FBpp0076115  .....................................................................................
FBpp0305988  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0293601  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0303945  .....................................................................................
FBpp0303946  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0085409  .....................................................................................
FBpp0271717  .....................................................................................
FBpp0271719  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0303439  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0300561  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0076600  ettipkhhlnsswvqsliglaryemreyeaavaifetihktep..........................................
FBpp0305561  ettipkhhlnsswvqsliglaryemreyeaavaifetihktep..........................................
FBpp0071712  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0305602  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0079666  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  .....................................................................................
FBpp0082819  .....................................................................................
FBpp0292061  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0081805  .....................................................................................
FBpp0100021  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0074877  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0297722  .....................................................................................
FBpp0087232  rtakrlyetgeypkalakfvdlirim...........................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0075786  .....................................................................................
FBpp0075788  .....................................................................................
FBpp0306229  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0075789  .....................................................................................
FBpp0301715  .....................................................................................
FBpp0301716  .....................................................................................
FBpp0306230  .....................................................................................
FBpp0075785  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076498  .....................................................................................
FBpp0293529  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0297722  .....................................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  .....................................................................................
FBpp0089396  .....................................................................................
FBpp0111789  .....................................................................................
FBpp0086683  .....................................................................................
FBpp0289328  .....................................................................................
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0305185  .....................................................................................
FBpp0112213  .....................................................................................
FBpp0087233  rtakrlyetgeypkalakfvdlirimy..........................................................
FBpp0070906  .....................................................................................
FBpp0303990  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0082112  .....................................................................................
FBpp0086359  .....................................................................................
FBpp0293627  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0303989  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085047  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0082420  .....................................................................................
FBpp0306145  .....................................................................................
FBpp0303989  .....................................................................................
FBpp0305372  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  cihcneee.............................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0081398  .....................................................................................
FBpp0301016  .....................................................................................
FBpp0085015  .....................................................................................
FBpp0084188  .....................................................................................
FBpp0293235  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0304708  .....................................................................................
FBpp0305372  .....................................................................................
FBpp0304707  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  fielcr...............................................................................
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075443  .....................................................................................
FBpp0305287  .....................................................................................
FBpp0305288  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0303990  .....................................................................................
FBpp0073018  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0087626  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0085046  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0306202  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................


                                                                                                    
                                                                                                    
d1kt1a1        .....................................................................................
FBpp0112456  .....................................................................................
FBpp0297503  .....................................................................................
FBpp0112455  .....................................................................................
FBpp0297502  .....................................................................................
FBpp0070352  .....................................................................................
FBpp0070351  .....................................................................................
FBpp0070402  .....................................................................................
FBpp0080138  lttanvrdslvelfdvranvpltedfafknfdifqstqitldwetiirervtpqeesilrifkmvdfgffickqkkfnyrfcvkt
FBpp0080139  lttanvrdslvelfdvranvpltedfafknfdifqstqitldwetiirervtpqeesilrifkmvdfgffickqkkfnyrfcvkt
FBpp0301685  .....................................................................................
FBpp0074609  .....................................................................................
FBpp0084171  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0305561  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0271718  .....................................................................................
FBpp0290895  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0293601  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0296963  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0305185  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0081607  .....................................................................................
FBpp0304082  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0303945  .....................................................................................
FBpp0303946  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0085344  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0297109  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070573  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0305905  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0076114  .....................................................................................
FBpp0076115  .....................................................................................
FBpp0305988  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0293601  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0303945  .....................................................................................
FBpp0303946  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0085409  .....................................................................................
FBpp0271717  .....................................................................................
FBpp0271719  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0303439  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0300561  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0305561  .....................................................................................
FBpp0071712  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0305602  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0079666  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  .....................................................................................
FBpp0082819  .....................................................................................
FBpp0292061  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0081805  .....................................................................................
FBpp0100021  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0074877  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0297722  .....................................................................................
FBpp0087232  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0075786  .....................................................................................
FBpp0075788  .....................................................................................
FBpp0306229  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0075789  .....................................................................................
FBpp0301715  .....................................................................................
FBpp0301716  .....................................................................................
FBpp0306230  .....................................................................................
FBpp0075785  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076498  .....................................................................................
FBpp0293529  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0080720  ...........