SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

TPR-like alignments in Drosophila melanogaster 76_5

These alignments are sequences aligned to the 0052646 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d2fbna1        akk..................................................................................
FBpp0112456  aqqvvelrpydieswsvmireaqtrpihevrslyeslvnvfpttarywklyiememrsryyerveklfqrclvkilnidlwklyl
FBpp0297503  aqqvvelrpydieswsvmireaqtrpihevrslyeslvnvfpttarywklyiememrsryyerveklfqrclvkilnidlwklyl
FBpp0112455  aqqvvelrpydieswsvmireaqtrpihevrslyeslvnvfpttarywklyiememrsryyerveklfqrclvkilnidlwklyl
FBpp0297502  aqqvvelrpydieswsvmireaqtrpihevrslyeslvnvfpttarywklyiememrsryyerveklfqrclvkilnidlwklyl
FBpp0070352  daykeyefaegnpmsdvenpfekgkeylskgdipsavlc..............................................
FBpp0070351  daykeyefaegnpmsdvenpfekgkeylskgdipsavlc..............................................
FBpp0070402  ednlrknrmv...........................................................................
FBpp0080138  lyrslytaskqlddakrnvqsvgqlfqheieekrsllvqlckqiifkdyqsvgkkvrevmwrrgyyefiafvkknwhkqcqdaat
FBpp0080139  lyrslytaskqlddakrnvqsvgqlfqheieekrsllvqlckqiifkdyqsvgkkvrevmwrrgyyefiafvkknwhkqcqdaat
FBpp0301685  aqqvvelrpydieswsvmireaqtrpihevr......................................................
FBpp0074609  qkalqlmaeaekkltqqkgflgslfggsnkve.....................................................
FBpp0084171  nivhlydqlmvlnqrnlilinwknfcyihdqlqdafkqllleqlkfvcehkvdvffwkllfynvrnylkrqqtdqahthtlllie
FBpp0085420  geiwlaihhfekavtldpnfldayinlgnvlkearifdravaaylralnlspnnavvhgnlacvyyeqglidlaidtyrraielq
FBpp0085421  geiwlaihhfekavtldpnfldayinlgnvlkearifdravaaylralnlspnnavvhgnlacvyyeqglidlaidtyrraielq
FBpp0085422  geiwlaihhfekavtldpnfldayinlgnvlkearifdravaaylralnlspnnavvhgnlacvyyeqglidlaidtyrraielq
FBpp0085420  lelahreyqavdyesaekhcmqlwrqdstntgvllllssihfqcrrldksaqfstlaikqnpvlaeaysnlgnvfkergqlqeal
FBpp0085421  lelahreyqavdyesaekhcmqlwrqdstntgvllllssihfqcrrldksaqfstlaikqnpvlaeaysnlgnvfkergqlqeal
FBpp0085422  lelahreyqavdyesaekhcmqlwrqdstntgvllllssihfqcrrldksaqfstlaikqnpvlaeaysnlgnvfkergqlqeal
FBpp0077790  fark.................................................................................
FBpp0082545  e....................................................................................
FBpp0084693  vtarwsfeegikrpyfhvkpleraqlknwkdyldfeiekgdrervlvlfercliacalydefwlkmlrylesledqsgvvdlvrd
FBpp0084691  vtarwsfeegikrpyfhvkpleraqlknwkdyldfeiekgdrervlvlfercliacalydefwlkmlrylesledqsgvvdlvrd
FBpp0084692  vtarwsfeegikrpyfhvkpleraqlknwkdyldfeiekgdrervlvlfercliacalydefwlkmlrylesledqsgvvdlvrd
FBpp0084694  vtarwsfeegikrpyfhvkpleraqlknwkdyldfeiekgdrervlvlfercliacalydefwlkmlrylesledqsgvvdlvrd
FBpp0112211  vtarwsfeegikrpyfhvkpleraqlknwkdyldfeiekgdrervlvlfercliacalydefwlkmlrylesledqsgvvdlvrd
FBpp0072096  aeaedlvkqaekslklsml..................................................................
FBpp0071560  pqakpgvsyhariapnhlnvfinlanliaknqtrleead..............................................
FBpp0071561  pqakpgvsyhariapnhlnvfinlanliaknqtrleead..............................................
FBpp0077790  ek...................................................................................
FBpp0076600  pvtwcvsgncfslqkehetai................................................................
FBpp0305561  pvtwcvsgncfslqkehetai................................................................
FBpp0271716  medllnevvpqedlerfekkyhheleldgevttdtkfeyafclvrsryt....................................
FBpp0077790  kv...................................................................................
FBpp0271718  medllnevvpqedlerfekkyhheleldgevttdtkfeyafclvrsryt....................................
FBpp0290895  dwrdeeqlfrsaisinppkalgnlgsvlsaqgryeeaelt.............................................
FBpp0290896  eeqlfrsaisinppkalgnlgsvlsaqgryeeaelt.................................................
FBpp0081673  eeaealigqtdsaaneyakagm...............................................................
FBpp0293601  eslyrsaia............................................................................
FBpp0077614  eslyrsaia............................................................................
FBpp0084692  ravkedstdft..........................................................................
FBpp0084694  ravkedstdft..........................................................................
FBpp0112211  ravkedstdft..........................................................................
FBpp0084691  ravkedstdft..........................................................................
FBpp0084693  ravkedstdft..........................................................................
FBpp0296980  qs...................................................................................
FBpp0300832  qs...................................................................................
FBpp0080535  l....................................................................................
FBpp0296963  l....................................................................................
FBpp0296980  gdrtgmgkaygnmarmahmagsyeaavkyhkqela..................................................
FBpp0300832  gdrtgmgkaygnmarmahmagsyeaavkyhkqela..................................................
FBpp0072164  qyk..................................................................................
FBpp0084016  tisfretqelrnmwsallnmelvysnnfddvlkealncndpleiyisvvdilkknkrkdrlssv.....................
FBpp0296980  ckdtqa...............................................................................
FBpp0300832  ckdtqa...............................................................................
FBpp0296980  d....................................................................................
FBpp0300832  d....................................................................................
FBpp0080894  petccv...............................................................................
FBpp0305185  petccv...............................................................................
FBpp0081606  .....................................................................................
FBpp0081607  .....................................................................................
FBpp0304082  .....................................................................................
FBpp0084559  ravefyqenlklmrdlgdrgaq...............................................................
FBpp0075683  e....................................................................................
FBpp0303945  e....................................................................................
FBpp0303946  e....................................................................................
FBpp0081284  evs..................................................................................
FBpp0079468  rla..................................................................................
FBpp0087297  qqqdeartyfelavqsgrk..................................................................
FBpp0074835  k....................................................................................
FBpp0079893  gtfhllcgsyvesqqdfdaiiandyadpnlrayayikraalyiqldqrekgiadf..............................
FBpp0079894  gtfhllcgsyvesqqdfdaiiandyadpnlrayayikraalyiqldqrekgiadf..............................
FBpp0079895  gtfhllcgsyvesqqdfdaiiandyadpnlrayayikraalyiqldqrekgiadf..............................
FBpp0082765  lta..................................................................................
FBpp0079617  q....................................................................................
FBpp0084440  qf...................................................................................
FBpp0305670  i....................................................................................
FBpp0080423  i....................................................................................
FBpp0305671  i....................................................................................
FBpp0080424  a....................................................................................
FBpp0305672  a....................................................................................
FBpp0085344  esfekalkfsfgeqhvwrqyglslmaaekhshalrvlqesmkltpsdplpcllasrlcyesletvkqgldyaqqalkrevkglrp
FBpp0081552  as...................................................................................
FBpp0297109  esfekalkfsfgeqhvwrqyglslmaaekhshalrvlqesmkltpsdplpcllasrlcyesletvkqgldyaqqalkrevkglrp
FBpp0087646  dcktfeayllcgklhmalknysdalny..........................................................
FBpp0083769  clvengdfnrlfyvahklvdrypdkaiswyavgcyydmigksdparrylskataldrlygpawlayghsfaneneheqamaayfk
FBpp0070572  k....................................................................................
FBpp0070573  k....................................................................................
FBpp0070575  k....................................................................................
FBpp0305905  k....................................................................................
FBpp0074835  rdqwfqeaieaeksgavnccqsivkavigigveeedrkqtwiddaefcakenafecaravyahalqifpskksiwlraayfeknh
FBpp0305670  em...................................................................................
FBpp0080424  m....................................................................................
FBpp0305672  m....................................................................................
FBpp0080423  m....................................................................................
FBpp0305671  m....................................................................................
FBpp0076113  qs...................................................................................
FBpp0076114  qs...................................................................................
FBpp0076115  qs...................................................................................
FBpp0305988  qs...................................................................................
FBpp0072561  ynlarlneamssydva.....................................................................
FBpp0072562  ynlarlneamssydva.....................................................................
FBpp0072561  dqshllgrayfcllegdkmdqada.............................................................
FBpp0072562  dqshllgrayfcllegdkmdqada.............................................................
FBpp0085923  .....................................................................................
FBpp0293601  eilyqrigdvlgrlqqwdeaerhhraalelqpnqvaahlsygitlarnssraseaem............................
FBpp0079893  e....................................................................................
FBpp0079894  e....................................................................................
FBpp0079895  e....................................................................................
FBpp0075683  lr...................................................................................
FBpp0303945  lr...................................................................................
FBpp0303946  lr...................................................................................
FBpp0077614  eilyqrigdvlgrlqqwdeaerhhraalelqpnqvaahlsygitlarnssraseaem............................
FBpp0085409  ileelarthpdgrr.......................................................................
FBpp0271717  ileelarthpdgrr.......................................................................
FBpp0271719  ileelarthpdgrr.......................................................................
FBpp0086749  rslkvwsmyadleesfgtfktcka.............................................................
FBpp0073411  dekmlats.............................................................................
FBpp0070907  m....................................................................................
FBpp0303439  dekmlats.............................................................................
FBpp0070908  m....................................................................................
FBpp0085842  trk..................................................................................
FBpp0300561  eeie.................................................................................
FBpp0077718  fqflyyheadvqkahslcqavleverqkpsgstgctlswwwqqqmgrcllalhyprraepflqqsltsfphpdtylllsrvyqri
FBpp0296980  fr...................................................................................
FBpp0300832  fr...................................................................................
FBpp0076600  esd..................................................................................
FBpp0305561  esd..................................................................................
FBpp0071712  i....................................................................................
FBpp0086749  ehfvskhgksnhqlwnelcdlisknphkvhslnvdaiirgglrrytdql....................................
FBpp0085479  la...................................................................................
FBpp0112016  i....................................................................................
FBpp0292906  kkereanal............................................................................
FBpp0305602  aln..................................................................................
FBpp0079665  aln..................................................................................
FBpp0079666  aln..................................................................................
FBpp0079664  aln..................................................................................
FBpp0084076  a....................................................................................
FBpp0111406  rv...................................................................................
FBpp0074918  ay...................................................................................
FBpp0082818  pgslrvmkfkamr........................................................................
FBpp0074480  elkqyknglklakqilsnpkymehgetlamkgltlnglgrreeaykyvrl...................................
FBpp0082819  ldtarfdiatkctkqlal...................................................................
FBpp0292061  svad.................................................................................
FBpp0085279  laealskakeafsldrtlhqfrdqhgenvyhnfdltyaqyersemhiealntysimaknkmfphvnqlklnmgniyysmgiyqka
FBpp0081805  afrsvad..............................................................................
FBpp0100021  wsade................................................................................
FBpp0100023  wsade................................................................................
FBpp0074877  wsade................................................................................
FBpp0071879  slqynrglvleelhmftlaaenyksitkeyssyhdcylrlgvmaiqknnhtqaiehlkdilvednlnmtartymgdcfkglsldk
FBpp0084559  gtedlrtl.............................................................................
FBpp0075591  sre..................................................................................
FBpp0076526  ekarsdgnrdqv.........................................................................
FBpp0079851  lhi..................................................................................
FBpp0290395  lnkalvylrqndvhqaietlqmydrksegsmtasaltnlsfiyislgnlemashcvnqlheigslknnapglinagivelgshnl
FBpp0072146  lh...................................................................................
FBpp0296980  q....................................................................................
FBpp0300832  q....................................................................................
FBpp0083238  ev...................................................................................
FBpp0111383  eq...................................................................................
FBpp0080424  yd...................................................................................
FBpp0305672  yd...................................................................................
FBpp0305670  yd...................................................................................
FBpp0071560  qaa..................................................................................
FBpp0071561  qaa..................................................................................
FBpp0080423  yd...................................................................................
FBpp0305671  yd...................................................................................
FBpp0071879  .....................................................................................
FBpp0077738  mdaalavyhkaedwfsqvkilcylgkiskadai....................................................
FBpp0077934  lrd..................................................................................
FBpp0292775  mdaalavyhkaedwfsqvkilcylgkiskadai....................................................
FBpp0087646  nghletat.............................................................................
FBpp0292906  deh..................................................................................
FBpp0079664  deh..................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  a....................................................................................
FBpp0077619  n....................................................................................
FBpp0086164  lta..................................................................................
FBpp0297722  lta..................................................................................
FBpp0087232  aae..................................................................................
FBpp0072561  y....................................................................................
FBpp0072562  y....................................................................................
FBpp0088148  eavrtwrsalkgtcqredcfqllgyly..........................................................
FBpp0088149  eavrtwrsalkgtcqredcfqllgyly..........................................................
FBpp0075786  l....................................................................................
FBpp0075788  l....................................................................................
FBpp0306229  l....................................................................................
FBpp0075787  l....................................................................................
FBpp0075789  l....................................................................................
FBpp0301715  l....................................................................................
FBpp0301716  l....................................................................................
FBpp0306230  l....................................................................................
FBpp0075785  l....................................................................................
FBpp0083319  nkfg.................................................................................
FBpp0076498  se...................................................................................
FBpp0293529  se...................................................................................
FBpp0290580  .....................................................................................
FBpp0290395  avffnlaeqyersemhiealntysimaknk.......................................................
FBpp0080720  w....................................................................................
FBpp0086164  lm...................................................................................
FBpp0297722  lm...................................................................................
FBpp0080741  davamarratvliaeigrdknmeif............................................................
FBpp0087297  fv...................................................................................
FBpp0070720  hvwlkylkarlvvtqtdeerkafeeqcakalgyyysiplseyvvnylvdqgnvqnhvlwaklladydverpdfgdklrslistit
FBpp0089396  hvwlkylkarlvvtqtdeerkafeeqcakalgyyysiplseyvvnylvdqgnvqnhvlwaklladydverpdfgdklrslistit
FBpp0111789  hvwlkylkarlvvtqtdeerkafeeqcakalgyyysiplseyvvnylvdqgnvqnhvlwaklladydverpdfgdklrslistit
FBpp0086683  k....................................................................................
FBpp0289328  nllnqvdqlgekfealrmylssvgyelhrslnekvqyvsnpinafsllrrthedlpkwheyfkeaigegnqsilvdlvkmvpndv
FBpp0070667  dgl..................................................................................
FBpp0082624  qql..................................................................................
FBpp0081552  re...................................................................................
FBpp0086749  rtr..................................................................................
FBpp0087646  ainwyvqneetda........................................................................
FBpp0071879  vaqmylhegelnrskaf....................................................................
FBpp0080894  ygvvlkalnlnqaaeqmlvqairlvpmlwsaylelsplimekkkllslqlgghwmrhffmahtylelylnddglkiyedlqasgf
FBpp0305185  ygvvlkalnlnqaaeqmlvqairlvpmlwsaylelsplimekkkllslqlgghwmrhffmahtylelylnddglkiyedlqasgf
FBpp0112213  r....................................................................................
FBpp0087233  eirv.................................................................................
FBpp0070906  y....................................................................................
FBpp0303990  y....................................................................................
FBpp0087646  iklgkhaeaipkcqrllksepenamgylllgaayqnidkaeaaknlrqcikctdgpapaallglancapsnelpeiydqladlqp
FBpp0082112  eyaal................................................................................
FBpp0086359  fl...................................................................................
FBpp0293627  fl...................................................................................
FBpp0076526  ltssvdyaklkgly.......................................................................
FBpp0085279  el...................................................................................
FBpp0074835  l....................................................................................
FBpp0303989  gev..................................................................................
FBpp0078887  yte..................................................................................
FBpp0290580  t....................................................................................
FBpp0085047  qynsslkpid...........................................................................
FBpp0296980  v....................................................................................
FBpp0300832  v....................................................................................
FBpp0086380  h....................................................................................
FBpp0083435  gingqaveelf..........................................................................
FBpp0078891  whlataivychdgqfenalkilhgstnlesmalsvqcllrlqrvdlakqlvakmq..............................
FBpp0082419  asglptsassedlsqslseytdadesvsapteflaeflsa.............................................
FBpp0082420  asglptsassedlsqslseytdadesvsapteflaeflsa.............................................
FBpp0306145  asglptsassedlsqslseytdadesvsapteflaeflsa.............................................
FBpp0303989  yknshlwsglamrflkgyanprtiidvlrqaakacvvkrdfaranllicqavrrareyfgpthqkygdalldygffllnvdsvfq
FBpp0305372  ged..................................................................................
FBpp0086749  eeeilrnaysvkhwlryidhkakapnngvnm......................................................
FBpp0078027  ieqg.................................................................................
FBpp0088148  hra..................................................................................
FBpp0088149  hra..................................................................................
FBpp0290863  my...................................................................................
FBpp0080720  qreqydkaeqmlhlalrmaqdiqskdg..........................................................
FBpp0083319  vqla.................................................................................
FBpp0071288  qrmiiddmqekfprepglwdllaqrelrgfhlgdleeedldtsdeepaskksrsvngrslkrriqlcvtvyksaveelqttemwn
FBpp0081398  elfsqgsrnflvksydeaadelsqvcqlyeevygeladelgqplllyakaliamaldenkvidvpdeaaddddedvdddeeesae
FBpp0301016  elfsqgsrnflvksydeaadelsqvcqlyeevygeladelgqplllyakaliamaldenkvidvpdeaaddddedvdddeeesae
FBpp0085015  rwr..................................................................................
FBpp0084188  v....................................................................................
FBpp0293235  v....................................................................................
FBpp0290580  lrdalkdyeqalelylp....................................................................
FBpp0085012  syvnhdyyhtvlwmneamarmleeptnh.........................................................
FBpp0086380  t....................................................................................
FBpp0304708  dhs..................................................................................
FBpp0305372  t....................................................................................
FBpp0304707  s....................................................................................
FBpp0071879  n....................................................................................
FBpp0076961  pteqqr...............................................................................
FBpp0075717  lq...................................................................................
FBpp0080267  agnds................................................................................
FBpp0070907  nyk..................................................................................
FBpp0085033  lsv..................................................................................
FBpp0082507  qclqalftfmppskve.....................................................................
FBpp0077738  iwtnlakmcvhtnrldvakvcmghleqarsvralrqaied.............................................
FBpp0292775  iwtnlakmcvhtnrldvakvcmghleqarsvralrqaied.............................................
FBpp0085676  sdevlh...............................................................................
FBpp0087091  vef..................................................................................
FBpp0082624  sm...................................................................................
FBpp0070908  eqrrraaecyrqigntdmaietllqvpptlrsprinlmlarlqhhgsrhgttkk...............................
FBpp0070431  lnvwyvktldaafeaa.....................................................................
FBpp0075443  qahd.................................................................................
FBpp0305287  qahd.................................................................................
FBpp0305288  qahd.................................................................................
FBpp0070906  iid..................................................................................
FBpp0303990  iid..................................................................................
FBpp0073018  lrv..................................................................................
FBpp0078634  ai...................................................................................
FBpp0087626  sknlreegnlmfkesasgsskdsvl............................................................
FBpp0075754  yfslvgllr............................................................................
FBpp0087625  sknlreegnlmfkesasgsskdsvl............................................................
FBpp0071288  rl...................................................................................
FBpp0085046  la...................................................................................
FBpp0110159  la...................................................................................
FBpp0072679  qraeisaf.............................................................................
FBpp0306202  qraeisaf.............................................................................
FBpp0082624  w....................................................................................
FBpp0084254  m....................................................................................
FBpp0085032  t....................................................................................


                                                                                                    
                                                                                                    
d2fbna1        .....................................................................................
FBpp0112456  tyvketksglsthkekmaqaydfalekigmdlhsfsiwqdyiyflrgveavgnyaenqkitavrrvyqkavvtpivgieqlwkdy
FBpp0297503  tyvketksglsthkekmaqaydfalekigmdlhsfsiwqdyiyflrgveavgnyaenqkitavrrvyqkavvtpivgieqlwkdy
FBpp0112455  tyvketksglsthkekmaqaydfalekigmdlhsfsiwqdyiyflrgveavgnyaenqkitavrrvyqkavvtpivgieqlwkdy
FBpp0297502  tyvketksglsthkekmaqaydfalekigmdlhsfsiwqdyiyflrgveavgnyaenqkitavrrvyqkavvtpivgieqlwkdy
FBpp0070352  .....................................................................................
FBpp0070351  .....................................................................................
FBpp0070402  .....................................................................................
FBpp0080138  aqenmqklerflcagifnykrlsarmeeiydldlkylidfsiisdgyisdmigdtmesshsgthavdksleavsfaldtihssll
FBpp0080139  aqenmqklerflcagifnykrlsarmeeiydldlkylidfsiisdgyisdmigdtmesshsgthavdksleavsfaldtihssll
FBpp0301685  .....................................................................................
FBpp0074609  .....................................................................................
FBpp0084171  qaikfyrmlydklmakcvassrcdsalkvvaqrlliclgdltryrvnh.....................................
FBpp0085420  pnfpdaycnlanalkekgqvkeaedcyntalrlcsnhadslnnlanikreqgyieeat...........................
FBpp0085421  pnfpdaycnlanalkekgqvkeaedcyntalrlcsnhadslnnlanikreqgyieeat...........................
FBpp0085422  pnfpdaycnlanalkekgqvkeaedcyntalrlcsnhadslnnlanikreqgyieeat...........................
FBpp0085420  dnyrravrlkpdfidgyinlaaalvaardmesavqa.................................................
FBpp0085421  dnyrravrlkpdfidgyinlaaalvaardmesavqa.................................................
FBpp0085422  dnyrravrlkpdfidgyinlaaalvaardmesavqa.................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084693  vyrracrih............................................................................
FBpp0084691  vyrracrih............................................................................
FBpp0084692  vyrracrih............................................................................
FBpp0084694  vyrracrih............................................................................
FBpp0112211  vyrracrih............................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0305561  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0271718  .....................................................................................
FBpp0290895  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0293601  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0296963  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0305185  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0081607  .....................................................................................
FBpp0304082  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0303945  .....................................................................................
FBpp0303946  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0085344  srsqlfvgighqqlaiqsnlkserdachklaldaleravqfdgndhlaeyylslqyallgqlaealvhirfalalrmehapclhl
FBpp0081552  .....................................................................................
FBpp0297109  srsqlfvgighqqlaiqsnlkserdachklaldaleravqfdgndhlaeyylslqyallgqlaealvhirfalalrmehapclhl
FBpp0087646  .....................................................................................
FBpp0083769  atqlmrgchlpllyigvecgltknlela.........................................................
FBpp0070572  .....................................................................................
FBpp0070573  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0305905  .....................................................................................
FBpp0074835  gtresle..............................................................................
FBpp0305670  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0076114  .....................................................................................
FBpp0076115  .....................................................................................
FBpp0305988  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0293601  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0303945  .....................................................................................
FBpp0303946  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0085409  .....................................................................................
FBpp0271717  .....................................................................................
FBpp0271719  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0303439  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0300561  .....................................................................................
FBpp0077718  kqperallvigevvdsrpfdvtyrleqarihqameqqedalq...........................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0305561  .....................................................................................
FBpp0071712  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0305602  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0079666  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  .....................................................................................
FBpp0082819  .....................................................................................
FBpp0292061  .....................................................................................
FBpp0085279  vkmyrmaldsvpkslsqlrlkirenigilfirmgsysdaassfefimteranirssihlllcyfalgdvekvklafrrlcdvqte
FBpp0081805  .....................................................................................
FBpp0100021  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0074877  .....................................................................................
FBpp0071879  fatfnynmilarqskftntyvsmamgnfc........................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0290395  ilas.................................................................................
FBpp0072146  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0297722  .....................................................................................
FBpp0087232  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0075786  .....................................................................................
FBpp0075788  .....................................................................................
FBpp0306229  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0075789  .....................................................................................
FBpp0301715  .....................................................................................
FBpp0301716  .....................................................................................
FBpp0306230  .....................................................................................
FBpp0075785  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076498  .....................................................................................
FBpp0293529  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0297722  .....................................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  deneaaafvemlqkhcvtwtcnveqrqmiksvvdkfkqhldettrgwdwseqhkahvydvetlsldddlknavirfifersvakf
FBpp0089396  deneaaafvemlqkhcvtwtcnveqrqmiksvvdkfkqhldettrgwdwseqhkahvydvetlsldddlknavirfifersvakf
FBpp0111789  deneaaafvemlqkhcvtwtcnveqrqmiksvvdkfkqhldettrgwdwseqhkahvydvetlsldddlknavirfifersvakf
FBpp0086683  .....................................................................................
FBpp0289328  dmlsamhgiqriekiydlkiddlaqgvlqgvqynvqlt...............................................
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0305185  .....................................................................................
FBpp0112213  .....................................................................................
FBpp0087233  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0303990  .....................................................................................
FBpp0087646  eqslnyweklfnlasdsnvapfcftvlkkrvqdtengnftkiqeylgriwvsndfeiapedtqlykttmeallqnsepsarsvvy
FBpp0082112  .....................................................................................
FBpp0086359  .....................................................................................
FBpp0293627  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0303989  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085047  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0082420  .....................................................................................
FBpp0306145  .....................................................................................
FBpp0303989  svniykealavrrgifgnmnfhvaiahedlsyayyvhe...............................................
FBpp0305372  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0071288  myldamlalnsdgkterilkqqcladalqaghrsqlmgvkhyatlrkmlctapsgreaavtiltealkndssvemhelllathiq
FBpp0081398  dgaakkeekkdtkeaangasssngkeldtikegsdeadstgeaeqaqsdekpskkvptgvdevsssnggggaavndderpstsng
FBpp0301016  dgaakkeekkdtkeaangasssngkeldtikegsdeadstgeaeqaqsdekpskkvptgvdevsssnggggaavndderpstsng
FBpp0085015  .....................................................................................
FBpp0084188  .....................................................................................
FBpp0293235  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0304708  .....................................................................................
FBpp0305372  .....................................................................................
FBpp0304707  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  .....................................................................................
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075443  .....................................................................................
FBpp0305287  .....................................................................................
FBpp0305288  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0303990  .....................................................................................
FBpp0073018  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0087626  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0085046  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0306202  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................


                                                                                                    
                                                                                                    
d2fbna1        .....................................................................................
FBpp0112456  iafeqninpiisekmslerskdymnarrvakeleyhtkglnrnlpavpptltkeevkqvelwkrfityeksnplrtedtalvtrr
FBpp0297503  iafeqninpiisekmslerskdymnarrvakeleyhtkglnrnlpavpptltkeevkqvelwkrfityeksnplrtedtalvtrr
FBpp0112455  iafeqninpiisekmslerskdymnarrvakeleyhtkglnrnlpavpptltkeevkqvelwkrfityeksnplrtedtalvtrr
FBpp0297502  iafeqninpiisekmslerskdymnarrvakeleyhtkglnrnlpavpptltkeevkqvelwkrfityeksnplrtedtalvtrr
FBpp0070352  .....................................................................................
FBpp0070351  .....................................................................................
FBpp0070402  .....................................................................................
FBpp0080138  slgdlhryfldfridsklsiskeq.............................................................
FBpp0080139  slgdlhryfldfridsklsiskeq.............................................................
FBpp0301685  .....................................................................................
FBpp0074609  .....................................................................................
FBpp0084171  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0305561  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0271718  .....................................................................................
FBpp0290895  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0293601  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0296963  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0305185  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0081607  .....................................................................................
FBpp0304082  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0303945  .....................................................................................
FBpp0303946  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0085344  fallltssrrprealgvvedalhefpdnlqllhvkahlqlhledaetalgtvqhmlavwrdvyeaqlageeekhsdtksgvhlah
FBpp0081552  .....................................................................................
FBpp0297109  fallltssrrprealgvvedalhefpdnlqllhvkahlqlhledaetalgtvqhmlavwrdvyeaqlageeekhsdtksgvhlah
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070573  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0305905  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0076114  .....................................................................................
FBpp0076115  .....................................................................................
FBpp0305988  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0293601  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0303945  .....................................................................................
FBpp0303946  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0085409  .....................................................................................
FBpp0271717  .....................................................................................
FBpp0271719  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0303439  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0300561  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0305561  .....................................................................................
FBpp0071712  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0305602  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0079666  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  .....................................................................................
FBpp0082819  .....................................................................................
FBpp0292061  .....................................................................................
FBpp0085279  aiesdmesetniiklqqqaepiqqigetdgyqslnnepvtgsvikaegggklnetvkfaatvkhryvvqalkkdelavyrnerrn
FBpp0081805  .....................................................................................
FBpp0100021  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0074877  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0297722  .....................................................................................
FBpp0087232  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0075786  .....................................................................................
FBpp0075788  .....................................................................................
FBpp0306229  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0075789  .....................................................................................
FBpp0301715  .....................................................................................
FBpp0301716  .....................................................................................
FBpp0306230  .....................................................................................
FBpp0075785  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076498  .....................................................................................
FBpp0293529  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0297722  .....................................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  pivdvlwlsyiefiqfegvtvpenedenevtaemvakrakrlgkgflrnteldlanrgvrshpsvqlnhrfldlmersdfelaev
FBpp0089396  pivdvlwlsyiefiqfegvtvpenedenevtaemvakrakrlgkgflrnteldlanrgvrshpsvqlnhrfldlmersdfelaev
FBpp0111789  pivdvlwlsyiefiqfegvtvpenedenevtaemvakrakrlgkgflrnteldlanrgvrshpsvqlnhrfldlmersdfelaev
FBpp0086683  .....................................................................................
FBpp0289328  .....................................................................................
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0305185  .....................................................................................
FBpp0112213  .....................................................................................
FBpp0087233  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0303990  .....................................................................................
FBpp0087646  krylkwlykkqdyetcvrhacnmteshpkdvygfewicktycehheqseivswqqelrhpiqv......................
FBpp0082112  .....................................................................................
FBpp0086359  .....................................................................................
FBpp0293627  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0303989  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085047  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0082420  .....................................................................................
FBpp0306145  .....................................................................................
FBpp0303989  .....................................................................................
FBpp0305372  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0071288  sdsepliyelfnkiqksmgsealplwrsvilyyrtrqdslgarrlde......................................
FBpp0081398  evtascsngaapaveeepeeeegvsgslqlaweileaaaqifsrqglsg....................................
FBpp0301016  evtascsngaapaveeepeeeegvsgslqlaweileaaaqifsrqglsg....................................
FBpp0085015  .....................................................................................
FBpp0084188  .....................................................................................
FBpp0293235  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0304708  .....................................................................................
FBpp0305372  .....................................................................................
FBpp0304707  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  .....................................................................................
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075443  .....................................................................................
FBpp0305287  .....................................................................................
FBpp0305288  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0303990  .....................................................................................
FBpp0073018  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0087626  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0085046  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0306202  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................


                                                                                                    
                                                                                                    
d2fbna1        .....................................................................................
FBpp0112456  vmfateqcllvlthhpavwhqasqfldts........................................................
FBpp0297503  vmfateqcllvlthhpavwhqasqfldts........................................................
FBpp0112455  vmfateqcllvlthhpavwhqasqfldtsarvltekgvrtsvenispilcvpvvnqiewvmafawwwakdvqaakifadecanil
FBpp0297502  vmfateqcllvlthhpavwhqasqfldtsarvltekgvrtsvenispilcvpvvnqiewvmafawwwakdvqaakifadecanil
FBpp0070352  .....................................................................................
FBpp0070351  .....................................................................................
FBpp0070402  .....................................................................................
FBpp0080138  .....................................................................................
FBpp0080139  .....................................................................................
FBpp0301685  .....................................................................................
FBpp0074609  .....................................................................................
FBpp0084171  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0305561  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0271718  .....................................................................................
FBpp0290895  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0293601  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0296963  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0305185  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0081607  .....................................................................................
FBpp0304082  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0303945  .....................................................................................
FBpp0303946  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0085344  ssqmsdkdsnsvyaaslaavsrveqalseaasslssftqrpgprrpwml....................................
FBpp0081552  .....................................................................................
FBpp0297109  ssqmsdkdsisrveqalseaasslssftqrpgprrpwml..............................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070573  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0305905  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0076114  .....................................................................................
FBpp0076115  .....................................................................................
FBpp0305988  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0293601  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0303945  .....................................................................................
FBpp0303946  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0085409  .....................................................................................
FBpp0271717  .....................................................................................
FBpp0271719  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0303439  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0300561  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0305561  .....................................................................................
FBpp0071712  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0305602  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0079666  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  .....................................................................................
FBpp0082819  .....................................................................................
FBpp0292061  .....................................................................................
FBpp0085279  avkrsitmivdlispfiednyndgynwcieiiktsnlawlanelelnkalvylrqndvhqaietlqmydrksegsmtasaltnls
FBpp0081805  .....................................................................................
FBpp0100021  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0074877  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0297722  .....................................................................................
FBpp0087232  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0075786  .....................................................................................
FBpp0075788  .....................................................................................
FBpp0306229  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0075789  .....................................................................................
FBpp0301715  .....................................................................................
FBpp0301716  .....................................................................................
FBpp0306230  .....................................................................................
FBpp0075785  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076498  .....................................................................................
FBpp0293529  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0297722  .....................................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  deeirlilqrivtdmdmtvelhldyla..........................................................
FBpp0089396  deeirlilqrivtdmdmtvelhldyla..........................................................
FBpp0111789  deeirlilqrivtdmdmtvelhldyla..........................................................
FBpp0086683  .....................................................................................
FBpp0289328  .....................................................................................
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0305185  .....................................................................................
FBpp0112213  .....................................................................................
FBpp0087233  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0303990  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0082112  .....................................................................................
FBpp0086359  .....................................................................................
FBpp0293627  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0303989  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085047  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0082420  .....................................................................................
FBpp0306145  .....................................................................................
FBpp0303989  .....................................................................................
FBpp0305372  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0081398  .....................................................................................
FBpp0301016  .....................................................................................
FBpp0085015  .....................................................................................
FBpp0084188  .....................................................................................
FBpp0293235  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0304708  .....................................................................................
FBpp0305372  .....................................................................................
FBpp0304707  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  .....................................................................................
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075443  .....................................................................................
FBpp0305287  .....................................................................................
FBpp0305288  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0303990  .....................................................................................
FBpp0073018  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0087626  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0085046  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0306202  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................


                                                                   10        20           30        
                                                                    |         |            |        
d2fbna1        ............................................---SIYDYTDEEKVQSAFDIKEEGNEF.FK..KN...EINE
FBpp0112456  ............................................-----------------------ARVL.TE..KG...DVQA
FBpp0297503  ............................................-----------------------ARVL.TE..KG...DVQA
FBpp0112455  .....................................ersingv-------------------LNRNALLY.FA..YA...DFEE
FBpp0297502  .....................................ersingv-------------------LNRNALLY.FA..YA...DFEE
FBpp0070352  ............................................-----FEVAAKKQPERAEVWQLLGTSQ.TE..NE...MDPQ
FBpp0070351  ............................................-----FEVAAKKQPERAEVWQLLGTSQ.TE..NE...MDPQ
FBpp0070402  ............................................----------------VSHWIKYAQWE.EQ..QQ...EIQR
FBpp0080138  ............................................---------------------------.--..--...----
FBpp0080139  ............................................---------------------------.--..--...----
FBpp0301685  ............................................---SLYESLVNVFPTTARYWKLYIEME.MR..SR...YYER
FBpp0074609  ............................................--------------DAIECYQRAGNMF.KM..SK...NWTK
FBpp0084171  ............................................---------------------------.--..--...----
FBpp0085420  ............................................---------------------------.--..--...----
FBpp0085421  ............................................---------------------------.--..--...----
FBpp0085422  ............................................---------------------------.--..--...----
FBpp0085420  ............................................-----YITALQYNPDLYCVRSDLGNLL.KA..LG...RLEE
FBpp0085421  ............................................-----YITALQYNPDLYCVRSDLGNLL.KA..LG...RLEE
FBpp0085422  ............................................-----YITALQYNPDLYCVRSDLGNLL.KA..LG...RLEE
FBpp0077790  ............................................-------------------EKELGNAA.YK..KK...DFET
FBpp0082545  ............................................---QLFKSALQVCPDNAKVHYNIARLA.TD..MG...NNTK
FBpp0084693  ............................................------------HPDKPSLHLMWAAFE.EC..QM...NFDD
FBpp0084691  ............................................------------HPDKPSLHLMWAAFE.EC..QM...NFDD
FBpp0084692  ............................................------------HPDKPSLHLMWAAFE.EC..QM...NFDD
FBpp0084694  ............................................------------HPDKPSLHLMWAAFE.EC..QM...NFDD
FBpp0112211  ............................................------------HPDKPSLHLMWAAFE.EC..QM...NFDD
FBpp0072096  ............................................-------KWVPDYDSAADEYSKAATAY.RI..AK...SYDK
FBpp0071560  ............................................---HLYRQAISMRSDYVQAYINRGDIL.MK..LN...RTAQ
FBpp0071561  ............................................---HLYRQAISMRSDYVQAYINRGDIL.MK..LN...RTAQ
FBpp0077790  ............................................----------------AEEEKEQGNLF.FK..KG...DYST
FBpp0076600  ............................................---KFFKRAVQVDPDFVYSYTLLGHEL.VL..TE...EFDK
FBpp0305561  ............................................---KFFKRAVQVDPDFVYSYTLLGHEL.VL..TE...EFDK
FBpp0271716  ............................................---------------------------.--..--...----
FBpp0077790  ............................................-----------------NELKEKGNQA.LS..AE...KFDE
FBpp0271718  ............................................---------------------------.--..--...----
FBpp0290895  ............................................-----LRMTLGHRPTMADAHFNLGVVH.QK..QL...NFSS
FBpp0290896  ............................................-----LRMTLGHRPTMADAHFNLGVVH.QK..QL...NFSS
FBpp0081673  ............................................-------------------YFKAATAY.RI..AK...SFDK
FBpp0293601  ............................................-----------INP--PKALGNLGSVL.SS..QG...RYEE
FBpp0077614  ............................................-----------INP--PKALGNLGSVL.SS..QG...RYEE
FBpp0084692  ............................................---------------------------.--..--...----
FBpp0084694  ............................................---------------------------.--..--...----
FBpp0112211  ............................................---------------------------.--..--...----
FBpp0084691  ............................................---------------------------.--..--...----
FBpp0084693  ............................................---------------------------.--..--...----
FBpp0296980  ............................................------------------------NAA.CQ..SG...DFAT
FBpp0300832  ............................................------------------------NAA.CQ..SG...DFAT
FBpp0080535  ............................................----------------AESIKNEGNRL.MK..EN...KYNE
FBpp0296963  ............................................----------------AESIKNEGNRL.MK..EN...KYNE
FBpp0296980  ............................................-----INQAMNDRSAEAATHGNLAVAY.QA..LG...AHDA
FBpp0300832  ............................................-----INQAMNDRSAEAATHGNLAVAY.QA..LG...AHDA
FBpp0072164  ............................................---------------KANDIKDRGNTY.VK..QG...EYEK
FBpp0084016  ............................................-----LTTVLNKFKTELRVWPVAAEAY.FW..LG...KSDQ
FBpp0296980  ............................................---------------AAAALTSLGHVY.TA..SG...DYPN
FBpp0300832  ............................................---------------AAAALTSLGHVY.TA..SG...DYPN
FBpp0296980  ............................................---------------RARALGHLGDCY.AA..LG...DYEE
FBpp0300832  ............................................---------------RARALGHLGDCY.AA..LG...DYEE
FBpp0080894  ............................................----------------------IGNYY.SI..RC...DHQV
FBpp0305185  ............................................----------------------IGNYY.SI..RC...DHQV
FBpp0081606  ............................................----------------AEQYKNQGNEM.LK..TK...EFSK
FBpp0081607  ............................................----------------AEQYKNQGNEM.LK..TK...EFSK
FBpp0304082  ............................................----------------AEQYKNQGNEM.LK..TK...EFSK
FBpp0084559  ............................................----------------GRACGNLGNTY.YL..LG...DFQA
FBpp0075683  ............................................-----------NHPAVAATLNNLAVLY.GK..RG...KYKD
FBpp0303945  ............................................-----------NHPAVAATLNNLAVLY.GK..RG...KYKD
FBpp0303946  ............................................-----------NHPAVAATLNNLAVLY.GK..RG...KYKD
FBpp0081284  ............................................---------------DAGSYKDKGNEA.FK..AS...RWEE
FBpp0079468  ............................................---------------EAKVYKEKGTNY.FK..KE...NWAL
FBpp0087297  ............................................----------------LESYVRLAELY.RK..DK...QYQK
FBpp0074835  ............................................------------------LWMMKGQIE.EQ..QR...RTDD
FBpp0079893  ............................................------AEAERLNPENPDVYHQRAQIL.LL..LE...QIEP
FBpp0079894  ............................................------AEAERLNPENPDVYHQRAQIL.LL..LE...QIEP
FBpp0079895  ............................................------AEAERLNPENPDVYHQRAQIL.LL..LE...QIEP
FBpp0082765  ............................................------------NKEKADKLKVEGNEL.FK..ND...DAEG
FBpp0079617  ............................................-------------------LKEQGNCL.FA..AR...KYDD
FBpp0084440  ............................................----------------AERHRLRGNES.FK..AK...EYEN
FBpp0305670  ............................................----------------AEEKKKLGNDQ.YK..AQ...NYQN
FBpp0080423  ............................................----------------AEEKKKLGNDQ.YK..AQ...NYQN
FBpp0305671  ............................................----------------AEEKKKLGNDQ.YK..AQ...NYQN
FBpp0080424  ............................................-----------------EEKKKLGNDQ.YK..AQ...NYQN
FBpp0305672  ............................................-----------------EEKKKLGNDQ.YK..AQ...NYQN
FBpp0085344  ............................................---------------QIEIWLLLADVY.LR..ID...QPNE
FBpp0081552  ............................................-------------PADIENHLELGKEF.LA..RG...QLSD
FBpp0297109  ............................................---------------QIEIWLLLADVY.LR..ID...QPNE
FBpp0087646  ............................................-----VLKATRLRPHFAECFDYLGKLYpLA..TG...DFSR
FBpp0083769  ............................................--EKFFLQAMNIAPLDVYVLHELGVIK.YE..YE...FFDG
FBpp0070572  ............................................--------ATEEEVEQASELRAQAASA.YG..QQ...KFDE
FBpp0070573  ............................................--------ATEEEVEQASELRAQAASA.YG..QQ...KFDE
FBpp0070575  ............................................--------ATEEEVEQASELRAQAASA.YG..QQ...KFDE
FBpp0305905  ............................................--------ATEEEVEQASELRAQAASA.YG..QQ...KFDE
FBpp0074835  ............................................---ALLQRAVAHCPKSEILWLMGAKSK.WM..AG...DVPA
FBpp0305670  ............................................--------------------KENGNML.FK..SG...RYRE
FBpp0080424  ............................................--------------------KENGNML.FK..SG...RYRE
FBpp0305672  ............................................--------------------KENGNML.FK..SG...RYRE
FBpp0080423  ............................................--------------------KENGNML.FK..SG...RYRE
FBpp0305671  ............................................--------------------KENGNML.FK..SG...RYRE
FBpp0076113  ............................................-----------------------GNHF.YQ..LG...RYHE
FBpp0076114  ............................................-----------------------GNHF.YQ..LG...RYHE
FBpp0076115  ............................................-----------------------GNHF.YQ..LG...RYHE
FBpp0305988  ............................................-----------------------GNHF.YQ..LG...RYHE
FBpp0072561  ............................................--DKLYKEILKEHPNYIDCYLRLGCMA.RD..KG...LIFV
FBpp0072562  ............................................--DKLYKEILKEHPNYIDCYLRLGCMA.RD..KG...LIFV
FBpp0072561  ............................................----QFNFVLNQSPSNIPSLLGKACIA.FN..RK...DYRG
FBpp0072562  ............................................----QFNFVLNQSPSNIPSLLGKACIA.FN..RK...DYRG
FBpp0085923  ............................................-------------PTEIEVYKKEGNDF.LE..NG...KLVD
FBpp0293601  ............................................----WFKRALKLAPEQASVYHHYAEFL.SL..QS...RHHE
FBpp0079893  ............................................----------------ANNYKTEGNNC.YR..NG...KYDE
FBpp0079894  ............................................----------------ANNYKTEGNNC.YR..NG...KYDE
FBpp0079895  ............................................----------------ANNYKTEGNNC.YR..NG...KYDE
FBpp0075683  ............................................------------------TLHNLVIQY.AS..QG...RYEV
FBpp0303945  ............................................------------------TLHNLVIQY.AS..QG...RYEV
FBpp0303946  ............................................------------------TLHNLVIQY.AS..QG...RYEV
FBpp0077614  ............................................----WFKRALKLAPEQASVYHHYAEFL.SL..QS...RHHE
FBpp0085409  ............................................---------------------------.--..--...----
FBpp0271717  ............................................---------------------------.--..--...----
FBpp0271719  ............................................---------------------------.--..--...----
FBpp0086749  ............................................----VYERIIDLKICTPQIIINYGMFL.EE..HN...YFEE
FBpp0073411  ............................................------------------TLRERGNNF.YK..AS...RFTE
FBpp0070907  ............................................--------------------MALGKCL.YY..NG...DYFQ
FBpp0303439  ............................................------------------TLRERGNNF.YK..AS...RFTE
FBpp0070908  ............................................--------------------MALGKCL.YY..NG...DYFQ
FBpp0085842  ............................................--------------------KERANFF.YK..RS...EFTT
FBpp0300561  ............................................--------------TNIKLLCDQSNNH.MK..VR...AYEK
FBpp0077718  ............................................----LYRLAAKLHPINVESLASIAVGY.FY..DN...NPEM
FBpp0296980  ............................................------------------ALGNIGDIL.IR..TG...SHEE
FBpp0300832  ............................................------------------ALGNIGDIL.IR..TG...SHEE
FBpp0076600  ............................................-----------------ETIFLLATSY.FR..SN...QVHQ
FBpp0305561  ............................................-----------------ETIFLLATSY.FR..SN...QVHQ
FBpp0071712  ............................................---------------------ALGLKE.IK..NA...NPEN
FBpp0086749  ............................................----------------GHLWNSLADYY.VR..SG...LFDR
FBpp0085479  ............................................-----------------LNYKEDGNFY.MK..HK...KFRM
FBpp0112016  ............................................---------------------ALGLKE.IK..NA...NPEN
FBpp0292906  ............................................---NFLQKSIEADPKSGQSLYLLGRCY.AG..IN...KVHD
FBpp0305602  ............................................----FLQKSIEADPKSGQSLYLLGRCY.AG..IN...KVHD
FBpp0079665  ............................................----FLQKSIEADPKSGQSLYLLGRCY.AG..IN...KVHD
FBpp0079666  ............................................----FLQKSIEADPKSGQSLYLLGRCY.AG..IN...KVHD
FBpp0079664  ............................................----FLQKSIEADPKSGQSLYLLGRCY.AG..IN...KVHD
FBpp0084076  ............................................-----------------ELQRSQGNEA.FR..SQ...KYEK
FBpp0111406  ............................................----------------AQNFRKLGNAE.YR..KG...NYEA
FBpp0074918  ............................................----------------------WGNHF.YR..SA...DYAQ
FBpp0082818  ............................................--------------------------Y.EA..LE...QYDE
FBpp0074480  ............................................--------GLRNDLRSHVCWHVYGLLQ.RS..DK...KYDE
FBpp0082819  ............................................-----------EFPGSLRVMKFKAMRY.EA..LE...QYDE
FBpp0292061  ............................................-----------------------GIEH.FK..NG...QQVE
FBpp0085279  fiyikmashcvnqlheigslknnapglinagivelgshnlilas---ERFEGALQLQPMNFEARYNLGLVA.LA..QN...DYEL
FBpp0081805  ............................................-----------------------GIEH.FK..NG...QQVE
FBpp0100021  ............................................-------------------C-------.--..--...----
FBpp0100023  ............................................-------------------C-------.--..--...----
FBpp0074877  ............................................-------------------CL------.--..--...----
FBpp0071879  ............................................-------------LEKLQNWIAEGNFR.AA..RK...QQEK
FBpp0084559  ............................................----------------SAIYSQLGNAY.FY..LG...DYNK
FBpp0075591  ............................................-------------------LELKAIAL.SE..SG...ELDG
FBpp0076526  ............................................----------------AVSCNQLGDFY.NQ..QG...KYTD
FBpp0079851  ............................................----------------------NGSVE.YS..RG...RCDE
FBpp0290395  ............................................---ERFEGALQLQPMNFEARYNLGLVA.LA..QN...DYEL
FBpp0072146  ............................................---------------------LHGKDS.VK..LG...RYQS
FBpp0296980  ............................................----------------ARALSNLGSVH.ES..LG...QQAE
FBpp0300832  ............................................----------------ARALSNLGSVH.ES..LG...QQAE
FBpp0083238  ............................................---------------------------.--..-G...NNRK
FBpp0111383  ............................................------------REDVAETFRRMGNYE.YR..KL...NFSL
FBpp0080424  ............................................---------------------------.--..TK...SYRN
FBpp0305672  ............................................---------------------------.--..TK...SYRN
FBpp0305670  ............................................---------------------------.--..TK...SYRN
FBpp0071560  ............................................---------------------------.--..--...---L
FBpp0071561  ............................................---------------------------.--..--...---L
FBpp0080423  ............................................---------------------------.--..TK...SYRN
FBpp0305671  ............................................---------------------------.--..TK...SYRN
FBpp0071879  ............................................-------------PKNILALIGRACLA.YN..RQ...DYIG
FBpp0077738  ............................................----------ARQSGDRAACYHLARHY.EN..VG...KFQE
FBpp0077934  ............................................-------------------LVDKGLIA.VA..KN...DFPE
FBpp0292775  ............................................----------ARQSGDRAACYHLARHY.EN..VG...KFQE
FBpp0087646  ............................................---KACKMAIKECSNRWQNWNLLGVIN.MNseNE...NLPL
FBpp0292906  ............................................---------------YVNALCKLGHLH.LL..LG...EYSE
FBpp0079664  ............................................---------------YVNALCKLGHLH.LL..LG...EYSE
FBpp0086749  ............................................---------------------------.--..--...-YEE
FBpp0082652  ............................................-----------------DSFRRLGNEE.YR..RT...NYEK
FBpp0077619  ............................................-----------------------GNVE.FQ..RG...NLEE
FBpp0086164  ............................................--------------DRVELYMDITEAL.MQ..EH...KYAE
FBpp0297722  ............................................--------------DRVELYMDITEAL.MQ..EH...KYAE
FBpp0087232  ............................................-------------------IKERATSA.FK..AK...KWLE
FBpp0072561  ............................................---------------------GLGQMY.IY..RG...DTEN
FBpp0072562  ............................................---------------------GLGQMY.IY..RG...DTEN
FBpp0088148  ............................................------------------------QAH.MD..WG...KFRE
FBpp0088149  ............................................------------------------QAH.MD..WG...KFRE
FBpp0075786  ............................................--------------------LEDGNVL.YR..KN...RFQE
FBpp0075788  ............................................--------------------LEDGNVL.YR..KN...RFQE
FBpp0306229  ............................................--------------------LEDGNVL.YR..KN...RFQE
FBpp0075787  ............................................--------------------LEDGNVL.YR..KN...RFQE
FBpp0075789  ............................................--------------------LEDGNVL.YR..KN...RFQE
FBpp0301715  ............................................--------------------LEDGNVL.YR..KN...RFQE
FBpp0301716  ............................................--------------------LEDGNVL.YR..KN...RFQE
FBpp0306230  ............................................--------------------LEDGNVL.YR..KN...RFQE
FBpp0075785  ............................................--------------------LEDGNVL.YR..KN...RFQE
FBpp0083319  ............................................---------------------------.-N..NQ...EFDK
FBpp0076498  ............................................----------------------KASSC.MH..LN...LLDD
FBpp0293529  ............................................----------------------KASSC.MH..LN...LLDD
FBpp0290580  ............................................----------------------LGHCY.YH..AQ...KYEE
FBpp0290395  ............................................-----------MFPHVNQLKLNMGNIY.YS..MG...IYQK
FBpp0080720  ............................................----------------------FGQLL.MK..QG...KYLE
FBpp0086164  ............................................---------------------GEANLS.FV..YG...RYET
FBpp0297722  ............................................---------------------GEANLS.FV..YG...RYET
FBpp0080741  ............................................----------------CDTFLERAYFL.ME..IG...NFNS
FBpp0087297  ............................................----------------------QGLID.RE..EG...NHIE
FBpp0070720  ............................................---------------------------.Y-..--...----
FBpp0089396  ............................................---------------------------.Y-..--...----
FBpp0111789  ............................................---------------------------.Y-..--...----
FBpp0086683  ............................................----------------AHTLFQAGKLW.MR..RM...RYHD
FBpp0289328  ............................................----------------YRDLIAMGNSM.YQ..QS...DYQT
FBpp0070667  ............................................----------QHHPASWKFHTLSSYYW.RM..RG...NARE
FBpp0082624  ............................................---------------------SLASMH.YM..RA...HYQE
FBpp0081552  ............................................---------------------------.--..EK...HFAE
FBpp0086749  ............................................---------------------------.--..--...----
FBpp0087646  ............................................---------------TPASLSFQGFLY.AR..KN...LYRQ
FBpp0071879  ............................................-----LESFLTSEPDEPVVMDLLAKIY.LE..YKcpeKIDK
FBpp0080894  ............................................-------------SKSIYLIAQMALVY.HN..KR...DVDK
FBpp0305185  ............................................-------------SKSIYLIAQMALVY.HN..KR...DVDK
FBpp0112213  ............................................---------------------------.--..--...----
FBpp0087233  ............................................---------------------------.--..--...----
FBpp0070906  ............................................---------------------------.-S..TG...DFSC
FBpp0303990  ............................................---------------------------.-S..TG...DFSC
FBpp0087646  ............................................---------------------------.--..--...----
FBpp0082112  ............................................----------------------KAQQY.YI..MK...DFQM
FBpp0086359  ............................................---------------------------.--..-G...HHRQ
FBpp0293627  ............................................---------------------------.--..-G...HHRQ
FBpp0076526  ............................................--------------------EKLGDGC.CH..LM...NYEK
FBpp0085279  ............................................---------------------NKALVY.LR..QN...DVHQ
FBpp0074835  ............................................---------------------------.--..--...----
FBpp0303989  ............................................------------NVQTAKHYGNLGRLY.QT..MN...RFEE
FBpp0078887  ............................................---------------------------.--..--...----
FBpp0290580  ............................................----------------ADTLNDEGCLL.FQ..AD...QHEA
FBpp0085047  ............................................-------------------CLAIGLHL.MN..NS...RWYA
FBpp0296980  ............................................-----------------------GQEL.LQ..AT...QYSA
FBpp0300832  ............................................-----------------------GQEL.LQ..AT...QYSA
FBpp0086380  ............................................-------------PSTILEYTHLSLYS.FA..NG...HVGM
FBpp0083435  ............................................---------------------------.--..--...----
FBpp0078891  ............................................----------EISDDATLTQLAQAWVA.LA..QGte.QMQD
FBpp0082419  ............................................---------------------------.--..--...----
FBpp0082420  ............................................---------------------------.--..--...----
FBpp0306145  ............................................---------------------------.--..--...----
FBpp0303989  ............................................---------------------------.YS..TG...DFSC
FBpp0305372  ............................................---------------------------.--..--...----
FBpp0086749  ............................................---------------------------.--..--...----
FBpp0078027  ............................................------------------IYKDWGTYY.SR..RR...RENL
FBpp0088148  ............................................---------------------------.--..--...----
FBpp0088149  ............................................---------------------------.--..--...----
FBpp0290863  ............................................---------------------------.--..--...----
FBpp0080720  ............................................---------------ITYVFDLMANLA.ME..RE...QFKK
FBpp0083319  ............................................------------------------YVL.QL..QG...KTKE
FBpp0071288  ............................................---------------------------.--..--...----
FBpp0081398  ............................................------------LPYLAEVQTELANIE.FE..NG...ILEA
FBpp0301016  ............................................------------LPYLAEVQTELANIE.FE..NG...ILEA
FBpp0085015  ............................................------------------ECYEIGVQL.FD..LG...EYQR
FBpp0084188  ............................................-----------------------ARLY.MK..VQ...EYPK
FBpp0293235  ............................................-----------------------ARLY.MK..VQ...EYPK
FBpp0290580  ............................................------------------VVMARAWIS.WR..DD...DFVG
FBpp0085012  ............................................---------------------------.--..--...----
FBpp0086380  ............................................---------------DAYNFYTTGQAK.IQ..QG...LFKE
FBpp0304708  ............................................---------------------------.ME..MK...DYNK
FBpp0305372  ............................................---------------DAYNFYTTGQAK.IQ..QG...LFKE
FBpp0304707  ............................................---------------------------.ME..MK...DYNK
FBpp0071879  ............................................---------------------------.--..--...----
FBpp0076961  ............................................-----------------WIYRSWGQYF.AR..MR...KNTF
FBpp0075717  ............................................---------------------------.--..--...---Q
FBpp0080267  ............................................--------------------------Y.RK..ER...HPLK
FBpp0070907  ............................................---------------------------.--..ER...NYRA
FBpp0085033  ............................................-----------------------GAYL.FM..KN...RPSD
FBpp0082507  ............................................----------------ARTHLQMGQIL.MAy.TK...NIDL
FBpp0077738  ............................................--------------DDLETEAKVAVLA.IE..LG...MIEE
FBpp0292775  ............................................--------------DDLETEAKVAVLA.IE..LG...MIEE
FBpp0085676  ............................................-----------------DIYRDWGTYY.SR..RR...RENF
FBpp0087091  ............................................--------------------RMLGNEQ.FS..LKnr.NYFQ
FBpp0082624  ............................................-----------------------ASAF.FL..YE...QFEE
FBpp0070908  ............................................---------------------------.--..--...--SE
FBpp0070431  ............................................---------------------------.IE..VG...KWSD
FBpp0075443  ............................................--------------------------M.VR..RR...SWAR
FBpp0305287  ............................................--------------------------M.VR..RR...SWAR
FBpp0305288  ............................................--------------------------M.VR..RR...SWAR
FBpp0070906  ............................................------------------VLRQAAKAC.VV..KR...DFAR
FBpp0303990  ............................................------------------VLRQAAKAC.VV..KR...DFAR
FBpp0073018  ............................................---------------------------.--..-R...DYYN
FBpp0078634  ............................................--------------------NELSIVL.AS..KE...EYNK
FBpp0087626  ............................................---------------------------.--..--...---K
FBpp0075754  ............................................---------------------------.--..--...----
FBpp0087625  ............................................---------------------------.--..--...---K
FBpp0071288  ............................................---------------------------.--..--...----
FBpp0085046  ............................................----------------------MGRHL.MN..QS...RWTI
FBpp0110159  ............................................----------------------MGRHL.MN..QS...RWTI
FBpp0072679  ............................................---------------------------.--..YG...EFEE
FBpp0306202  ............................................---------------------------.--..YG...EFEE
FBpp0082624  ............................................---------------------------.--..--...----
FBpp0084254  ............................................----------------AMSMYEVARVA.MH..KE...NFDE
FBpp0085032  ............................................--------------------YAMGQIL.FD..QK...NYLA


                  40        50        60                                                            
                   |         |         |                                                            
d2fbna1        AIVKYKEALDFFIHTEEWDDQILLDKKKNIE......................................................
FBpp0112456  AKIFADECANILERSINGV------LNRN--......................................................
FBpp0297503  AKIFADECANILERSINGV------LNRN--......................................................
FBpp0112455  GRLKYEKVHTMYNKLLQ--------LPDIDP......................................................
FBpp0297502  GRLKYEKVHTMYNKLLQ--------LPDIDP......................................................
FBpp0070352  AIAALKRAYDL--------------QPDNQQvlmalaacytneglqnnavrmlcnwltvhpkyqhlvaahpelqaegtslassli
FBpp0070351  AIAALKRAYDL--------------QPDNQQvlmalaacytneglqnnavrmlcnwltvhpkyqhlvaahpelqaegtslassli
FBpp0070402  ARSIWERALDN--------------EHRN--......................................................
FBpp0080138  -------------------------------......................................................
FBpp0080139  -------------------------------......................................................
FBpp0301685  VEKLFQRCLVK--------------------......................................................
FBpp0074609  AGECFCEAATL--------------HARAGSrhdagtcyvdasncykkvdvesavnclmksidiytdmgrftma...........
FBpp0084171  -------------------------------......................................................
FBpp0085420  --RLYLKALEV--------------FPDF--......................................................
FBpp0085421  --RLYLKALEV--------------FPDF--......................................................
FBpp0085422  --RLYLKALEV--------------FPDF--......................................................
FBpp0085420  AKACYLKAIET--------------CPGF--......................................................
FBpp0085421  AKACYLKAIET--------------CPGF--......................................................
FBpp0085422  AKACYLKAIET--------------CPGF--......................................................
FBpp0077790  ALKHYHAAIEH--------------DPTD--......................................................
FBpp0082545  AFQHYHRAIEL--------------YPNY--......................................................
FBpp0084693  AAEILQRIDQR--------------CPNL--......................................................
FBpp0084691  AAEILQRIDQR--------------CPNL--......................................................
FBpp0084692  AAEILQRIDQR--------------CPNL--......................................................
FBpp0084694  AAEILQRIDQR--------------CPNL--......................................................
FBpp0112211  AAEILQRIDQR--------------CPNL--......................................................
FBpp0072096  SKECFLKAIDA--------------YKNNKSwfhaakayeqiillskdadklhev..............................
FBpp0071560  AQEVYEQALLY--------------DNEN--......................................................
FBpp0071561  AQEVYEQALLY--------------DNEN--......................................................
FBpp0077790  AVKHYTEAIKR--------------NPDD--......................................................
FBpp0076600  AMDYFRAAVVR--------------DPRH--......................................................
FBpp0305561  AMDYFRAAVVR--------------DPRH--......................................................
FBpp0271716  -------------------------------......................................................
FBpp0077790  AVAAYTEAIAL--------------DDQN--......................................................
FBpp0271718  -------------------------------......................................................
FBpp0290895  AIPCFRRAIEL--------------RPQL--......................................................
FBpp0290896  AIPCFRRAIEL--------------RPQL--......................................................
FBpp0081673  RKDCLLKAIDC--------------YENNKSwfhaaksyeqiillaketdklse...............................
FBpp0293601  AKQVLQEAIRF--------------RPNM--......................................................
FBpp0077614  AKQVLQEAIRF--------------RPNM--......................................................
FBpp0084692  -------------------------------......................................................
FBpp0084694  -------------------------------......................................................
FBpp0112211  -------------------------------......................................................
FBpp0084691  -------------------------------......................................................
FBpp0084693  -------------------------------......................................................
FBpp0296980  AVLLYTDALQL--------------DPGN--......................................................
FBpp0300832  AVLLYTDALQL--------------DPGN--......................................................
FBpp0080535  ALLQYNRAIAF--------------DPKN--......................................................
FBpp0296963  ALLQYNRAIAF--------------DPKN--......................................................
FBpp0296980  ALTHYRAHLAT--------------ARSLKDtage..................................................
FBpp0300832  ALTHYRAHLAT--------------ARSLKDtage..................................................
FBpp0072164  AIVAYSTAIAV--------------YPHD--......................................................
FBpp0084016  VHNLLQRALRA--------------LPNQEH......................................................
FBpp0296980  ALASHKQCVQL--------------FKQLGDrlqe..................................................
FBpp0300832  ALASHKQCVQL--------------FKQLGDrlqe..................................................
FBpp0296980  ALKCHDRQLQLALGLTS--------HRDQ--......................................................
FBpp0300832  ALKCHDRQLQLALGLTS--------HRDQ--......................................................
FBpp0080894  AISYFQRALKL--------------NPKY--......................................................
FBpp0305185  AISYFQRALKL--------------NPKY--......................................................
FBpp0081606  AIDMYTKAIEL--------------HPNS--......................................................
FBpp0081607  AIDMYTKAIEL--------------HPNS--......................................................
FBpp0304082  AIDMYTKAIEL--------------HPNS--......................................................
FBpp0084559  AIEHHQERLRI--------------AREFGDraae..................................................
FBpp0075683  AEPLCKRALEIREKVLGKD------HPDV--......................................................
FBpp0303945  AEPLCKRALEIREKVLGKD------HPDV--......................................................
FBpp0303946  AEPLCKRALEIREKVLGKD------HPDV--......................................................
FBpp0081284  AVEHYGKAIKA--------------GSKHKEl.....................................................
FBpp0079468  AIKMYTKCKNI--------------LPTTVHtneevkkik.............................................
FBpp0087297  AIEILENCLHL--------------TPENSEvlieisvlylkinetqkahdrlaevvsierkcspkgllafgailqsrndidgal
FBpp0074835  AAATYTLGLKK--------------CPTS--......................................................
FBpp0079893  ALAEFEKAVSI--------------APNHAIafvqkcyaeyrlsllagdqrrlesvmhtfqnaierfpsc...............
FBpp0079894  ALAEFEKAVSI--------------APNHAIafvqkcyaeyrlsllagdqrrlesvmhtfqnaierfpsc...............
FBpp0079895  ALAEFEKAVSI--------------APNHAIafvqkcyaeyrlsllagdqrrlesvmhtfqnaierfpsc...............
FBpp0082765  AAKTYTEALDI--------------CPSASSker...................................................
FBpp0079617  AINCYSKAIIK--------------NPTN--......................................................
FBpp0084440  AIEEYNCSIIY--------------DPENA-......................................................
FBpp0305670  ALKLYTDAISL--------------CPDS--......................................................
FBpp0080423  ALKLYTDAISL--------------CPDS--......................................................
FBpp0305671  ALKLYTDAISL--------------CPDS--......................................................
FBpp0080424  ALKLYTDAISL--------------CPDS--......................................................
FBpp0305672  ALKLYTDAISL--------------CPDS--......................................................
FBpp0085344  ALNCIHEASQI--------------YPLS--......................................................
FBpp0081552  ALTHYHAAVEG--------------DANN--......................................................
FBpp0297109  ALNCIHEASQI--------------YPLS--......................................................
FBpp0087646  ARKCYEKCISL--------------NPLAEEavdalsfiyqeqgeeelnetlllntlshlgsnes....................
FBpp0083769  AATIFQCTVDI-------------------Vkqraksnneeissrw.......................................
FBpp0070572  AIALYTKAIEL--------------SPGN--......................................................
FBpp0070573  AIALYTKAIEL--------------SPGN--......................................................
FBpp0070575  AIALYTKAIEL--------------SPGN--......................................................
FBpp0305905  AIALYTKAIEL--------------SPGN--......................................................
FBpp0074835  ARGILSLAFQA--------------NPNS--......................................................
FBpp0305670  AHVIYTDALKI--------------DEHNKDin....................................................
FBpp0080424  AHVIYTDALKI--------------DEHNKDin....................................................
FBpp0305672  AHVIYTDALKI--------------DEHNKDin....................................................
FBpp0080423  AHVIYTDALKI--------------DEHNKDin....................................................
FBpp0305671  AHVIYTDALKI--------------DEHNKDin....................................................
FBpp0076113  ARAKYRKANRY--------------YHYLSRqfgwqqlnplkkhlvdedllkvdgfs............................
FBpp0076114  ARAKYRKANRY--------------YHYLSRqfgwqqlnplkkhlvdedllkvdgfs............................
FBpp0076115  ARAKYRKANRY--------------YHYLSRqfgwqqlnplkkhlvdedllkvdgfs............................
FBpp0305988  ARAKYRKANRY--------------YHYLSRqfgwqqlnplkkhlvdedllkvdgfs............................
FBpp0072561  ASDFFKDALNI--------------NNDNPDarsllgnlhlakmqfalgqknfetilknpststdayslialgnfslqtlhqpsr
FBpp0072562  ASDFFKDALNI--------------NNDNPDarsllgnlhlakmqfalgqknfetilknpststdayslialgnfslqtlhqpsr
FBpp0072561  AMAFYKKALRT--------------NPNCPAnvrigmahcflkmgnpekaklaferalqldqqcvgaliglavlklnqlepesnk
FBpp0072562  AMAFYKKALRT--------------NPNCPAnvrigmahcflkmgnpekaklaferalqldqqcvgaliglavlklnqlepesnk
FBpp0085923  AIDAYSAALAK--------------YPQG--......................................................
FBpp0293601  SAIYHRRAAEL--------------APND--......................................................
FBpp0079893  AIKFYDKAIDK--------------CPKEHRtdm...................................................
FBpp0079894  AIKFYDKAIDK--------------CPKEHRtdm...................................................
FBpp0079895  AIKFYDKAIDK--------------CPKEHRtdm...................................................
FBpp0075683  AVPLCKQALEDLERTSGHD------HPDV--......................................................
FBpp0303945  AVPLCKQALEDLERTSGHD------HPDV--......................................................
FBpp0303946  AVPLCKQALEDLERTSGHD------HPDV--......................................................
FBpp0077614  SAIYHRRAAEL--------------APND--......................................................
FBpp0085409  -------------------------------......................................................
FBpp0271717  -------------------------------......................................................
FBpp0271719  -------------------------------......................................................
FBpp0086749  AYRAYEKGISL------------FKWPNV--......................................................
FBpp0073411  AETCYREAVGIVEQLMLKE------KPHDEEwqelaaik..............................................
FBpp0070907  AEDIFSSTLCA--------------NPDNVEaiglmavlcgqeggceqdsadmdylfakvssevkyt..................
FBpp0303439  AETCYREAVGIVEQLMLKE------KPHDEEwqelaaik..............................................
FBpp0070908  AEDIFSSTLCA--------------NPDNVEaiglmavlcgqeggceqdsadmdylfakvssevkyt..................
FBpp0085842  AIHLYRRALDFLDNRDG--------DPDSEFdkedlelsnsdtqtlledr...................................
FBpp0300561  ALFGYNQALEL--------------NSTD--......................................................
FBpp0077718  ALMYYRRILSL--------------GAQS--......................................................
FBpp0296980  AIKLYQRQLAL--------------ARAAGDrsme..................................................
FBpp0300832  AIKLYQRQLAL--------------ARAAGDrsme..................................................
FBpp0076600  AYWLLKEKARR--------------SP----......................................................
FBpp0305561  AYWLLKEKARR--------------SP----......................................................
FBpp0071712  AIHFFCKALEL--------------NSTD--......................................................
FBpp0086749  ARDIYEEAIQTVTTVRDFT-----------Qvfdeyaqfeelslnrrmeqvaaneaateeddidvelrlsrfeylmerrllllns
FBpp0085479  AIYSFTEGIKT--------------KTDNPDvl....................................................
FBpp0112016  AIHFFCKALEL--------------NSTD--......................................................
FBpp0292906  AFLAYRNSVEK--------------SEGN--......................................................
FBpp0305602  AFLAYRNSVEK--------------SEGN--......................................................
FBpp0079665  AFLAYRNSVEK--------------SEGN--......................................................
FBpp0079666  AFLAYRNSVEK--------------SEGN--......................................................
FBpp0079664  AFLAYRNSVEK--------------SEGN--......................................................
FBpp0084076  AILHYDKAIIK--------------VKDS--......................................................
FBpp0111406  AMKVYTEAIEN--------------IRDS--......................................................
FBpp0074918  AMDHFEISLEI--------------NNLQ--......................................................
FBpp0082818  ADEVLDAIIAK--------------DETNAAprkrkiailkargrrleaikelneylkkfmsd......................
FBpp0074480  AIKCYRNALKW--------------EKDN--......................................................
FBpp0082819  ADEVLDAIIAK--------------DETNAAprkrkiailkargrrleaikelneylkkfmsd......................
FBpp0292061  AFQCLNKALNI--------------DPRN--......................................................
FBpp0085279  AEERFELLKEQLM------------LPSSVQhshvfyqlaklqerrlesglisnftpgaalqaylqvvgisasdid.........
FBpp0081805  AFQCLNKALNI--------------DPRN--......................................................
FBpp0100021  -------------------------------......................................................
FBpp0100023  -------------------------------......................................................
FBpp0074877  -------------------------------......................................................
FBpp0071879  ALQCFGKILDC--------------NPKN--......................................................
FBpp0084559  AMQYHKHDLTL--------------AKSMNDrlge..................................................
FBpp0075591  ALELFQQSLNL--------------AQR---......................................................
FBpp0076526  AVREYVQEAQI--------------YASMGKeletakakrmvgemytllcdydaakdhindylkiakrlknqveeqrayatlgrv
FBpp0079851  ALKYFQELLSVV-------------DPMDNLlf....................................................
FBpp0290395  AEERFELLKEQLM------------LPSSVQhshvfyqlaklqerrlesglisnftpgaalqaylqvvgisasdid.........
FBpp0072146  AATAFERAVSSLNYCR--------------Mandeeerkqtell.........................................
FBpp0296980  ALKCYERQLEL--------------STDRLAk.....................................................
FBpp0300832  ALKCYERQLEL--------------STDRLAk.....................................................
FBpp0083238  ALQESEKLLRK--------------HPNL--......................................................
FBpp0111383  AKDYYSKGIQY--------------IKDS--......................................................
FBpp0080424  VVFYLDSALKL--------------APAC--......................................................
FBpp0305672  VVFYLDSALKL--------------APAC--......................................................
FBpp0305670  VVFYLDSALKL--------------APAC--......................................................
FBpp0071560  AILLLTHALKT--------------HQRNLDwrteyslfmsgvhvnqrn....................................
FBpp0071561  AILLLTHALKT--------------HQRNLDwrteyslfmsgvhvnqrn....................................
FBpp0080423  VVFYLDSALKL--------------APAC--......................................................
FBpp0305671  VVFYLDSALKL--------------APAC--......................................................
FBpp0071879  ALGYFKSVLLI--------------QPQGM-......................................................
FBpp0077738  AIMFFTRAQTF--------------SNAIRIckendfqeelwtvasssrqrdkaiaaayfeecgnfkhavelyhragmlhkalem
FBpp0077934  AYVIFQKALHL--------------DTGN--......................................................
FBpp0292775  AIMFFTRAQTF--------------SNAIRIckendfqeelwtvasssrqrdkaiaaayfeecgnfkhavelyhragmlhkalem
FBpp0087646  AQHCFIQAVVL--------------EKKC--......................................................
FBpp0292906  ALSAYQKYLRF--------------RENNYWtn....................................................
FBpp0079664  ALSAYQKYLRF--------------RENNYWtn....................................................
FBpp0086749  VNSAFERALVF--------------MHKM--......................................................
FBpp0082652  AVYFYSKAIQY--------------VADS--......................................................
FBpp0077619  AALYYESALTL--------------PPPEVNerdff.................................................
FBpp0086164  AIALMSPITDG--------------DTVECP......................................................
FBpp0297722  AIALMSPITDG--------------DTVECP......................................................
FBpp0087232  AMMLYTRSYVA--------------LPSENVaei...................................................
FBpp0072561  AAQCFEKVLKI--------------QPGN--......................................................
FBpp0072562  AAQCFEKVLKI--------------QPGN--......................................................
FBpp0088148  AIEFSHQQLGI--------------SEELDSpnmr..................................................
FBpp0088149  AIEFSHQQLGI--------------SEELDSpnmr..................................................
FBpp0075786  AAHRYQYALRK--------------ISGLEQllernaifaqlr..........................................
FBpp0075788  AAHRYQYALRK--------------ISGLEQllernaifaqlr..........................................
FBpp0306229  AAHRYQYALRK--------------ISGLEQllernaifaqlr..........................................
FBpp0075787  AAHRYQYALRK--------------ISGLEQllernaifaqlr..........................................
FBpp0075789  AAHRYQYALRK--------------ISGLEQllernaifaqlr..........................................
FBpp0301715  AAHRYQYALRK--------------ISGLEQllernaifaqlr..........................................
FBpp0301716  AAHRYQYALRK--------------ISGLEQllernaifaqlr..........................................
FBpp0306230  AAHRYQYALRK--------------ISGLEQllernaifaqlr..........................................
FBpp0075785  AAHRYQYALRK--------------ISGLEQllernaifaqlr..........................................
FBpp0083319  AVKAVNRILGV--------------APDD--......................................................
FBpp0076498  ALKFCNASLEK--------------SPAN--......................................................
FBpp0293529  ALKFCNASLEK--------------SPAN--......................................................
FBpp0290580  AATCYEQLCQL--------------APKE--......................................................
FBpp0290395  AVKMYRMALDS--------------VPKSLSqlr...................................................
FBpp0080720  AKNLFKEAFDTLINVYGAV------NDAS--......................................................
FBpp0086164  AERICMEIIRQ--------------NPLA--......................................................
FBpp0297722  AERICMEIIRQ--------------NPLA--......................................................
FBpp0080741  AQQCLEQIKTQILACTEYRF-----VKLN--......................................................
FBpp0087297  ALRHLQKSAEL--------------NPRN--......................................................
FBpp0070720  -------------------------------......................................................
FBpp0089396  -------------------------------......................................................
FBpp0111789  -------------------------------......................................................
FBpp0086683  AQRAFEKAITRLKTCK--------------Tssfeqqcrkkdm..........................................
FBpp0289328  AAKWYRIACKR--------------------......................................................
FBpp0070667  ALPCARLAALL--------------APPIFK......................................................
FBpp0082624  AIDVYKRVLVD--------------NKEY--......................................................
FBpp0081552  CIAAGEAVLRN--------------EPEETMir....................................................
FBpp0086749  --EIYEKAIES--------------LPEQNM......................................................
FBpp0087646  AIEAFTRACKLC-------------EPGADR......................................................
FBpp0071879  AIEMLVKVVES--------------ASYHQN......................................................
FBpp0080894  AIELYQALLES--------------DPYR--......................................................
FBpp0305185  AIELYQALLES--------------DPYR--......................................................
FBpp0112213  -------------------------------......................................................
FBpp0087233  -------------------------------......................................................
FBpp0070906  AQDHVDKAVNIMQHLVPSNH----------Lmlasakrvkallleeialdkmadgideedlllqseelhnfalllslqvfgevnv
FBpp0303990  AQDHVDKAVNIMQHLVPSNH----------Lmlasakrvkallleeialdkmadgideedlllqseelhnfalllslqvfgevnv
FBpp0087646  ---Y---------------------------......................................................
FBpp0082112  AAKQLMRINNECTQAG--------------Titpqls................................................
FBpp0086359  ATTIHELLINR--------------LPED--......................................................
FBpp0293627  ATTIHELLINR--------------LPED--......................................................
FBpp0076526  ALTYYQKMLEN--------------AELNQEsgksl.................................................
FBpp0085279  AIETLQMYDRK--------------SEGSMT......................................................
FBpp0074835  -------------------------------......................................................
FBpp0303989  AERMHKKAIKI--------------KSELLGhfdyev................................................
FBpp0078887  -------AEQT--------------NIKE--......................................................
FBpp0290580  AVQRFQAALQV--------------GGFN--......................................................
FBpp0085047  AEQWISASIEAYDQKSSQTDMELLRGPKL--......................................................
FBpp0296980  AVTVLEAALRI--------------GSCSLKlr....................................................
FBpp0300832  AVTVLEAALRI--------------GSCSLKlr....................................................
FBpp0086380  SLKLLYRARYLMVLICGED------HPEV--......................................................
FBpp0083435  -------------------------------......................................................
FBpp0078891  AFHIYQEFCEK--------------FKPT--......................................................
FBpp0082419  -------------------------------......................................................
FBpp0082420  -------------------------------......................................................
FBpp0306145  -------------------------------......................................................
FBpp0303989  AQDHVDKAVNIMQHL---------------Vpsnhlmlasakrvkallleeialdkmadgideedlllqseelhnfalllslqvf
FBpp0305372  -------------------------HPEV--......................................................
FBpp0086749  -------------------------------......................................................
FBpp0078027  GMYYFDKALKL--------------GPAD--......................................................
FBpp0088148  -------------------------------......................................................
FBpp0088149  -------------------------------......................................................
FBpp0290863  -------------------------------......................................................
FBpp0080720  AEKIFTDVMKRLFAEGHTEE-----SPKI--......................................................
FBpp0083319  ASSIYADCLRH--------------KPKDAAlvavasnnlvvvnkdqnvfdskkkiraaladacesrltsrqkqvialnncllal
FBpp0071288  -------------------------------......................................................
FBpp0081398  AREDYEKALKI--------------HGELPTrnrral................................................
FBpp0301016  AREDYEKALKI--------------HGELPTrnrral................................................
FBpp0085015  SLEWLQVAFILLRNSP--------------Reekdadhyl.............................................
FBpp0084188  AIEYLNGYLRV--------------RDD---......................................................
FBpp0293235  AIEYLNGYLRV--------------RDD---......................................................
FBpp0290580  AEREFHASAEF--------------CSEN--......................................................
FBpp0085012  ------------------------------Tqsftk.................................................
FBpp0086380  GYELISGALNLLNNVFGAL------HQEN--......................................................
FBpp0304708  SKEWLNVAISMLESSAYW-------DPIVPS......................................................
FBpp0305372  GYELISGALNLLNNVFGAL------HQEN--......................................................
FBpp0304707  SKEWLNVAISMLESSAYW-------DPIVPS......................................................
FBpp0071879  -------------------------------......................................................
FBpp0076961  AQKYFDKCITE--------------NESTD-......................................................
FBpp0075717  ALMAANLAVMR--------------APDRNAdpvldegltl............................................
FBpp0080267  ASDLFTEAIFL--------------APARNTlaa...................................................
FBpp0070907  ALRHFDEIIHKRRLMMRHKNAVLVAIESSYPefgdaeqrrraaecyrqigntdmaietllqvpptlrsprinlmlarlqhhgsrh
FBpp0085033  AIQWLQEVPQR--------------LQEELLiqprhlpike............................................
FBpp0082507  ARQHLEKAWSI--------------SEPLPNfdvk..................................................
FBpp0077738  AKDLYRRCKRF--------------DLLN--......................................................
FBpp0292775  AKDLYRRCKRF--------------DLLN--......................................................
FBpp0085676  ALHYLNKALAL--------------EPTD--......................................................
FBpp0087091  ALELYNKSICY--------------AEPNSEhl....................................................
FBpp0082624  VLVYMNSIRSY--------------FVND--......................................................
FBpp0070908  AVLAYKEVIRE--------------CPMALQvieallelgvngneinslvmhaatvpdhfdwlskwikalaqmfnfkhsdasqtf
FBpp0070431  ALDYGQRLLPGFRKYHGPW------NPLL--......................................................
FBpp0075443  AVALYDQLIAP--------------SPGQGSggqsagsraqkdqq........................................
FBpp0305287  AVALYDQLIAP--------------SPGQGSggqsagsraqkdqq........................................
FBpp0305288  AVALYDQLIAP--------------SPGQGSggqsagsraqkdqq........................................
FBpp0070906  ANLLICQAVRRAREYFGPT------HQKY--......................................................
FBpp0303990  ANLLICQAVRRAREYFGPT------HQKY--......................................................
FBpp0073018  ALSALHRALDR--------------SPVRLMsqekgy................................................
FBpp0078634  GLEILLEAEKI--------------YEDFKAsglkplaiqdvfnppeegqqsheagpkelesly.....................
FBpp0087626  ACRLYSEAVFE--------------AENAVEel....................................................
FBpp0075754  -------------------------------......................................................
FBpp0087625  ACRLYSEAVFE--------------AENAVEel....................................................
FBpp0071288  ----YREALAK--------------FNHD--......................................................
FBpp0085046  AEQWILAGIKAQDRKGPQTEMILLRGPTK--......................................................
FBpp0110159  AEQWILAGIKAQDRKGPQTEMILLRGPTK--......................................................
FBpp0072679  AEKLYLDADRR--------------DLAIELrmtlcdwfrvvqlyrmggsgvsdqqm............................
FBpp0306202  AEKLYLDADRR--------------DLAIELrmtlcdwfrvvqlyrmggsgvsdqqm............................
FBpp0082624  -------------------------------......................................................
FBpp0084254  ALLILLEADEL--------------FSQCDSkllegvdny.............................................
FBpp0085032  AASWIYQSVVL--------------MEAFSMaapleisk..............................................


                                                                                                    
                                                                                                    
d2fbna1        .....................................................................................
FBpp0112456  .....................................................................................
FBpp0297503  .....................................................................................
FBpp0112455  .....................................................................................
FBpp0297502  .....................................................................................
FBpp0070352  gpsklrdlqqiyleavrqhpsevd.............................................................
FBpp0070351  gpsklrdlqqiyleavrqhpsevd.............................................................
FBpp0070402  .....................................................................................
FBpp0080138  .....................................................................................
FBpp0080139  .....................................................................................
FBpp0301685  .....................................................................................
FBpp0074609  .....................................................................................
FBpp0084171  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0305561  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0271718  .....................................................................................
FBpp0290895  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0293601  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0296963  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0305185  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0081607  .....................................................................................
FBpp0304082  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0303945  .....................................................................................
FBpp0303946  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  skysqianaepei........................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0085344  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0297109  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070573  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0305905  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0076114  .....................................................................................
FBpp0076115  .....................................................................................
FBpp0305988  .....................................................................................
FBpp0072561  dkekerkhqekalaifkqvlrndprniwatngigavlahkgcvieardifaqvreatadf.........................
FBpp0072562  dkekerkhqekalaifkqvlrndprniwatngigavlahkgcvieardifaqvreatadf.........................
FBpp0072561  lgvqmlskaytidnanpmvlnhlanhfffkkdyqkvhhlalhafhnteneamr................................
FBpp0072562  lgvqmlskaytidnanpmvlnhlanhfffkkdyqkvhhlalhafhnteneamr................................
FBpp0085923  .....................................................................................
FBpp0293601  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0303945  .....................................................................................
FBpp0303946  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0085409  .....................................................................................
FBpp0271717  .....................................................................................
FBpp0271719  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0303439  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0300561  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0305561  .....................................................................................
FBpp0071712  .....................................................................................
FBpp0086749  vllrqnphnvhewhkrvtlyedkpaeiistyteavqtvqpkqavgkl......................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0305602  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0079666  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  .....................................................................................
FBpp0082819  .....................................................................................
FBpp0292061  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0081805  .....................................................................................
FBpp0100021  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0074877  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  hllhgqsladssasgsmeqlklaeknflrslllikdlsgqiskleqldmq...................................
FBpp0079851  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0077738  afesqqpeileiiasdlapdsd...............................................................
FBpp0077934  .....................................................................................
FBpp0292775  afesqqpeileiiasdlapdsd...............................................................
FBpp0087646  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0297722  .....................................................................................
FBpp0087232  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0075786  .....................................................................................
FBpp0075788  .....................................................................................
FBpp0306229  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0075789  .....................................................................................
FBpp0301715  .....................................................................................
FBpp0301716  .....................................................................................
FBpp0306230  .....................................................................................
FBpp0075785  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076498  .....................................................................................
FBpp0293529  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0297722  .....................................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  .....................................................................................
FBpp0089396  .....................................................................................
FBpp0111789  .....................................................................................
FBpp0086683  .....................................................................................
FBpp0289328  .....................................................................................
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0305185  .....................................................................................
FBpp0112213  .....................................................................................
FBpp0087233  .....................................................................................
FBpp0070906  qt...................................................................................
FBpp0303990  qt...................................................................................
FBpp0087646  .....................................................................................
FBpp0082112  .....................................................................................
FBpp0086359  .....................................................................................
FBpp0293627  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0303989  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085047  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0082420  .....................................................................................
FBpp0306145  .....................................................................................
FBpp0303989  gevnvqt..............................................................................
FBpp0305372  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  ytnagdqvqqlsqklaqtypqve..............................................................
FBpp0071288  .....................................................................................
FBpp0081398  .....................................................................................
FBpp0301016  .....................................................................................
FBpp0085015  .....................................................................................
FBpp0084188  .....................................................................................
FBpp0293235  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0304708  .....................................................................................
FBpp0305372  .....................................................................................
FBpp0304707  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  .....................................................................................
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070907  gttkkseavlaykevirecpmalqvieallelgvngneinslvmhaatvpdhfdwlskwikalaqmfnfkhsdasqtflmlhdnt
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070908  lmlhdnttlrcn.........................................................................
FBpp0070431  .....................................................................................
FBpp0075443  .....................................................................................
FBpp0305287  .....................................................................................
FBpp0305288  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0303990  .....................................................................................
FBpp0073018  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0087626  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0085046  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0306202  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................


                      70         80                                                                 
                       |          |                                                                 
d2fbna1        .....ISCNLNLATCY.NKN...K...D.........................................................
FBpp0112456  .....ALLYFAYADFE.EGR...L...K.........................................................
FBpp0297503  .....ALLYFAYADFE.EGR...L...K.........................................................
FBpp0112455  .....TLVYVQYMKFA.RRA...E...G.........................................................
FBpp0297502  .....TLVYVQYMKFA.RRA...E...G.........................................................
FBpp0070352  .....AEVQDALGVLY.NLS...G...E.........................................................
FBpp0070351  .....AEVQDALGVLY.NLS...G...E.........................................................
FBpp0070402  .....VTLWLKYAEME.MKN...K...Q.........................................................
FBpp0080138  .....-----------.---...-...-.........................................................
FBpp0080139  .....-----------.---...-...-.........................................................
FBpp0301685  .....-----------.---...-...-.........................................................
FBpp0074609  .....AKHHQSIAEMY.ESDp..N...N.........................................................
FBpp0084171  .....-----------.VKA...T...D.........................................................
FBpp0085420  .....AAAHSNLASVL.QQQ...G...K.........................................................
FBpp0085421  .....AAAHSNLASVL.QQQ...G...K.........................................................
FBpp0085422  .....AAAHSNLASVL.QQQ...G...K.........................................................
FBpp0085420  .....AVAWSNLGCVF.NAQ...G...E.........................................................
FBpp0085421  .....AVAWSNLGCVF.NAQ...G...E.........................................................
FBpp0085422  .....AVAWSNLGCVF.NAQ...G...E.........................................................
FBpp0077790  .....ITFYNNIAAVH.FER...K...E.........................................................
FBpp0082545  .....ESALMNLGNLY.REH...G...Q.........................................................
FBpp0084693  .....LQLSYRRINVE.RRR...G...A.........................................................
FBpp0084691  .....LQLSYRRINVE.RRR...G...A.........................................................
FBpp0084692  .....LQLSYRRINVE.RRR...G...A.........................................................
FBpp0084694  .....LQLSYRRINVE.RRR...G...A.........................................................
FBpp0112211  .....LQLSYRRINVE.RRR...G...A.........................................................
FBpp0072096  .....EEYANKSASLY.QQH...G...S.........................................................
FBpp0071560  .....ADIYYNLGVVF.LEQ...G...K.........................................................
FBpp0071561  .....ADIYYNLGVVF.LEQ...G...K.........................................................
FBpp0077790  .....PKLYSNRAACY.TKL...A...A.........................................................
FBpp0076600  .....YNAWYGIGTIY.SKQ...E...K.........................................................
FBpp0305561  .....YNAWYGIGTIY.SKQ...E...K.........................................................
FBpp0271716  .....-----------.---...N...D.........................................................
FBpp0077790  .....HVLYSNRSAAF.AKA...G...K.........................................................
FBpp0271718  .....-----------.---...N...D.........................................................
FBpp0290895  .....AVAYLNLGTSL.ISL...G...Dhrqeaisvlrtgarlegsgvrdrgahvearytcylqlsvlyrsdgrlqdaaaalres
FBpp0290896  .....AVAYLNLGTSL.ISL...G...Dhrqeaisvlrtgarlegsgvrdrgahvearytcylqlsvlyrsdgrlqdaaaalres
FBpp0081673  .....VEDYANRACCL.YQQh..G...S.........................................................
FBpp0293601  .....ADVHFNLGILH.QNQ...Q...V.........................................................
FBpp0077614  .....ADVHFNLGILH.QNQ...Q...V.........................................................
FBpp0084692  .....--GWTYLLQYV.DNE...S...D.........................................................
FBpp0084694  .....--GWTYLLQYV.DNE...S...D.........................................................
FBpp0112211  .....--GWTYLLQYV.DNE...S...D.........................................................
FBpp0084691  .....--GWTYLLQYV.DNE...S...D.........................................................
FBpp0084693  .....--GWTYLLQYV.DNE...S...D.........................................................
FBpp0296980  .....HILYSNRSAAL.LKQ...G...Q.........................................................
FBpp0300832  .....HILYSNRSAAL.LKQ...G...Q.........................................................
FBpp0080535  .....PIFYCNRAAAH.IRL...G...E.........................................................
FBpp0296963  .....PIFYCNRAAAH.IRL...G...E.........................................................
FBpp0296980  .....ACALLNLGNCL.SGR...Q...E.........................................................
FBpp0300832  .....ACALLNLGNCL.SGR...Q...E.........................................................
FBpp0072164  .....PIYHINRALCY.LKQ...E...S.........................................................
FBpp0084016  .....IPCIVSFAKLY.AKH...D...N.........................................................
FBpp0296980  .....AREIGNVGAVY.LAL...G...E.........................................................
FBpp0300832  .....AREIGNVGAVY.LAL...G...E.........................................................
FBpp0296980  .....ERAYRGLGQAR.RAL...G...Q.........................................................
FBpp0300832  .....ERAYRGLGQAR.RAL...G...Q.........................................................
FBpp0080894  .....LAAWTLMGHEF.MEL...K...N.........................................................
FBpp0305185  .....LAAWTLMGHEF.MEL...K...N.........................................................
FBpp0081606  .....AIYYANRSLAH.LRQ...E...S.........................................................
FBpp0081607  .....AIYYANRSLAH.LRQ...E...S.........................................................
FBpp0304082  .....AIYYANRSLAH.LRQ...E...S.........................................................
FBpp0084559  .....RRANSNLGNSH.IFL...G...Q.........................................................
FBpp0075683  .....AKQLNNLALLC.QNQ...G...K.........................................................
FBpp0303945  .....AKQLNNLALLC.QNQ...G...K.........................................................
FBpp0303946  .....AKQLNNLALLC.QNQ...G...K.........................................................
FBpp0081284  .....AVFYKNRAAAY.LKL...G...K.........................................................
FBpp0079468  .....VATHSNIALCH.QKS...N...D.........................................................
FBpp0087297  .....AELWNNIGLCF.FKK...Q...K.........................................................
FBpp0074835  .....IPLWILSANLE.ERK...G...V.........................................................
FBpp0079893  .....VECYSLTAQVL.ADQ...Q...Q.........................................................
FBpp0079894  .....VECYSLTAQVL.ADQ...Q...Q.........................................................
FBpp0079895  .....VECYSLTAQVL.ADQ...Q...Q.........................................................
FBpp0082765  .....AVLYGNRAAAK.IKL...E...A.........................................................
FBpp0079617  .....ATYFTNRALCN.LKL...K...R.........................................................
FBpp0084440  .....VHAYNNRAVAH.LKL...K...K.........................................................
FBpp0305670  .....AAYYGNRAACY.MML...L...N.........................................................
FBpp0080423  .....AAYYGNRAACY.MML...L...N.........................................................
FBpp0305671  .....AAYYGNRAACY.MML...L...N.........................................................
FBpp0080424  .....AAYYGNRAACY.MML...L...N.........................................................
FBpp0305672  .....AAYYGNRAACY.MML...L...N.........................................................
FBpp0085344  .....HQIMFMRGQVH.VYL...E...Q.........................................................
FBpp0081552  .....YLTLFKRGTVY.LAL...G...K.........................................................
FBpp0297109  .....HQIMFMRGQVH.VYL...E...Q.........................................................
FBpp0087646  .....IRLQYKLGLHF.SHV...K...K.........................................................
FBpp0083769  .....EPLFINLGHSL.RKV...H...K.........................................................
FBpp0070572  .....ALFHAKRGQAF.LKL...K...K.........................................................
FBpp0070573  .....ALFHAKRGQAF.LKL...K...K.........................................................
FBpp0070575  .....ALFHAKRGQAF.LKL...K...K.........................................................
FBpp0305905  .....ALFHAKRGQAF.LKL...K...K.........................................................
FBpp0074835  .....EDIWLAAVKLE.SEN...S...E.........................................................
FBpp0305670  .....SKLLYNRALVN.TRI...G...N.........................................................
FBpp0080424  .....SKLLYNRALVN.TRI...G...N.........................................................
FBpp0305672  .....SKLLYNRALVN.TRI...G...N.........................................................
FBpp0080423  .....SKLLYNRALVN.TRI...G...N.........................................................
FBpp0305671  .....SKLLYNRALVN.TRI...G...N.........................................................
FBpp0076113  .....VVNNINAAAVD.LKV...G...N.........................................................
FBpp0076114  .....VVNNINAAAVD.LKV...G...N.........................................................
FBpp0076115  .....VVNNINAAAVD.LKV...G...N.........................................................
FBpp0305988  .....VVNNINAAAVD.LKV...G...N.........................................................
FBpp0072561  .....CDVWLNIAHVY.VEQ...K...Q.........................................................
FBpp0072562  .....CDVWLNIAHVY.VEQ...K...Q.........................................................
FBpp0072561  .....AESCYQLARSF.HAQ...S...D.........................................................
FBpp0072562  .....AESCYQLARSF.HAQ...S...D.........................................................
FBpp0085923  .....EVLYLNRATAL.MRR...GwfgD.........................................................
FBpp0293601  .....YTLVVAAATAM.RLL...D...R.........................................................
FBpp0079893  .....AIFYQNRAASY.EML...K...K.........................................................
FBpp0079894  .....AIFYQNRAASY.EML...K...K.........................................................
FBpp0079895  .....AIFYQNRAASY.EML...K...K.........................................................
FBpp0075683  .....ATMLNILALVY.RDQ...N...K.........................................................
FBpp0303945  .....ATMLNILALVY.RDQ...N...K.........................................................
FBpp0303946  .....ATMLNILALVY.RDQ...N...K.........................................................
FBpp0077614  .....YTLVVAAATAM.RLL...D...R.........................................................
FBpp0085409  .....-DYIYYLAFGN.ARI...K...E.........................................................
FBpp0271717  .....-DYIYYLAFGN.ARI...K...E.........................................................
FBpp0271719  .....-DYIYYLAFGN.ARI...K...E.........................................................
FBpp0086749  .....YDIWNSYLTKF.LERyggT...K.........................................................
FBpp0073411  .....TPLLLNYAQCR.LIA...G...D.........................................................
FBpp0070907  .....ASHWFAHAQLL.YDE...G...K.........................................................
FBpp0303439  .....TPLLLNYAQCR.LIA...G...D.........................................................
FBpp0070908  .....ASHWFAHAQLL.YDE...G...K.........................................................
FBpp0085842  .....LIVYNNLAMTQ.IKI...A...A.........................................................
FBpp0300561  .....INALISRSKCY.LLL...G...E.........................................................
FBpp0077718  .....PELYCNIALCC.LYG...G...Q.........................................................
FBpp0296980  .....AAACGALGLAH.RLM...R...R.........................................................
FBpp0300832  .....AAACGALGLAH.RLM...R...R.........................................................
FBpp0076600  .....-QCRFLQAKCA.YEL...K...K.........................................................
FBpp0305561  .....-QCRFLQAKCA.YEL...K...K.........................................................
FBpp0071712  .....INALISRSKCY.LLL...G...E.........................................................
FBpp0086749  .....HTLWVEFAKFY.EAN...G...Q.........................................................
FBpp0085479  .....AVLYNNRSAAH.FFI...K...N.........................................................
FBpp0112016  .....INALISRSKCY.LLL...G...E.........................................................
FBpp0292906  .....ADTWCSIGVLY.QQQ...N...Q.........................................................
FBpp0305602  .....ADTWCSIGVLY.QQQ...N...Q.........................................................
FBpp0079665  .....ADTWCSIGVLY.QQQ...N...Q.........................................................
FBpp0079666  .....ADTWCSIGVLY.QQQ...N...Q.........................................................
FBpp0079664  .....ADTWCSIGVLY.QQQ...N...Q.........................................................
FBpp0084076  .....AITYCNRALCY.IKL...Q...N.........................................................
FBpp0111406  .....HILYINRALCF.IKS...G...K.........................................................
FBpp0074918  .....EAILLRCGYCA.IQL...E...R.........................................................
FBpp0082818  .....QEAWHELCNMY.LAE...G...E.........................................................
FBpp0074480  .....-----------.---...-...-.........................................................
FBpp0082819  .....QEAWHELCNMY.LAE...G...E.........................................................
FBpp0292061  .....VEALVARGALY.ANR...G...S.........................................................
FBpp0085279  .....SRLFEKVGSLY.EQI...Q...D.........................................................
FBpp0081805  .....VEALVARGALY.ANR...G...S.........................................................
FBpp0100021  .....----LMLGLMY.LFL...K...D.........................................................
FBpp0100023  .....----LMLGLMY.LFL...K...D.........................................................
FBpp0074877  .....-----MLGLMY.LFL...K...D.........................................................
FBpp0071879  .....LWAANGIGAVL.SSC...N...N.........................................................
FBpp0084559  .....AKSSGNLGNTL.KVM...G...R.........................................................
FBpp0075591  .....ASVLNNRAQTL.RLA...K...R.........................................................
FBpp0076526  .....ARCYLNIGVVK.EHM...E...A.........................................................
FBpp0079851  .....KLSFLRLGQLA.LQR...K...Q.........................................................
FBpp0290395  .....SRLFEKVGSLY.EQI...Q...D.........................................................
FBpp0072146  .....TTLNQNLMIVY.NKM...N...K.........................................................
FBpp0296980  .....AMACLALGRVH.HQL...E...Q.........................................................
FBpp0300832  .....AMACLALGRVH.HQL...E...Q.........................................................
FBpp0083238  .....LCARALKGLSL.LRL...G...R.........................................................
FBpp0111383  .....PVLYVNRALCF.IKL...R...E.........................................................
FBpp0080424  .....LKYRLLKAECL.AFL...G...R.........................................................
FBpp0305672  .....LKYRLLKAECL.AFL...G...R.........................................................
FBpp0305670  .....LKYRLLKAECL.AFL...G...R.........................................................
FBpp0071560  .....AKLYNNVGHAL.ENE...G...K.........................................................
FBpp0071561  .....AKLYNNVGHAL.ENE...G...K.........................................................
FBpp0080423  .....LKYRLLKAECL.AFL...G...R.........................................................
FBpp0305671  .....LKYRLLKAECL.AFL...G...R.........................................................
FBpp0071879  .....ADVWVGIGHCF.WKM...G...E.........................................................
FBpp0077738  .....AELINRCADFF.CSI...E...Q.........................................................
FBpp0077934  .....TMILNNMGVCL.LYA...G...K.........................................................
FBpp0292775  .....AELINRCADFF.CSI...E...Q.........................................................
FBpp0087646  .....YTAWTNLGVLY.IKL...N...E.........................................................
FBpp0292906  .....HAFIYGIGVAY.FKL...R...C.........................................................
FBpp0079664  .....HAFIYGIGVAY.FKL...R...C.........................................................
FBpp0086749  .....PRIWMDYGAFM.TSQ...C...K.........................................................
FBpp0082652  .....PVLYCNRALAK.IKK...R...D.........................................................
FBpp0077619  .....EVSRLRLGYIS.YEL...G...N.........................................................
FBpp0086164  .....AFVWLRQAECL.RQL...N...R.........................................................
FBpp0297722  .....AFVWLRQAECL.RQL...N...R.........................................................
FBpp0087232  .....RVVLANRSATL.YHM...Q...K.........................................................
FBpp0072561  .....YETMKILGSLY.AHS...NsqtK.........................................................
FBpp0072562  .....YETMKILGSLY.AHS...NsqtK.........................................................
FBpp0088148  .....AETYLNLSRAH.ASL...G...G.........................................................
FBpp0088149  .....AETYLNLSRAH.ASL...G...G.........................................................
FBpp0075786  .....TNLLLNLSRCK.RKL...N...E.........................................................
FBpp0075788  .....TNLLLNLSRCK.RKL...N...E.........................................................
FBpp0306229  .....TNLLLNLSRCK.RKL...N...E.........................................................
FBpp0075787  .....TNLLLNLSRCK.RKL...N...E.........................................................
FBpp0075789  .....TNLLLNLSRCK.RKL...N...E.........................................................
FBpp0301715  .....TNLLLNLSRCK.RKL...N...E.........................................................
FBpp0301716  .....TNLLLNLSRCK.RKL...N...E.........................................................
FBpp0306230  .....TNLLLNLSRCK.RKL...N...E.........................................................
FBpp0075785  .....TNLLLNLSRCK.RKL...N...E.........................................................
FBpp0083319  .....PTALHCKVVCL.VQL...S...K.........................................................
FBpp0076498  .....FKSLCLRAEVL.LKL...S...H.........................................................
FBpp0293529  .....FKSLCLRAEVL.LKL...S...H.........................................................
FBpp0290580  .....AKYRFYYAQSL.YQA...G...I.........................................................
FBpp0290395  .....LKIRENIGILF.IRM...G...S.........................................................
FBpp0080720  .....VTILNNISVAY.VNL...E...K.........................................................
FBpp0086164  .....SEPFYTLAEIY.ENR...D...E.........................................................
FBpp0297722  .....SEPFYTLAEIY.ENR...D...E.........................................................
FBpp0080741  .....IKYYLIQGQCS.EIF...E...H.........................................................
FBpp0087297  .....IETYKEIGRTL.YIM...G...R.........................................................
FBpp0070720  .....-----------.---...-...-.........................................................
FBpp0089396  .....-----------.---...-...-.........................................................
FBpp0111789  .....-----------.---...-...-.........................................................
FBpp0086683  .....LIALFESLMIC.FNK...M...R.........................................................
FBpp0289328  .....-----------.---...-...-.........................................................
FBpp0070667  .....DIPLLSLGTIL.FRM...G...R.........................................................
FBpp0082624  .....QAINVYLALCF.YKL...D...Y.........................................................
FBpp0081552  .....YEGHKVLCTCY.TGD...E...Q.........................................................
FBpp0086749  .....RHMCVKFAELE.TKL...G...E.........................................................
FBpp0087646  .....DKLYTNLGYLY.LKI...D...Q.........................................................
FBpp0071879  .....TNSWLNLAFAY.EQK...R...L.........................................................
FBpp0080894  .....LDNVDTYSNLL.FVK...E...M.........................................................
FBpp0305185  .....LDNVDTYSNLL.FVK...E...M.........................................................
FBpp0112213  .....-----------.---...-...-.........................................................
FBpp0087233  .....--VLANRSATL.YHM...Q...K.........................................................
FBpp0070906  .....AKHYGNLGRLY.QTM...N...R.........................................................
FBpp0303990  .....AKHYGNLGRLY.QTM...N...R.........................................................
FBpp0087646  .....-----------.---...-...-.........................................................
FBpp0082112  .....TCIANNMGVIH.LRV...R...H.........................................................
FBpp0086359  .....PRLRNQLSLTY.LMV...N...N.........................................................
FBpp0293627  .....PRLRNQLSLTY.LMV...N...N.........................................................
FBpp0076526  .....VPIYVSLYQTY.RDN...G...Q.........................................................
FBpp0085279  .....ASALTNLSFIY.IKM...A...Shcvnqlheigslknnapglinagivelgshn..........................
FBpp0074835  .....-----------.---...E...N.........................................................
FBpp0303989  .....GLSIGHLASLYnYQM...K...K.........................................................
FBpp0078887  .....ALGALRMAQDL.YLA...G...K.........................................................
FBpp0290580  .....PLVAYNVALAH.FQK...K...Q.........................................................
FBpp0085047  .....ADLCRILGQVQ.MKQ...R...N.........................................................
FBpp0296980  .....GSVFSALSSAH.WAL...N...Q.........................................................
FBpp0300832  .....GSVFSALSSAH.WAL...N...Q.........................................................
FBpp0086380  .....ALIDSNISLIL.HAL...G...E.........................................................
FBpp0083435  .....IQIQTNLAACL.LQE...K...R.........................................................
FBpp0078891  .....PALLNGQAVVH.LGL...E...R.........................................................
FBpp0082419  .....-----------.VML...K...D.........................................................
FBpp0082420  .....-----------.VML...K...D.........................................................
FBpp0306145  .....-----------.VML...K...D.........................................................
FBpp0303989  .....AKHYGNLGRLY.QTM...N...R.........................................................
FBpp0305372  .....ALIDSNISLIL.HAL...G...E.........................................................
FBpp0086749  .....-----------.---...-...-.........................................................
FBpp0078027  .....FTTLYRRSQSK.RKN...A...Q.........................................................
FBpp0088148  .....--ALLRMAVSL.RKQ...G...E.........................................................
FBpp0088149  .....--ALLRMAVSL.RKQ...G...E.........................................................
FBpp0290863  .....----SDWAMFF.FTQ...Q...R.........................................................
FBpp0080720  .....LHISSKIAHMS.QLQ...G...D.........................................................
FBpp0083319  .....FEALLIRCTQL.AKD...R...K.........................................................
FBpp0071288  .....-----------.---...-...-.........................................................
FBpp0081398  .....AELHYKIGLTY.LMQ...Q...-.........................................................
FBpp0301016  .....AELHYKIGLTY.LMQ...Q...-.........................................................
FBpp0085015  .....SDIREYASMAN.FEL...G...N.........................................................
FBpp0084188  .....AVGHNMIATCY.SRL...Npp.D.........................................................
FBpp0293235  .....AVGHNMIATCY.SRL...Npp.D.........................................................
FBpp0290580  .....SIWRLNAGHVL.FMQ...Gd..K.........................................................
FBpp0085012  .....ADILEYLAFST.YKE...G...N.........................................................
FBpp0086380  .....GSCLRMLARLS.YLL...G...D.........................................................
FBpp0304708  .....ADLYLKLAEVY.VKQ...Q...N.........................................................
FBpp0305372  .....GSCLRMLARLS.YLL...G...D.........................................................
FBpp0304707  .....ADLYLKLAEVY.VKQ...Q...N.........................................................
FBpp0071879  .....------SAHIA.LVS...G...Q.........................................................
FBpp0076961  .....HKALYLRSKFK.RSV...A...L.........................................................
FBpp0075717  .....ALAYRSRASIL.IRL...G...E.........................................................
FBpp0080267  .....ALAHANRSLVL.FDC...G...L.........................................................
FBpp0070907  tlrcnEHLMMALGKCL.YYN...G...D.........................................................
FBpp0085033  .....VDALRLLAEAQ.IKD...Q...N.........................................................
FBpp0082507  .....FDTASLLAQLH.LQT...Dr..N.........................................................
FBpp0077738  .....--------KLL.QSI...G...H.........................................................
FBpp0292775  .....--------KLL.QSI...G...H.........................................................
FBpp0085676  .....HMTLYKRCQSK.RKA...A...Q.........................................................
FBpp0087091  .....SIGYANRSAVL.FEW...K...R.........................................................
FBpp0082624  .....DVFNYNFAQAK.CAT...G...Y.........................................................
FBpp0070908  .....EHLMMALGKCL.YYN...G...D.........................................................
FBpp0070431  .....GLLHMKLGKIQ.LYE...G...H.........................................................
FBpp0075443  .....IACLLGRCECL.LEL...G...K.........................................................
FBpp0305287  .....IACLLGRCECL.LEL...G...K.........................................................
FBpp0305288  .....IACLLGRCECL.LEL...G...K.........................................................
FBpp0070906  .....GDALLDYGFFL.LNV...D...S.........................................................
FBpp0303990  .....GDALLDYGFFL.LNV...D...S.........................................................
FBpp0073018  .....QYFCVNLAVLH.ATF...G...H.........................................................
FBpp0078634  .....TLVSFYMAQMY.GHL...G...E.........................................................
FBpp0087626  .....SLAFANRGIAL.QEY...G...Y.........................................................
FBpp0075754  .....---------VH.SLL...G...D.........................................................
FBpp0087625  .....SLAFANRGIAL.QEY...G...Y.........................................................
FBpp0071288  .....RRLWSNWI-KF.SRK...S...N.........................................................
FBpp0085046  .....AELFRTLGKVR.FER...R...N.........................................................
FBpp0110159  .....AELFRTLGKVR.FER...R...N.........................................................
FBpp0072679  .....EIAWREIGHHF.ANL...R...S.........................................................
FBpp0306202  .....EIAWREIGHHF.ANL...R...S.........................................................
FBpp0082624  .....------IAFCN.FHL...G...D.........................................................
FBpp0084254  .....ALINLDIVWCY.LRL...K...N.........................................................
FBpp0085032  .....NEVRMVYAETL.LKL...N...Q.........................................................


                                                                                                    
                                                                                                    
d2fbna1        .....................................................................................
FBpp0112456  .....................................................................................
FBpp0297503  .....................................................................................
FBpp0112455  .....................................................................................
FBpp0297502  .....................................................................................
FBpp0070352  .....................................................................................
FBpp0070351  .....................................................................................
FBpp0070402  .....................................................................................
FBpp0080138  .....................................................................................
FBpp0080139  .....................................................................................
FBpp0301685  .....................................................................................
FBpp0074609  .....................................................................................
FBpp0084171  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0305561  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0271718  .....................................................................................
FBpp0290895  lkalpllpqkqravlhlrlgeilaelqdwneaehqqrlamqlqpeqgaayvtygqtlarngsrlaeaeswfkralqlaplepssh
FBpp0290896  lkalpllpqkqravlhlrlgeilaelqdwneaehqqrlamqlqpeqgaayvtygqtlarngsrlaeaeswfkralqlaplepssh
FBpp0081673  .....................................................................................
FBpp0293601  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0296963  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0305185  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0081607  .....................................................................................
FBpp0304082  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0303945  .....................................................................................
FBpp0303946  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0085344  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0297109  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070573  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0305905  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0076114  .....................................................................................
FBpp0076115  .....................................................................................
FBpp0305988  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0293601  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0303945  .....................................................................................
FBpp0303946  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0085409  .....................................................................................
FBpp0271717  .....................................................................................
FBpp0271719  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0303439  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0300561  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0305561  .....................................................................................
FBpp0071712  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0305602  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0079666  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  .....................................................................................
FBpp0082819  .....................................................................................
FBpp0292061  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0081805  .....................................................................................
FBpp0100021  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0074877  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0297722  .....................................................................................
FBpp0087232  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0075786  .....................................................................................
FBpp0075788  .....................................................................................
FBpp0306229  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0075789  .....................................................................................
FBpp0301715  .....................................................................................
FBpp0301716  .....................................................................................
FBpp0306230  .....................................................................................
FBpp0075785  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076498  .....................................................................................
FBpp0293529  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0297722  .....................................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  .....................................................................................
FBpp0089396  .....................................................................................
FBpp0111789  .....................................................................................
FBpp0086683  .....................................................................................
FBpp0289328  .....................................................................................
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0305185  .....................................................................................
FBpp0112213  .....................................................................................
FBpp0087233  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0303990  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0082112  .....................................................................................
FBpp0086359  .....................................................................................
FBpp0293627  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0303989  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085047  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0082420  .....................................................................................
FBpp0306145  .....................................................................................
FBpp0303989  .....................................................................................
FBpp0305372  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0081398  .....................................................................................
FBpp0301016  .....................................................................................
FBpp0085015  .....................................................................................
FBpp0084188  .....................................................................................
FBpp0293235  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0304708  .....................................................................................
FBpp0305372  .....................................................................................
FBpp0304707  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  .....................................................................................
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075443  .....................................................................................
FBpp0305287  .....................................................................................
FBpp0305288  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0303990  .....................................................................................
FBpp0073018  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0087626  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0085046  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0306202  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................


                                                                   90                               
                                                                    |                               
d2fbna1        ..............................................YPKAIDHASKVLK.I........................
FBpp0112456  ..............................................YEKVHTMYNKLLQ.Lpdi.....................
FBpp0297503  ..............................................YEKVHTMYNKLLQ.Lpdi.....................
FBpp0112455  ..............................................IKSARSIFKKARE.D........................
FBpp0297502  ..............................................IKSARSIFKKARE.D........................
FBpp0070352  ..............................................FDKAVDCYQSALQ.V........................
FBpp0070351  ..............................................FDKAVDCYQSALQ.V........................
FBpp0070402  ..............................................VNHARNLWDRAVT.I........................
FBpp0080138  ..............................................---VAKYYLEAFK.L........................
FBpp0080139  ..............................................---VAKYYLEAFK.L........................
FBpp0301685  ..............................................-------------.-........................
FBpp0074609  ..............................................LAKSIQHYEQAAD.Y........................
FBpp0084171  ..............................................YMEAARYYQRAQE.L........................
FBpp0085420  ..............................................LKEALMHYKEAIR.I........................
FBpp0085421  ..............................................LKEALMHYKEAIR.I........................
FBpp0085422  ..............................................LKEALMHYKEAIR.I........................
FBpp0085420  ..............................................IWLAIHHFEKAVT.L........................
FBpp0085421  ..............................................IWLAIHHFEKAVT.L........................
FBpp0085422  ..............................................IWLAIHHFEKAVT.L........................
FBpp0077790  ..............................................YEECIKQCEKGIE.V........................
FBpp0082545  ..............................................LSTAEEYIRLALQ.A........................
FBpp0084693  ..............................................LDKCRELYKHYIE.S........................
FBpp0084691  ..............................................LDKCRELYKHYIE.S........................
FBpp0084692  ..............................................LDKCRELYKHYIE.S........................
FBpp0084694  ..............................................LDKCRELYKHYIE.S........................
FBpp0112211  ..............................................LDKCRELYKHYIE.S........................
FBpp0072096  ..............................................PEAAASALDKAAK.Ltesk....................
FBpp0071560  ..............................................SQQAQVYFNKAIE.L........................
FBpp0071561  ..............................................SQQAQVYFNKAIE.L........................
FBpp0077790  ..............................................FDLGLKDCDTCIK.L........................
FBpp0076600  ..............................................YELAEIHYVKALK.I........................
FBpp0305561  ..............................................YELAEIHYVKALK.I........................
FBpp0271716  ..............................................VRKGIMILEELAR.T........................
FBpp0077790  ..............................................FQEALEDAEKTIQ.L........................
FBpp0271718  ..............................................VRKGIMILEELAR.T........................
FBpp0290895  hhyadfleqqerhhealglrlraaalapqdytlqscvadalrllnrLAEAELWYRKAVT.L........................
FBpp0290896  hhyadfleqqerhhealglrlraaalapqdytlqscvadalrllnrLAEAELWYRKAVT.L........................
FBpp0081673  ..............................................PEAAAAALDKAAK.Mtesk....................
FBpp0293601  ..............................................YPAAVECFQRAIK.F........................
FBpp0077614  ..............................................YPAAVECFQRAIK.F........................
FBpp0084692  ..............................................AEAAREAYDTFLS.H........................
FBpp0084694  ..............................................AEAAREAYDTFLS.H........................
FBpp0112211  ..............................................AEAAREAYDTFLS.H........................
FBpp0084691  ..............................................AEAAREAYDTFLS.H........................
FBpp0084693  ..............................................AEAAREAYDTFLS.H........................
FBpp0296980  ..............................................FTAALQDATQARD.L........................
FBpp0300832  ..............................................FTAALQDATQARD.L........................
FBpp0080535  ..............................................NERAVTDCKSALV.Y........................
FBpp0296963  ..............................................NERAVTDCKSALV.Y........................
FBpp0296980  ..............................................YEEAVPHYESYLM.L........................
FBpp0300832  ..............................................YEEAVPHYESYLM.L........................
FBpp0072164  ..............................................FDQCVEDCEAAIA.L........................
FBpp0084016  ..............................................NDMAQTLLDDVVT.S........................
FBpp0296980  ..............................................CEAALDCHSQHLR.L........................
FBpp0300832  ..............................................CEAALDCHSQHLR.L........................
FBpp0296980  ..............................................LPAALVCLEKRLV.V........................
FBpp0300832  ..............................................LPAALVCLEKRLV.V........................
FBpp0080894  ..............................................TNAAIQSYRKAVE.V........................
FBpp0305185  ..............................................TNAAIQSYRKAVE.V........................
FBpp0081606  ..............................................FGFALQDGVSAVK.A........................
FBpp0081607  ..............................................FGFALQDGVSAVK.A........................
FBpp0304082  ..............................................FGFALQDGVSAVK.A........................
FBpp0084559  ..............................................FEDAAEHYKRTLA.L........................
FBpp0075683  ..............................................YDEVEKYYQRALD.Iyesklgpd................
FBpp0303945  ..............................................YDEVEKYYQRALD.Iyesklgpd................
FBpp0303946  ..............................................YDEVEKYYQRALD.Iyesklgpd................
FBpp0081284  ..............................................YENAVEDCTESLK.A........................
FBpp0079468  ..............................................HFEAKQECNEVLA.L........................
FBpp0087297  ..............................................FIVAISSLRKSVW.L........................
FBpp0074835  ..............................................LTKARSILERGRL.R........................
FBpp0079893  ..............................................FTQAEEYYKKAMV.L........................
FBpp0079894  ..............................................FTQAEEYYKKAMV.L........................
FBpp0079895  ..............................................FTQAEEYYKKAMV.L........................
FBpp0082765  ..............................................NKAAIDDCTKAIE.L........................
FBpp0079617  ..............................................WELCCQDSRRALD.I........................
FBpp0084440  ..............................................YFSAISDCQACLQ.I........................
FBpp0305670  ..............................................YNSALTDARHAIR.I........................
FBpp0080423  ..............................................YNSALTDARHAIR.I........................
FBpp0305671  ..............................................YNSALTDARHAIR.I........................
FBpp0080424  ..............................................YNSALTDARHAIR.I........................
FBpp0305672  ..............................................YNSALTDARHAIR.I........................
FBpp0085344  ..............................................WFDAKQCFLNAVA.A........................
FBpp0081552  ..............................................TRFAVQDFSRVLE.L........................
FBpp0297109  ..............................................WFDAKQCFLNAVA.A........................
FBpp0087646  ..............................................WDSAIQCFRIAIK.N........................
FBpp0083769  ..............................................YEEALYNFQYALL.L........................
FBpp0070572  ..............................................PNACIRDCDVALE.L........................
FBpp0070573  ..............................................PNACIRDCDVALE.L........................
FBpp0070575  ..............................................PNACIRDCDVALE.L........................
FBpp0305905  ..............................................PNACIRDCDVALE.L........................
FBpp0074835  ..............................................YERARRLLAKARG.S........................
FBpp0305670  ..............................................LREAVADCNRVLE.L........................
FBpp0080424  ..............................................LREAVADCNRVLE.L........................
FBpp0305672  ..............................................LREAVADCNRVLE.L........................
FBpp0080423  ..............................................LREAVADCNRVLE.L........................
FBpp0305671  ..............................................LREAVADCNRVLE.L........................
FBpp0076113  ..............................................YTSAREVCNEAIR.L........................
FBpp0076114  ..............................................YTSAREVCNEAIR.L........................
FBpp0076115  ..............................................YTSAREVCNEAIR.L........................
FBpp0305988  ..............................................YTSAREVCNEAIR.L........................
FBpp0072561  ..............................................YISAIQMYENCMK.Kfy......................
FBpp0072562  ..............................................YISAIQMYENCMK.Kfy......................
FBpp0072561  ..............................................YDQAFQYYYQSTQ.I........................
FBpp0072562  ..............................................YDQAFQYYYQSTQ.I........................
FBpp0085923  ..............................................IYAALRDCHEALR.L........................
FBpp0293601  ..............................................KVDAEMWYRKAVA.L........................
FBpp0079893  ..............................................WSNVKEDCTASLE.F........................
FBpp0079894  ..............................................WSNVKEDCTASLE.F........................
FBpp0079895  ..............................................WSNVKEDCTASLE.F........................
FBpp0075683  ..............................................YKEAANLLNDALS.Irgktlgen................
FBpp0303945  ..............................................YKEAANLLNDALS.Irgktlgen................
FBpp0303946  ..............................................YKEAANLLNDALS.Irgktlgen................
FBpp0077614  ..............................................KVDAEMWYRKAVA.L........................
FBpp0085409  ..............................................YTSGLKYCRAFLD.I........................
FBpp0271717  ..............................................YTSGLKYCRAFLD.I........................
FBpp0271719  ..............................................YTSGLKYCRAFLD.I........................
FBpp0086749  ..............................................LERARDLFEQCLD.Q........................
FBpp0073411  ..............................................FYAVIEHCNEVLT.L........................
FBpp0070907  ..............................................FERGLNFVEKCLD.S........................
FBpp0303439  ..............................................FYAVIEHCNEVLT.L........................
FBpp0070908  ..............................................FERGLNFVEKCLD.S........................
FBpp0085842  ..............................................YDAALQSVEHVLR.C........................
FBpp0300561  ..............................................ASKALQDAETALG.E........................
FBpp0077718  ..............................................IDLVLPCFQRALA.Tat......................
FBpp0296980  ..............................................WDKALGHHTQELT.L........................
FBpp0300832  ..............................................WDKALGHHTQELT.L........................
FBpp0076600  ..............................................YAEAESALISTGF.A........................
FBpp0305561  ..............................................YAEAESALISTGF.A........................
FBpp0071712  ..............................................ASKALQDAETALG.E........................
FBpp0086749  ..............................................VEDARVVFERGTE.Veyvk....................
FBpp0085479  ..............................................YRSSLSDAQRALF.Y........................
FBpp0112016  ..............................................ASKALQDAETALG.E........................
FBpp0292906  ..............................................PTDALQAYICAVQ.L........................
FBpp0305602  ..............................................PTDALQAYICAVQ.L........................
FBpp0079665  ..............................................PTDALQAYICAVQ.L........................
FBpp0079666  ..............................................PTDALQAYICAVQ.L........................
FBpp0079664  ..............................................PTDALQAYICAVQ.L........................
FBpp0084076  ..............................................YKRALKDCQYVLE.Kl.......................
FBpp0111406  ..............................................FKRGIVDCDFVLN.Kl.......................
FBpp0074918  ..............................................WEPAVKYYLAYTH.L........................
FBpp0082818  ..............................................FGKAAFCMEEVLL.H........................
FBpp0074480  ..............................................-------------.-........................
FBpp0082819  ..............................................FGKAAFCMEEVLL.H........................
FBpp0292061  ..............................................FLKGLQDFEKALH.L........................
FBpp0085279  ..............................................HQEANQYYNEAYR.I........................
FBpp0081805  ..............................................FLKGLQDFEKALH.L........................
FBpp0100021  ..............................................YNQSENWLELALY.H........................
FBpp0100023  ..............................................YNQSENWLELALY.H........................
FBpp0074877  ..............................................YNQSENWLELALY.H........................
FBpp0071879  ..............................................LSAGGAIFKQIIE.C........................
FBpp0084559  ..............................................FDEAAICCERHLT.L........................
FBpp0075591  ..............................................DEEALDDLNKALE.L........................
FBpp0076526  ..............................................FQESIEYIDKAIK.I........................
FBpp0079851  ..............................................YELAEKAFNICLP.A........................
FBpp0290395  ..............................................HQEANQYYNEAYR.I........................
FBpp0072146  ..............................................PKRACIMMKALRH.L........................
FBpp0296980  ..............................................HNQAVDYLRQGLA.S........................
FBpp0300832  ..............................................HNQAVDYLRQGLA.S........................
FBpp0083238  ..............................................YDESHGCLQTVAE.E........................
FBpp0111383  ..............................................FKLGIIDCDYVLA.Ki.......................
FBpp0080424  ..............................................CDEALDIAVSVMK.L........................
FBpp0305672  ..............................................CDEALDIAVSVMK.L........................
FBpp0305670  ..............................................CDEALDIAVSVMK.L........................
FBpp0071560  ..............................................FEEALLYFQQAVR.I........................
FBpp0071561  ..............................................FEEALLYFQQAVR.I........................
FBpp0080423  ..............................................CDEALDIAVSVMK.L........................
FBpp0305671  ..............................................CDEALDIAVSVMK.L........................
FBpp0071879  ..............................................LEKAQLSFQIALE.H........................
FBpp0077738  ..............................................FQKAVHLLAKTRH.Leralgicsekgvpvteelsemltp
FBpp0077934  ..............................................LKDAINLYERAIN.L........................
FBpp0292775  ..............................................FQKAVHLLAKTRH.Leralgicsekgvpvteelsemltp
FBpp0087646  ..............................................VRLANEAFTRAQQ.S........................
FBpp0292906  ..............................................FKWAIKSFQELLY.L........................
FBpp0079664  ..............................................FKWAIKSFQELLY.L........................
FBpp0086749  ..............................................ITRTRHVFDRALR.A........................
FBpp0082652  ..............................................FKLALFDLDYVIFnL........................
FBpp0077619  ..............................................YNKCIEALSFPFA.G........................
FBpp0086164  ..............................................TNEAIQSYEKVVQ.L........................
FBpp0297722  ..............................................TNEAIQSYEKVVQ.L........................
FBpp0087232  ..............................................YQECLIDIKRALD.L........................
FBpp0072561  ..............................................RDMAKTHLKKVTE.Q........................
FBpp0072562  ..............................................RDMAKTHLKKVTE.Q........................
FBpp0088148  ..............................................LERSLSYARHSLY.N........................
FBpp0088149  ..............................................LERSLSYARHSLY.N........................
FBpp0075786  ..............................................LDASIDLATQAIA.Q........................
FBpp0075788  ..............................................LDASIDLATQAIA.Q........................
FBpp0306229  ..............................................LDASIDLATQAIA.Q........................
FBpp0075787  ..............................................LDASIDLATQAIA.Q........................
FBpp0075789  ..............................................LDASIDLATQAIA.Q........................
FBpp0301715  ..............................................LDASIDLATQAIA.Q........................
FBpp0301716  ..............................................LDASIDLATQAIA.Q........................
FBpp0306230  ..............................................LDASIDLATQAIA.Q........................
FBpp0075785  ..............................................LDASIDLATQAIA.Q........................
FBpp0083319  ..............................................FEEAYKFIEK---.-........................
FBpp0076498  ..............................................YQSSLADIENALR.T........................
FBpp0293529  ..............................................YQSSLADIENALR.T........................
FBpp0290580  ..............................................FADALRVLKQMGD.Qedelreqclqlqsailys......
FBpp0290395  ..............................................YSDAASSFEFIMT.-........................
FBpp0080720  ..............................................YAEARETLLEAME.L........................
FBpp0086164  ..............................................VK-FLNFSTLAAH.L........................
FBpp0297722  ..............................................VK-FLNFSTLAAH.L........................
FBpp0080741  ..............................................VEKATSCYKRALR.L........................
FBpp0087297  ..............................................FSQALGVFREAEQ.Rs.......................
FBpp0070720  ..............................................-------------.-........................
FBpp0089396  ..............................................-------------.-........................
FBpp0111789  ..............................................-------------.-........................
FBpp0086683  ..............................................QSRCVCYVMKELR.Llti.....................
FBpp0289328  ..............................................-------------.-........................
FBpp0070667  ..............................................LADADLILTAAVE.H........................
FBpp0082624  ..............................................YDMSQEVLDVYLS.Q........................
FBpp0081552  ..............................................FGKALQQCKEALD.I........................
FBpp0086749  ..............................................VDRARAIYAHCSQ.V........................
FBpp0087646  ..............................................PEQAAHALNTVAH.-........................
FBpp0071879  ..............................................WAHGVNAYQKAID.I........................
FBpp0080894  ..............................................KTEMAQLAHKAVS.I........................
FBpp0305185  ..............................................KTEMAQLAHKAVS.I........................
FBpp0112213  ..............................................----------AVK.E........................
FBpp0087233  ..............................................YQECLIDIKRALD.L........................
FBpp0070906  ..............................................FEEAERMHKKAIK.I........................
FBpp0303990  ..............................................FEEAERMHKKAIK.I........................
FBpp0087646  ..............................................-------------.-........................
FBpp0082112  ..............................................YAIAAKFFQNALN.F........................
FBpp0086359  ..............................................LQQVEKVAVETLK.L........................
FBpp0293627  ..............................................LQQVEKVAVETLK.L........................
FBpp0076526  ..............................................FDKALEYLWKEFE.L........................
FBpp0085279  ..............................................LILASERFEGALQ.L........................
FBpp0074835  ..............................................PDDARILLSRAVE.C........................
FBpp0303989  ..............................................YRDAEQLYMRSID.Islrlfgns................
FBpp0078887  ..............................................DDKAARLFEHALA.L........................
FBpp0290580  ..............................................RAQALDYTSEIVE.Rgmrnhp..................
FBpp0085047  ..............................................HEGALQAYQVALK.L........................
FBpp0296980  ..............................................LDQAIGYMQQDLA.V........................
FBpp0300832  ..............................................LDQAIGYMQQDLA.V........................
FBpp0086380  ..............................................YELSLRFIEHALK.L........................
FBpp0083435  ..............................................YEHVIYHTQFVET.E........................
FBpp0078891  ..............................................YEEADSVLRESLL.K........................
FBpp0082419  ..............................................YKKALKYCKLILQ.Y........................
FBpp0082420  ..............................................YKKALKYCKLILQ.Y........................
FBpp0306145  ..............................................YKKALKYCKLILQ.Y........................
FBpp0303989  ..............................................FEEAERMHKKAIK.I........................
FBpp0305372  ..............................................YELSLRFIEHALK.L........................
FBpp0086749  ..............................................-------------.-........................
FBpp0078027  ..............................................ADGALKDSLEAKR.L........................
FBpp0088148  ..............................................LGDAQDYCKEATK.Lslisgd..................
FBpp0088149  ..............................................LGDAQDYCKEATK.Lslisgd..................
FBpp0290863  ..............................................YANGLRYFNSALD.L........................
FBpp0080720  ..............................................LEKSFQGFTWTLQ.Qlakllekmp...............
FBpp0083319  ..............................................HKEAIEQLQKFAA.A........................
FBpp0071288  ..............................................----------I--.-........................
FBpp0081398  ..............................................-------------.-........................
FBpp0301016  ..............................................-------------.-........................
FBpp0085015  ..............................................PKKAARLLSQILE.S........................
FBpp0084188  ..............................................VTEALQHYQRSIQ.I........................
FBpp0293235  ..............................................VTEALQHYQRSIQ.I........................
FBpp0290580  ..............................................YNEAAAFYEPIVR.Q........................
FBpp0085012  ..............................................IESALTMTNELLQ.L........................
FBpp0086380  ..............................................AQDALAIQQRAVI.Mservngmd................
FBpp0304708  ..............................................WTLALETVEFALK.S........................
FBpp0305372  ..............................................AQDALAIQQRAVI.Mservngmd................
FBpp0304707  ..............................................WTLALETVEFALK.S........................
FBpp0071879  ..............................................YRLAIQTYERCLK.Dh.......................
FBpp0076961  ..............................................TQDALEDSLRAME.V........................
FBpp0075717  ..............................................GEAALNDLKLAIN.Fgle.....................
FBpp0080267  ..............................................YAESYDDCLCALD.Lgyp.....................
FBpp0070907  ..............................................YFQAEDIFSSTLC.A........................
FBpp0085033  ..............................................YSEALPLLHNCLK.L........................
FBpp0082507  ..............................................SHQAKAMLRRAVE.L........................
FBpp0077738  ..............................................LDEAVELAEAEDR.I........................
FBpp0292775  ..............................................LDEAVELAEAEDR.I........................
FBpp0085676  ..............................................MLGALDDSRAAAK.L........................
FBpp0087091  ..............................................YRQCLDNIKLARQ.-........................
FBpp0082624  ..............................................YKEAEELLMQISD.M........................
FBpp0070908  ..............................................YFQAEDIFSSTLC.A........................
FBpp0070431  ..............................................SKEALHHLEEAQR.I........................
FBpp0075443  ..............................................FEGCLADAYKVLT.L........................
FBpp0305287  ..............................................FEGCLADAYKVLT.L........................
FBpp0305288  ..............................................FEGCLADAYKVLT.L........................
FBpp0070906  ..............................................VFQSVNIYKEALA.V........................
FBpp0303990  ..............................................VFQSVNIYKEALA.V........................
FBpp0073018  ..............................................RDEALAALRESIM.L........................
FBpp0078634  ..............................................PEKSAKCCHRTLH.Rqleskty.................
FBpp0087626  ..............................................YREAYDDCSNALE.Cg.......................
FBpp0075754  ..............................................YYQAIKVLEP-IE.I........................
FBpp0087625  ..............................................YREAYDDCSNALE.Cg.......................
FBpp0071288  ..............................................PVEVAGIYEKMLL.Y........................
FBpp0085046  ..............................................EEGALKAYQAALK.H........................
FBpp0110159  ..............................................EEGALKAYQAALK.H........................
FBpp0072679  ..............................................WESAREYYEKSHY.L........................
FBpp0306202  ..............................................WESAREYYEKSHY.L........................
FBpp0082624  ..............................................YQQALAQYKAIQQ.G........................
FBpp0084254  ..............................................ITQ-LPDAQRRLD.Icergfvksygeqfirlfsik....
FBpp0085032  ..............................................HADALKVVNIALT.D........................


                        100                                                                      110
                          |                                                                        |
d2fbna1        ......DK..NN..............................................................VKALYKLG.VA
FBpp0112456  ......DP..T-..............................................................-LVYVQYM.KF
FBpp0297503  ......DP..T-..............................................................-LVYVQYM.KF
FBpp0112455  ......VR..SR..............................................................YHIFVAAA.LM
FBpp0297502  ......VR..SR..............................................................YHIFVAAA.LM
FBpp0070352  ......DP..QN..............................................................AKTWNRLG.AS
FBpp0070351  ......DP..QN..............................................................AKTWNRLG.AS
FBpp0070402  ......MP..RV..............................................................NQFWYKYT.YM
FBpp0080138  ......NP..AI..............................................................GMAQNQLG.TL
FBpp0080139  ......NP..AI..............................................................GMAQNQLG.TL
FBpp0301685  ......--..--..............................................................--------.--
FBpp0074609  ......FK..GEesvssa........................................................NKCMLKVA.QY
FBpp0084171  ......VP..GN..............................................................GAPFNQLA.VI
FBpp0085420  ......QP..TF..............................................................ADAYSNMG.NT
FBpp0085421  ......QP..TF..............................................................ADAYSNMG.NT
FBpp0085422  ......QP..TF..............................................................ADAYSNMG.NT
FBpp0085420  ......DP..NF..............................................................LDAYINLG.NV
FBpp0085421  ......DP..NF..............................................................LDAYINLG.NV
FBpp0085422  ......DP..NF..............................................................LDAYINLG.NV
FBpp0077790  ......GR..ESradfkli.......................................................AKSFARIG.NT
FBpp0082545  ......YP..AF..............................................................PAAWMNLG.IV
FBpp0084693  ......TK..NKgiag..........................................................SLAIKYAR.FL
FBpp0084691  ......TK..NKgiag..........................................................SLAIKYAR.FL
FBpp0084692  ......TK..NKgiag..........................................................SLAIKYAR.FL
FBpp0084694  ......TK..NKgiag..........................................................SLAIKYAR.FL
FBpp0112211  ......TK..NKgiag..........................................................SLAIKYAR.FL
FBpp0072096  ......HP..DMalrfyqhalevimiedsvrqa.........................................AEYASKVS.RI
FBpp0071560  ......--..--..............................................................--------.--
FBpp0071561  ......--..--..............................................................--------.--
FBpp0077790  ......DE..KF..............................................................IKGYIRKG.KI
FBpp0076600  ......NP..QN..............................................................SVILVHIG.AM
FBpp0305561  ......NP..QN..............................................................SVILVHIG.AM
FBpp0271716  ......HP..DGr.............................................................RDYIYYLA.FG
FBpp0077790  ......NP..TW..............................................................PKGYSRKG.AA
FBpp0271718  ......HP..DGr.............................................................RDYIYYLA.FG
FBpp0290895  ......QP..MA..............................................................AHAHANLG.AI
FBpp0290896  ......QP..MA..............................................................AHAHANLG.AI
FBpp0081673  ......HP..DL..............................................................ALGFYKRA.LA
FBpp0293601  ......RP..NL..............................................................AVAYLNLG.IS
FBpp0077614  ......RP..NL..............................................................AVAYLNLG.IS
FBpp0084692  ......YP..YC..............................................................YGYWRKYA.DY
FBpp0084694  ......YP..YC..............................................................YGYWRKYA.DY
FBpp0112211  ......YP..YC..............................................................YGYWRKYA.DY
FBpp0084691  ......YP..YC..............................................................YGYWRKYA.DY
FBpp0084693  ......YP..YC..............................................................YGYWRKYA.DY
FBpp0296980  ......CP..QW..............................................................PKAYFRQG.VA
FBpp0300832  ......CP..QW..............................................................PKAYFRQG.VA
FBpp0080535  ......NN..NY..............................................................SKAYCRLG.VA
FBpp0296963  ......NN..NY..............................................................SKAYCRLG.VA
FBpp0296980  ......AQ..ELgdvaae........................................................GKACHLLG.YA
FBpp0300832  ......AQ..ELgdvaae........................................................GKACHLLG.YA
FBpp0072164  ......DK..LC..............................................................VKAYYRRM.QA
FBpp0084016  ......YP..KR..............................................................IDIWSVYV.DM
FBpp0296980  ......AR..KLhdqvee........................................................ARAYSNLG.SA
FBpp0300832  ......AR..KLhdqvee........................................................ARAYSNLG.SA
FBpp0296980  ......AH..ELhspeik........................................................ALAYGDLG.HV
FBpp0300832  ......AH..ELhspeik........................................................ALAYGDLG.HV
FBpp0080894  ......NK..RD..............................................................YRAWYGLG.QA
FBpp0305185  ......NK..RD..............................................................YRAWYGLG.QA
FBpp0081606  ......DP..AY..............................................................LKGYYRRA.AA
FBpp0081607  ......DP..AY..............................................................LKGYYRRA.AA
FBpp0304082  ......DP..AY..............................................................LKGYYRRA.AA
FBpp0084559  ......AV..ELgereve........................................................AQSCYSLG.NT
FBpp0075683  ......DP..NV..............................................................AKTKNNLA.GC
FBpp0303945  ......DP..NV..............................................................AKTKNNLA.GC
FBpp0303946  ......DP..NV..............................................................AKTKNNLA.GC
FBpp0081284  ......AP..GD..............................................................PKALFRRA.QA
FBpp0079468  ......DK..NN..............................................................VKALYRRG.QC
FBpp0087297  ......SP..LN..............................................................YNALYNLS.LI
FBpp0074835  ......NP..KV..............................................................AVLWLEAI.RV
FBpp0079893  ......AP..TN..............................................................PALIVHQAiMV
FBpp0079894  ......AP..TN..............................................................PALIVHQAiMV
FBpp0079895  ......AP..TN..............................................................PALIVHQAiMV
FBpp0082765  ......WP..EY..............................................................VRVLLRRA.KL
FBpp0079617  ......DG..NL..............................................................LKGHFFLG.QG
FBpp0084440  ......DP..MN..............................................................IKAHLRMA.EA
FBpp0305670  ......DP..GF..............................................................EKAYVRVA.KC
FBpp0080423  ......DP..GF..............................................................EKAYVRVA.KC
FBpp0305671  ......DP..GF..............................................................EKAYVRVA.KC
FBpp0080424  ......DP..GF..............................................................EKAYVRVA.KC
FBpp0305672  ......DP..GF..............................................................EKAYVRVA.KC
FBpp0085344  ......NP..NH..............................................................TEALRALG.EA
FBpp0081552  ......KP..DF..............................................................MAARIQRG.VV
FBpp0297109  ......NP..NH..............................................................TEALRALG.EA
FBpp0087646  ......DS..RC..............................................................ISYWESLG.DA
FBpp0083769  ......KP..QS..............................................................PTTYTSIG.FI
FBpp0070572  ......NS..DL..............................................................AAGYKFRG.RA
FBpp0070573  ......NS..DL..............................................................AAGYKFRG.RA
FBpp0070575  ......NS..DL..............................................................AAGYKFRG.RA
FBpp0305905  ......NS..DL..............................................................AAGYKFRG.RA
FBpp0074835  ......AP..T-..............................................................PRVMMKSA.RL
FBpp0305670  ......NS..QY..............................................................LKALLLRA.RC
FBpp0080424  ......NS..QY..............................................................LKALLLRA.RC
FBpp0305672  ......NS..QY..............................................................LKALLLRA.RC
FBpp0080423  ......NS..QY..............................................................LKALLLRA.RC
FBpp0305671  ......NS..QY..............................................................LKALLLRA.RC
FBpp0076113  ......DP..KC..............................................................SKAFYRRA.QA
FBpp0076114  ......DP..KC..............................................................SKAFYRRA.QA
FBpp0076115  ......DP..KC..............................................................SKAFYRRA.QA
FBpp0305988  ......DP..KC..............................................................SKAFYRRA.QA
FBpp0072561  ......KH..NN..............................................................VEVMQYLA.RA
FBpp0072562  ......KH..NN..............................................................VEVMQYLA.RA
FBpp0072561  ......AP..ANf.............................................................VLPHYGLG.QM
FBpp0072562  ......AP..ANf.............................................................VLPHYGLG.QM
FBpp0085923  ......DP..SY..............................................................VKAHFRLA.RA
FBpp0293601  ......RP..GD..............................................................AHAHTNLG.AI
FBpp0079893  ......NP..RY..............................................................AKAYYRRA.RA
FBpp0079894  ......NP..RY..............................................................AKAYYRRA.RA
FBpp0079895  ......NP..RY..............................................................AKAYYRRA.RA
FBpp0075683  ......HP..AV..............................................................AATLNNLA.VL
FBpp0303945  ......HP..AV..............................................................AATLNNLA.VL
FBpp0303946  ......HP..AV..............................................................AATLNNLA.VL
FBpp0077614  ......RP..GD..............................................................AHAHTNLG.AI
FBpp0085409  ......ES..ND..............................................................--------.--
FBpp0271717  ......ES..ND..............................................................--------.--
FBpp0271719  ......ES..ND..............................................................--------.--
FBpp0086749  ......CP..PEha............................................................KYFYLLYA.KL
FBpp0073411  ......DP..RN..............................................................VKALFRRA.KA
FBpp0070907  ......EP..RN..............................................................HEALILRG.RL
FBpp0303439  ......DP..RN..............................................................VKALFRRA.KA
FBpp0070908  ......EP..RN..............................................................HEALILRG.RL
FBpp0085842  ......QP..NN..............................................................SKALYRKG.RI
FBpp0300561  ......DK..NN..............................................................IRAIYQKA.ES
FBpp0077718  ......QP..GQk.............................................................SDIWYNLS.FV
FBpp0296980  ......RQ..ELgdlsge........................................................CRAHGHLG.AV
FBpp0300832  ......RQ..ELgdlsge........................................................CRAHGHLG.AV
FBpp0076600  ......DA..KNcdelqrdfgdla..................................................CFAYQLMA.QI
FBpp0305561  ......DA..KNcdelqrdfgdla..................................................CFAYQLMA.QI
FBpp0071712  ......DK..NN..............................................................IRAIYQKA.ES
FBpp0086749  ......VE..DL..............................................................AAVWCEWA.EM
FBpp0085479  ......KP..DY..............................................................TKARWRSA.QC
FBpp0112016  ......DK..NN..............................................................IRAIYQKA.ES
FBpp0292906  ......DK..DH..............................................................KAAWTNLG.IL
FBpp0305602  ......DK..DH..............................................................KAAWTNLG.IL
FBpp0079665  ......DK..DH..............................................................KAAWTNLG.IL
FBpp0079666  ......DK..DH..............................................................KAAWTNLG.IL
FBpp0079664  ......DK..DH..............................................................KAAWTNLG.IL
FBpp0084076  ......QE..SN..............................................................LRAWLYQA.HA
FBpp0111406  ......DE..KN..............................................................LRAWMYRA.MA
FBpp0074918  ......EP..NG..............................................................FESWNNLA.KA
FBpp0082818  ......NP..HS..............................................................HLIHQRLA.EI
FBpp0074480  ......--..--..............................................................LQILKDLS.LL
FBpp0082819  ......NP..HS..............................................................HLIHQRLA.EI
FBpp0292061  ......NK..YHvnarkym.......................................................GETLVALG.RS
FBpp0085279  ......NM..SD..............................................................IGIASSIG.SY
FBpp0081805  ......NK..YHvnarkym.......................................................GETLVALG.RS
FBpp0100021  ......YD..DNvspevlkiklwny.................................................PNLLESLV.EA
FBpp0100023  ......YD..DNvspevlkiklwny.................................................PNLLESLV.EA
FBpp0074877  ......YD..DNvspevlkiklwny.................................................PNLLESLV.EA
FBpp0071879  ......GN..KC..............................................................IPAIINSA.HI
FBpp0084559  ......AR..QLgdrlse........................................................GRALYNLG.NV
FBpp0075591  ......AN..DQqtrtk.........................................................CHAHCQRG.VL
FBpp0076526  ......SK..THelwdlt........................................................HLCYISMS.LL
FBpp0079851  ......RR..KN..............................................................FIANYGMG.LT
FBpp0290395  ......NM..SD..............................................................IGIASSIG.SY
FBpp0072146  ......TM..GNps............................................................CKALFQEG.RA
FBpp0296980  ......AQ..TTgkseee........................................................AKIRHQLG.LA
FBpp0300832  ......AQ..TTgkseee........................................................AKIRHQLG.LA
FBpp0083238  ......KP..TD..............................................................DSTLQVLS.FC
FBpp0111383  ......DE..HY..............................................................LRAWLYRA.AA
FBpp0080424  ......DT..TS..............................................................ADAIYVRG.LC
FBpp0305672  ......DT..TS..............................................................ADAIYVRG.LC
FBpp0305670  ......DT..TS..............................................................ADAIYVRG.LC
FBpp0071560  ......QT..DD..............................................................IGAHINVG.RT
FBpp0071561  ......QT..DD..............................................................IGAHINVG.RT
FBpp0080423  ......DT..TS..............................................................ADAIYVRG.LC
FBpp0305671  ......DT..TS..............................................................ADAIYVRG.LC
FBpp0071879  ......NG..QC..............................................................LNAALALA.LV
FBpp0077738  ekgefeEA..TR..............................................................VHILVQLG.EF
FBpp0077934  ......NP..QKsln...........................................................ESLLVNLS.TL
FBpp0292775  ekgefeEA..TR..............................................................VHILVQLG.EF
FBpp0087646  ......SP..VY..............................................................ANAWIGQA.MV
FBpp0292906  ......SP..NFtca...........................................................NEVHLRLG.LM
FBpp0079664  ......SP..NFtca...........................................................NEVHLRLG.LM
FBpp0086749  ......LPitQH..............................................................GRIWPLYL.QF
FBpp0082652  ......DP..IH..............................................................LRAWLYRA.GA
FBpp0077619  ......QL..LS..............................................................IVANYMIG.KS
FBpp0086164  ......AP..FC..............................................................YDARFTLS.AL
FBpp0297722  ......AP..FC..............................................................YDARFTLS.AL
FBpp0087232  ......SY..SKdli...........................................................YKLYERQA.RC
FBpp0072561  ......FP..ED..............................................................IEAWIELA.QI
FBpp0072562  ......FP..ED..............................................................IEAWIELA.QI
FBpp0088148  ......EC..GTkcrs..........................................................GLVHLTVA.RV
FBpp0088149  ......EC..GTkcrs..........................................................GLVHLTVA.RV
FBpp0075786  ......KP..HS..............................................................YEGYYARA.KA
FBpp0075788  ......KP..HS..............................................................YEGYYARA.KA
FBpp0306229  ......KP..HS..............................................................YEGYYARA.KA
FBpp0075787  ......KP..HS..............................................................YEGYYARA.KA
FBpp0075789  ......KP..HS..............................................................YEGYYARA.KA
FBpp0301715  ......KP..HS..............................................................YEGYYARA.KA
FBpp0301716  ......KP..HS..............................................................YEGYYARA.KA
FBpp0306230  ......KP..HS..............................................................YEGYYARA.KA
FBpp0075785  ......KP..HS..............................................................YEGYYARA.KA
FBpp0083319  ......-N..RL..............................................................SSLFFEKA.YC
FBpp0076498  ......RC..TS..............................................................PKAHYLRA.LA
FBpp0293529  ......RC..TS..............................................................PKAHYLRA.LA
FBpp0290580  ......S-..-Edfagaqsllnqraggt..............................................ADTLNDEG.CL
FBpp0290395  ......ER..AN..............................................................IRSSIHLL.LC
FBpp0080720  ......TK..ELkdatqe........................................................GILQANLG.LV
FBpp0086164  ......NP..QD..............................................................RDMWIRVS.DL
FBpp0297722  ......NP..QD..............................................................RDMWIRVS.DL
FBpp0080741  ......SR..LYthrdle........................................................AEILLHLG.KI
FBpp0087297  ......SR..QD..............................................................HEIYHYLG.EL
FBpp0070720  ......--..--..............................................................--------.--
FBpp0089396  ......--..--..............................................................--------.--
FBpp0111789  ......--..--..............................................................--------.--
FBpp0086683  ......NN..PS..............................................................ALALCQHG.RA
FBpp0289328  ......--..--..............................................................--------.--
FBpp0070667  ......AP..NV..............................................................AENHVVLA.SA
FBpp0082624  ......HG..DStiainlkacnrfrlfngrvaeqeikniadngtfgadllrhnlvvfrngegalrvlpgllniiPEARLNLA.IY
FBpp0081552  ......MK..-D..............................................................AQVYCDRA.DA
FBpp0086749  ......--..--..............................................................--------.--
FBpp0087646  ......--..AT..............................................................FKPIIGLA.QA
FBpp0071879  ......YL..SQghqip.........................................................IEWLNNLA.SS
FBpp0080894  ......NK..YR..............................................................PETCCVIG.NY
FBpp0305185  ......NK..YR..............................................................PETCCVIG.NY
FBpp0112213  ......DS..TD..............................................................FTGWTYLL.QY
FBpp0087233  ......SY..SKdli...........................................................YKLYERQA.RC
FBpp0070906  ......KS..ELlghfdyev......................................................GLSIGHLA.SL
FBpp0303990  ......KS..ELlghfdyev......................................................GLSIGHLA.SL
FBpp0087646  ......--..--..............................................................--------.--
FBpp0082112  ......DQ..QLarnlrqstlqtmssars.............................................CEILYNLG.VA
FBpp0086359  ......WP..NN..............................................................AVAQLHYG.LA
FBpp0293627  ......WP..NN..............................................................AVAQLHYG.LA
FBpp0076526  ......NQ..DApsea..........................................................FTTLCTIA.EI
FBpp0085279  ......QP..MN..............................................................FEARYNLG.LV
FBpp0074835  ......CN..TS..............................................................VELWLALA.--
FBpp0303989  ......YS..GL..............................................................EYDYLGLC.HV
FBpp0078887  ......AP..RH..............................................................PEVLLRYG.EF
FBpp0290580  ......E-..-Lgigaqmdipdggarsvgnpitmaisgi...................................TQALNLKA.AI
FBpp0085047  ......SP..HD..............................................................PEIY----.--
FBpp0296980  ......AK..SLgdtage........................................................CRAHGNLG.SA
FBpp0300832  ......AK..SLgdtage........................................................CRAHGNLG.SA
FBpp0086380  ......NL..KYfgdkdmhv......................................................ALSYHLMA.RT
FBpp0083435  ......ES..PS..............................................................EKSIYRRA.LA
FBpp0078891  ......KH..ND..............................................................YDTLINLM.VH
FBpp0082419  ......EP..DN..............................................................AT------.--
FBpp0082420  ......EP..DN..............................................................AT------.--
FBpp0306145  ......EP..DN..............................................................AT------.--
FBpp0303989  ......KS..ELlghfdyev......................................................GLSIGHLA.SL
FBpp0305372  ......NL..KYfgdkdmhv......................................................ALSYHLMA.RT
FBpp0086749  ......--..--..............................................................--------.--
FBpp0078027  ......LK..NLqryd..........................................................APINLEVC.DA
FBpp0088148  ......QA..TY..............................................................TRSIRVMG.DI
FBpp0088149  ......QA..TY..............................................................TRSIRVMG.DI
FBpp0290863  ......NP..FN..............................................................ERALMRRS.QL
FBpp0080720  ......D-..-Dkdilely.......................................................GLTKNWFG.QL
FBpp0083319  ......HK..SHe.............................................................FVSKFAII.QL
FBpp0071288  ......--..--..............................................................--------.--
FBpp0081398  ......--..--..............................................................--------.--
FBpp0301016  ......--..--..............................................................--------.--
FBpp0085015  ......QP..TH..............................................................S-------.--
FBpp0084188  ......DP..RQ..............................................................SEVV----.--
FBpp0293235  ......DP..RQ..............................................................SEVV----.--
FBpp0290580  ......HS..DDimsvs.........................................................AAVLANLC.VS
FBpp0085012  ......LP..HH..............................................................ERAN----.--
FBpp0086380  ......HP..ST..............................................................ILEYTHLS.LY
FBpp0304708  ......NP..RN..............................................................AQ------.--
FBpp0305372  ......HP..ST..............................................................ILEYTHLS.LY
FBpp0304707  ......NP..RN..............................................................AQ------.--
FBpp0071879  ......LP..KNr.............................................................VDVMHCLA.KA
FBpp0076961  ......RQ..AWd.............................................................ANVSMELG.DA
FBpp0075717  ......LK..SS..............................................................VDYYLKMA.KA
FBpp0080267  ......EE..YL..............................................................PLIKLRQA.AC
FBpp0070907  ......NP..DN..............................................................VEAIGLMA.V-
FBpp0085033  ......QP..HD..............................................................ARVL----.--
FBpp0082507  ......SQ..NNvywh..........................................................CKLLLQLA.QI
FBpp0077738  ......HL..--..............................................................KHTYYQKA.QE
FBpp0292775  ......HL..--..............................................................KHTYYQKA.QE
FBpp0085676  ......AR..SKdgeek.........................................................AIINLDIC.DV
FBpp0087091  ......--..--..............................................................--------.--
FBpp0082624  ......DI..KNq.............................................................HTYCMILA.KC
FBpp0070908  ......NP..DN..............................................................VEAIGLMA.VL
FBpp0070431  ......--..--..............................................................--------.--
FBpp0075443  ......LS..EQteclasv.......................................................SRARRWLV.HA
FBpp0305287  ......LS..EQteclasv.......................................................SRARRWLV.HA
FBpp0305288  ......LS..EQteclasv.......................................................SRARRWLV.HA
FBpp0070906  ......RR..GIfgnmnfhv......................................................AIAHEDLS.YA
FBpp0303990  ......RR..GIfgnmnfhv......................................................AIAHEDLS.YA
FBpp0073018  ......AQ..EHg.............................................................D-------.--
FBpp0078634  ......DPi.DF..............................................................ALNTATLS.QF
FBpp0087626  ......YP..ERlr............................................................HKVIMRQA.FC
FBpp0075754  ......HK..KSayshipacq.....................................................ISTSYYVG.FA
FBpp0087625  ......YP..ERlr............................................................HKVIMRQA.FC
FBpp0071288  ......HG..DS..............................................................PDLWVDAA.LW
FBpp0085046  ......SP..HD..............................................................LEI-----.--
FBpp0110159  ......SP..HD..............................................................LEI-----.--
FBpp0072679  ......E-..--..............................................................-----GYM.EA
FBpp0306202  ......E-..--..............................................................-----GYM.EA
FBpp0082624  ......SS..TPd.............................................................GKLDLNLA.VC
FBpp0084254  ......GP..SSperali........................................................MRLHLLQG.VL
FBpp0085032  ......NP..HD..............................................................IKLLL---.--


                                                           120         130                        14
                                                             |           |                          
d2fbna1        .N.MYF...........G...F.....................LEEAKENLYKAA..SL...........NPNNLD......IRN
FBpp0112456  .A.RRA...........E...G.....................IKSARSIFKKA-..--...........------......---
FBpp0297503  .A.RRA...........E...G.....................IKSARSIFKKA-..--...........------......---
FBpp0112455  eY.YCS...........K...D.....................KEIAFRIFELGL..KR...........FGGS--......---
FBpp0297502  eY.YCS...........K...D.....................KEIAFRIFELGL..KR...........FGGS--......---
FBpp0070352  .L.ANG...........S...R.....................SVEAVEAYQQAL..QL...........QPGFIR......VRY
FBpp0070351  .L.ANG...........S...R.....................SVEAVEAYQQAL..QL...........QPGFIR......VRY
FBpp0070402  .E.EML...........E...N.....................VAGARQVFERWM..EW...........QPEEQAwq....TYV
FBpp0080138  .H.YGQ...........N...H.....................DL----------..--...........------......---
FBpp0080139  .H.YGQ...........N...H.....................DL----------..--...........------......---
FBpp0301685  .-.---...........-...-.....................------------..--...........------......---
FBpp0074609  .A.AQL...........E...D.....................YEKAISIYEQVA..A-...........------......---
FBpp0084171  .S.IYH...........H...K.....................RFDAVYYYVRSL..LT...........SNSIQS......AKE
FBpp0085420  .L.KEL...........Q...D.....................VSGALQ------..--...........------......---
FBpp0085421  .L.KEL...........Q...D.....................VSGALQ------..--...........------......---
FBpp0085422  .L.KEL...........Q...D.....................VSGALQ------..--...........------......---
FBpp0085420  .L.KEA...........R...I.....................FDRAVAAYLRAL..NL...........SPNNAV......VHG
FBpp0085421  .L.KEA...........R...I.....................FDRAVAAYLRAL..NL...........SPNNAV......VHG
FBpp0085422  .L.KEA...........R...I.....................FDRAVAAYLRAL..NL...........SPNNAV......VHG
FBpp0077790  .Y.RKL...........E...N.....................YKQAKVYYEKAM..SE...........HRT-PE......IKT
FBpp0082545  .Q.SAQ...........G...K.....................YDKALASYEKAL..KY...........RANFAV......CYY
FBpp0084693  .N.KIC...........H...D.....................LDAGLAALQQAL..ER...........DPANTR......VAL
FBpp0084691  .N.KIC...........H...D.....................LDAGLAALQQAL..ER...........DPANTR......VAL
FBpp0084692  .N.KIC...........H...D.....................LDAGLAALQQAL..ER...........DPANTR......VAL
FBpp0084694  .N.KIC...........H...D.....................LDAGLAALQQAL..ER...........DPANTR......VAL
FBpp0112211  .N.KIC...........H...D.....................LDAGLAALQQAL..ER...........DPANTR......VAL
FBpp0072096  .L.VKL...........R...R.....................YDEATNALKKEI..SL...........NQQTE-......---
FBpp0071560  .-.---...........-...-.....................------------..--...........YPEHEQ......ALL
FBpp0071561  .-.---...........-...-.....................------------..--...........YPEHEQ......ALL
FBpp0077790  .L.QGM...........Q...Q.....................QSKAQAAYQKAL..EL...........DPNNAE......AIE
FBpp0076600  .Q.FYM...........K...K.....................KDLSLQTLNTAA..TL...........DPKNPL......TRF
FBpp0305561  .Q.FYM...........K...K.....................KDLSLQTLNTAA..TL...........DPKNPL......TRF
FBpp0271716  .N.ARI...........K...E.....................YTSGLKYCRAFL..DI...........ESND--......---
FBpp0077790  .A.AGL...........N...D.....................FMKAFEAYNEGL..KY...........DPTNAI......LLQ
FBpp0271718  .N.ARI...........K...E.....................YTSGLKYCRAFL..DI...........ESND--......---
FBpp0290895  .L.QMR...........G...L.....................RKEAVACYHKAL..EL...........QPGHAI......SRA
FBpp0290896  .L.QMR...........G...L.....................RKEAVACYHKAL..EL...........QPGHAI......SRA
FBpp0081673  .V.VLI...........G...DsthqasefaskvsrilvrlkkYEEATKALKKEI..SL...........------......---
FBpp0293601  .F.IAL...........G...K.....................RQQAIEILQAGS..NLdgaavrdrtahDQARSS......AYL
FBpp0077614  .F.IAL...........G...K.....................RQQAIEILQAGS..NLdgaavrdrtahDQARSS......AYL
FBpp0084692  .E.KRK...........G...I.....................KANCYKVFERGL..EA...........IPLSVD......LWI
FBpp0084694  .E.KRK...........G...I.....................KANCYKVFERGL..EA...........IPLSVD......LWI
FBpp0112211  .E.KRK...........G...I.....................KANCYKVFERGL..EA...........IPLSVD......LWI
FBpp0084691  .E.KRK...........G...I.....................KANCYKVFERGL..EA...........IPLSVD......LWI
FBpp0084693  .E.KRK...........G...I.....................KANCYKVFERGL..EA...........IPLSVD......LWI
FBpp0296980  .L.QCL...........G...R.....................YGEALAAFASGL..AQ...........EPSNKQ......LMA
FBpp0300832  .L.QCL...........G...R.....................YGEALAAFASGL..AQ...........EPSNKQ......LMA
FBpp0080535  .Y.SNM...........G...N.....................FEKAEQAYAKAI..EL...........EPDNEV......YKS
FBpp0296963  .Y.SNM...........G...N.....................FEKAEQAYAKAI..EL...........EPDNEV......YKS
FBpp0296980  .H.FSL...........G...N.....................YRAAVRYYDQDL..ALakdaqh.....RPNMGR......AYC
FBpp0300832  .H.FSL...........G...N.....................YRAAVRYYDQDL..ALakdaqh.....RPNMGR......AYC
FBpp0072164  .N.ESL...........G...N.....................NMEALKDCTTVL..AI...........EPKNIE......AKR
FBpp0084016  .L.IKA...........G...L.....................IDSARNVLERAVvqKL...........KPNKMQ......VIY
FBpp0296980  .H.HQR...........R...Q.....................FTQAAACHEQVL..RI...........AQALGDrsmeaaAYA
FBpp0300832  .H.HQR...........R...Q.....................FTQAAACHEQVL..RI...........AQALGDrsmeaaAYA
FBpp0296980  .H.AAL...........G...N.....................HAQALNCLEHQR..EL...........AQGLQDralesdAMC
FBpp0300832  .H.AAL...........G...N.....................HAQALNCLEHQR..EL...........AQGLQDralesdAMC
FBpp0080894  .Y.EII...........K...M.....................HYYSLYYFKIAH..QL...........RPYDSR......MLV
FBpp0305185  .Y.EII...........K...M.....................HYYSLYYFKIAH..QL...........RPYDSR......MLV
FBpp0081606  .H.MSL...........G...K.....................FKQALCDFEFVA..KC...........RPNDKD......AKL
FBpp0081607  .H.MSL...........G...K.....................FKQALCDFEFVA..KC...........RPNDKD......AKL
FBpp0304082  .H.MSL...........G...K.....................FKQALCDFEFVA..KC...........RPNDKD......AKL
FBpp0084559  .Y.TLL...........H...E.....................FNTAIEYHNRHL..AI...........AQELGDrigearACW
FBpp0075683  .Y.LKQ...........G...R.....................YTEAEILYKQVL..TR...........------......---
FBpp0303945  .Y.LKQ...........G...R.....................YTEAEILYKQVL..TR...........------......---
FBpp0303946  .Y.LKQ...........G...R.....................YTEAEILYKQVL..TR...........------......---
FBpp0081284  .Y.EAL...........E...K.....................FEEAYKDATALF..KA...........DPGNKT......VQP
FBpp0079468  .N.LTI...........N...E.....................LEDALEDFQKVI..QL...........EPGNKA......AAN
FBpp0087297  .Y.IAS...........E...Q.....................YASAFHTLAAAI..NL...........RKDNAE......CYM
FBpp0074835  .E.LRA...........G...L.....................KEIASTMMARAL..QE...........CPNAGE......LWA
FBpp0079893  .L.QWR...........G...D.....................INLAVQLLNKAI..EV...........DPKCEL......AYE
FBpp0079894  .L.QWR...........G...D.....................INLAVQLLNKAI..EV...........DPKCEL......AYE
FBpp0079895  .L.QWR...........G...D.....................INLAVQLLNKAI..EV...........DPKCEL......AYE
FBpp0082765  .Y.EQE...........D...K.....................PDEALEDYKKVT..EI...........DPGQQE......ARE
FBpp0079617  .L.MEI...........D...N.....................FDEAIKHLQRAY..DL...........SK----......---
FBpp0084440  .H.NAE...........G...K.....................HLESLNVYKKLL..DF...........EPDNAI......AKK
FBpp0305670  .C.LAL...........G...D.....................I-----------..--...........------......---
FBpp0080423  .C.LAL...........G...D.....................I-----------..--...........------......---
FBpp0305671  .C.LAL...........G...D.....................I-----------..--...........------......---
FBpp0080424  .C.LAL...........G...D.....................I-----------..--...........------......---
FBpp0305672  .C.LAL...........G...D.....................I-----------..--...........------......---
FBpp0085344  .H.LVL...........G...E.....................PRLAEKMLKDAA..KL...........DPSCPK......IWF
FBpp0081552  .H.MKS...........G...E.....................YEQAIQDFDQVL..QE...........EPNNGL......VLE
FBpp0297109  .H.LVL...........G...E.....................PRLAEKMLKDAA..KL...........DPSCPK......IWF
FBpp0087646  .Y.AGR...........G...S.....................YNSAIRVFQKIL..EL...........SPENNY......ALL
FBpp0083769  .H.ALL...........G...N.....................LDPAIEAFHKSL..AL...........NRD---......---
FBpp0070572  .R.RLL...........G...D.....................FELAAHDLRQAC..KL...........D-----......---
FBpp0070573  .R.RLL...........G...D.....................FELAAHDLRQAC..KL...........D-----......---
FBpp0070575  .R.RLL...........G...D.....................FELAAHDLRQAC..KL...........D-----......---
FBpp0305905  .R.RLL...........G...D.....................FELAAHDLRQAC..KL...........D-----......---
FBpp0074835  .E.WAL...........E...K.....................FDEALRLLEEAV..EV...........FPDFPK......LW-
FBpp0305670  .Y.NDL...........E...K.....................FEESVADYETAL..QL...........E-KTPE......IKR
FBpp0080424  .Y.NDL...........E...K.....................FEESVADYETAL..QL...........E-KTPE......IKR
FBpp0305672  .Y.NDL...........E...K.....................FEESVADYETAL..QL...........E-KTPE......IKR
FBpp0080423  .Y.NDL...........E...K.....................FEESVADYETAL..QL...........E-KTPE......IKR
FBpp0305671  .Y.NDL...........E...K.....................FEESVADYETAL..QL...........E-KTPE......IKR
FBpp0076113  .Q.RGL...........R...N.....................YEEAINDLKTAH..NL...........LPENKQ......ILN
FBpp0076114  .Q.RGL...........R...N.....................YEEAINDLKTAH..NL...........LPENKQ......ILN
FBpp0076115  .Q.RGL...........R...N.....................YEEAINDLKTAH..NL...........LPENKQ......ILN
FBpp0305988  .Q.RGL...........R...N.....................YEEAINDLKTAH..NL...........LPENKQ......ILN
FBpp0072561  .Y.LRA...........N...K.....................LVDAKAVLLKAR..RV...........APQDTV......LLF
FBpp0072562  .Y.LRA...........N...K.....................LVDAKAVLLKAR..RV...........APQDTV......LLF
FBpp0072561  .Y.IYR...........G...D.....................TENAAQCFEKVL..KI...........QPGNYE......TMK
FBpp0072562  .Y.IYR...........G...D.....................TENAAQCFEKVL..KI...........QPGNYE......TMK
FBpp0085923  .L.LEL...........H...R.....................PQDADQCLQALI..QR...........FPDFAN......---
FBpp0293601  .L.HLL...........G...R.....................TNHAAASYKAAL..RL...........QPGDAI......TLG
FBpp0079893  .H.EAT...........K...D.....................MNECLDD-----..--...........------......---
FBpp0079894  .H.EAT...........K...D.....................MNECLDD-----..--...........------......---
FBpp0079895  .H.EAT...........K...D.....................MNECLDD-----..--...........------......---
FBpp0075683  .Y.GKR...........G...K.....................YKDAEPLCKRAL..EI...........------......---
FBpp0303945  .Y.GKR...........G...K.....................YKDAEPLCKRAL..EI...........------......---
FBpp0303946  .Y.GKR...........G...K.....................YKDAEPLCKRAL..EI...........------......---
FBpp0077614  .L.HLL...........G...R.....................TNHAAASYKAAL..RL...........QPGDAI......TLG
FBpp0085409  .-.---...........-...-.....................------------..--...........------......---
FBpp0271717  .-.---...........-...-.....................------------..--...........------......---
FBpp0271719  .-.---...........-...-.....................------------..--...........------......---
FBpp0086749  .E.EEH...........G...L.....................ARHAMSVYDRA-..--...........------......---
FBpp0073411  .H.AGA...........W...N.....................PAQARRDFLDAL..AL...........D-----......---
FBpp0070907  .L.IAL...........E...R.....................HTQAVCAFRTAQ..MV...........APYRFE......IYR
FBpp0303439  .H.AGA...........W...N.....................PAQARRDFLDAL..AL...........D-----......---
FBpp0070908  .L.IAL...........E...R.....................HTQAVCAFRTAQ..MV...........APYRFE......IYR
FBpp0085842  .L.EGK...........A...D.....................TQGAIKLLQKVA..TL...........EPENRA......VQS
FBpp0300561  .L.YYL...........G...Q.....................FEQSLMFFHRGL..RA...........RPELAL......FRL
FBpp0077718  .A.VTS...........G...D.....................FNLAKRCLQLCL..TS...........DAQNGA......ALN
FBpp0296980  .H.MAL...........C...S.....................WTNAVKCYQEQL..ER...........AQEQRDaaveaqAHG
FBpp0300832  .H.MAL...........C...S.....................WTNAVKCYQEQL..ER...........AQEQRDaaveaqAHG
FBpp0076600  .C.MRT...........E...R.....................NKLAVSALRRAL..KL...........NPFMWH......AFA
FBpp0305561  .C.MRT...........E...R.....................NKLAVSALRRAL..KL...........NPFMWH......AFA
FBpp0071712  .L.YYL...........G...Q.....................FEQSLMFFHRGL..RA...........RPELAL......FRL
FBpp0086749  .E.LRQ...........Q...Q.....................FEAALKLMQRAT..AM...........PK----......---
FBpp0085479  .A.YEL...........E...R.....................FDLCTQMCEELL..EV...........DVDNEV......A--
FBpp0112016  .L.YYL...........G...Q.....................FEQSLMFFHRGL..RA...........RPELAL......FRL
FBpp0292906  .Y.ESC...........G...Q.....................LRDAYACYL---..--...........------......---
FBpp0305602  .Y.ESC...........G...Q.....................LRDAYACYLN--..--...........------......---
FBpp0079665  .Y.ESC...........G...Q.....................LRDAYACYLN--..--...........------......---
FBpp0079666  .Y.ESC...........G...Q.....................LRDAYACYLN--..--...........------......---
FBpp0079664  .Y.ESC...........G...Q.....................LRDAYACYLN--..--...........------......---
FBpp0084076  .Y.KGL...........K...Q.....................DDKFEESVVKAR..EH...........NPKQL-......---
FBpp0111406  .Y.KGL...........N...D.....................ESNFENCVKYAR..KF...........------......---
FBpp0074918  .L.IKL...........G...D.....................KQRAHRVLGEAL..KC...........NYSNWK......VWE
FBpp0082818  .R.YTM...........GgveN.....................MESARTYYSQAL..KL...........NPHNLR......ALY
FBpp0074480  .Q.IQM...........R...D.....................LEGYKETRHHLF..TL...........RPSQHA......SWI
FBpp0082819  .R.YTM...........GgveN.....................MESARTYYSQAL..KL...........NPHNLR......ALY
FBpp0292061  .Y.EEE...........N...R.....................IAEAVKAYSDCL..NL...........LPLHEE......ARQ
FBpp0085279  .Y.IKL...........Q...A.....................TERALFYYERAV..LA...........DPNDPN......LML
FBpp0081805  .Y.EEE...........N...R.....................IAEAVKAYSDCL..NL...........LPLHEE......ARQ
FBpp0100021  .N.KGL...........G...H.....................YFEAKKYANELL..SI...........NPNHTY......MLT
FBpp0100023  .N.KGL...........G...H.....................YFEAKKYANELL..SI...........NPNHTY......MLT
FBpp0074877  .N.KGL...........G...H.....................YFEAKKYANELL..SI...........NPNHTY......ML-
FBpp0071879  .A.LVS...........G...Q.....................YRLAIQTYERCL..K-...........------......---
FBpp0084559  .Y.HAK...........G...K.....................------------..--...........------......---
FBpp0075591  .Y.RKL...........D...N.....................LEAARADFEAAA..QL...........GSKF--......---
FBpp0076526  .Y.ICKk..........N...D.....................ATAALRFCNMAL..EV...........A-----......---
FBpp0079851  .L.YHL...........N...R.....................LEEAIPYLSRCT..EV...........DIFIPD......VWG
FBpp0290395  .Y.IKL...........Q...A.....................TERALFYYERAV..LA...........DPNDPN......LML
FBpp0072146  .L.AAL...........G...E.....................YNLARNAYLQAQ..AK...........QPANKE......ISD
FBpp0296980  .L.RSS...........G...D.....................AEGAHIQLETAA..QLlesvrheqr..SPETRQ......ALY
FBpp0300832  .L.RSS...........G...D.....................AEGAHIQLETAA..QLlesvrheqr..SPETRQ......ALY
FBpp0083238  .Y.REM...........E...Q.....................LDKIVELYQHAV..KQ...........NPGNEE......LLA
FBpp0111383  .Y.KRL...........N...D.....................EPNFEYSVDRAR..RF...........NRSDA-......---
FBpp0080424  .L.YYT...........D...N.....................LDKGILHFERAL..TL...........DPDHYK......SKQ
FBpp0305672  .L.YYT...........D...N.....................LDKGILHFERAL..TL...........DPDHYK......SKQ
FBpp0305670  .L.YYT...........D...N.....................LDKGILHFERAL..TL...........DPDHYK......SKQ
FBpp0071560  .F.NNL...........K...R.....................YAEAEQAYVQAK..AL...........FPQ---......---
FBpp0071561  .F.NNL...........K...R.....................YAEAEQAYVQAK..AL...........FPQ---......---
FBpp0080423  .L.YYT...........D...N.....................LDKGILHFERAL..TL...........DPDHYK......SKQ
FBpp0305671  .L.YYT...........D...N.....................LDKGILHFERAL..TL...........DPDHYK......SKQ
FBpp0071879  .K.FEH...........N...Deqs..................YQDGKMLLTAAY..KE...........NNKNPD......LLS
FBpp0077738  .L.QQQ...........G...D.....................YHSATKKFTQ--..--...........------......---
FBpp0077934  .Y.ELE...........S...N.....................NSKAKKY-----..--...........------......---
FBpp0292775  .L.QQQ...........G...D.....................YHSATKKFTQ--..--...........------......---
FBpp0087646  .A.ELI...........G...D.....................REEAFDLFRHCQ..QF...........D-----......---
FBpp0292906  .L.KHC...........G...E.....................FHIALKHLQLAL..LYt..........YPSTFSelq...VKF
FBpp0079664  .L.KHC...........G...E.....................FHIALKHLQLAL..LYt..........YPSTFSelq...VKF
FBpp0086749  .V.RRF...........E...M.....................PETALRVYRRYL..KL...........FPEDTE......EYV
FBpp0082652  .L.ARL...........N...N.....................ESE---------..--...........------......---
FBpp0077619  .Y.YKL...........D...L.....................LDLALESFANAT..HM...........DTHVPN......VWG
FBpp0086164  .L.KQQ...........G...R.....................HEEAVQALEQPG..EA...........EGQPLI......ARL
FBpp0297722  .L.KQQ...........G...R.....................HEEAVQALEQPG..EA...........EGQPLI......ARL
FBpp0087232  .Y.MAL...........K...D.....................YPHTIDSFKKCI..TA...........MDDSTL......ASD
FBpp0072561  .L.E-Q...........N...D.....................LQASLSAYGTAS..SI...........LRDKAKyeipaeIQN
FBpp0072562  .L.E-Q...........N...D.....................LQASLSAYGTAS..SI...........LRDKAKyeipaeIQN
FBpp0088148  .Y.LEM...........G...G.....................FSRALEGLQGAY..KIataig......DPSLELq.....VYV
FBpp0088149  .Y.LEM...........G...G.....................FSRALEGLQGAY..KIataig......DPSLELq.....VYV
FBpp0075786  .R.MEL...........G...A.....................LNEALVDANEAM..Q-...........------......---
FBpp0075788  .R.MEL...........G...A.....................LNEALVDANEAM..Q-...........------......---
FBpp0306229  .R.MEL...........G...A.....................LNEALVDANEAM..Q-...........------......---
FBpp0075787  .R.MEL...........G...A.....................LNEALVDANEAM..Q-...........------......---
FBpp0075789  .R.MEL...........G...A.....................LNEALVDANEAM..Q-...........------......---
FBpp0301715  .R.MEL...........G...A.....................LNEALVDANEAM..Q-...........------......---
FBpp0301716  .R.MEL...........G...A.....................LNEALVDANEAM..Q-...........------......---
FBpp0306230  .R.MEL...........G...A.....................LNEALVDANEAM..Q-...........------......---
FBpp0075785  .R.MEL...........G...A.....................LNEALVDANEAM..Q-...........------......---
FBpp0083319  .E.YQL...........N...K.....................QQQALKTIDDA-..--...........------......---
FBpp0076498  .L.SGL...........G...R.....................LEEALYNGFLAI..CL...........DK----......---
FBpp0293529  .L.SGL...........G...R.....................LEEALYNGFLAI..CL...........DK----......---
FBpp0290580  .L.FQA...........D...Q.....................HEAAVQRFQAAL..QV...........GGFNPL......VAY
FBpp0290395  .Y.FAL...........G...D.....................VEKVKLAFRRLC..DV...........------......---
FBpp0080720  .Y.LRE...........G...L.....................MSQAENACRLAW..KL...........GKQHQ-......---
FBpp0086164  .L.VQQ...........G...N.....................LARARLIYTKAI..KM...........LPKVYQ......LRL
FBpp0297722  .L.VQQ...........G...N.....................LARARLIYTKAI..KM...........LPKVYQ......LRL
FBpp0080741  .F.AKDt..........Q...M.....................TSIAKKCYEHAK..RI...........YVDFND......LHS
FBpp0087297  .L.YRAattqsqkdvasQ...Q.....................QDEARTYFELAV..--...........------......---
FBpp0070720  .-.---...........-...-.....................------------..--...........------......---
FBpp0089396  .-.---...........-...-.....................------------..--...........------......---
FBpp0111789  .-.---...........-...-.....................------------..--...........------......---
FBpp0086683  .L.SDL...........G...K.....................YHPSRLCYIKAL..KK...........RPRDQG......IKD
FBpp0289328  .-.---...........-...-.....................------------..--...........------......---
FBpp0070667  .L.AMK...........H...D.....................FNRSLQHFDEAE..RL...........DPS---......---
FBpp0082624  .Y.LKQ...........G...D.....................VQEAHALMK---..EL...........QPTSPH......EYI
FBpp0081552  .L.LGT...........E...M.....................YDDAIHSFQAAL..DL...........EESNTR......AKE
FBpp0086749  .-.---...........-...-.....................------------..--...........------......---
FBpp0087646  .Y.YLA...........G...Q.....................LQESYSIYNSVL..GN...........------......---
FBpp0071879  .Q.LMA...........K...M.....................PEKALNTLDDAL..S-...........------......---
FBpp0080894  .Y.SIR...........C...D.....................HQVAISYFQRAL..KL...........NPKYLA......AWT
FBpp0305185  .Y.SIR...........C...D.....................HQVAISYFQRAL..KL...........NPKYLA......AWT
FBpp0112213  .V.DNE...........S...D.....................AEAAREAYDTFL..SH...........YPYCYG......YWR
FBpp0087233  .Y.MAL...........K...D.....................YPHTIDSFKKCI..TA...........MDDSTL......ASD
FBpp0070906  .YnYQM...........K...K.....................YRDAEQLYMRSI..DIslrlfg.....N-----......---
FBpp0303990  .YnYQM...........K...K.....................YRDAEQLYMRSI..DIslrlfg.....N-----......---
FBpp0087646  .-.---...........-...-.....................------------..--...........------......---
FBpp0082112  .M.LHL...........R...R.....................PKEAFQCFLVPV..KQ...........FHSNPR......LWL
FBpp0086359  .L.RQF...........Ha..D.....................YAKALPYLKYAV..ES...........GEEGTQeaf...FYL
FBpp0293627  .L.RQF...........Ha..D.....................YAKALPYLKYAV..ES...........GEEGTQeaf...FYL
FBpp0076526  .C.EQ-...........-...-.....................------------..--...........------......---
FBpp0085279  .A.LAQ...........N...D.....................YELAEE------..--...........------......---
FBpp0074835  .-.-RL...........E...T.....................YENARKVLNKAR..EN...........IPTDRQ......IWT
FBpp0303989  .Y.ETL...........H...N.....................F-----------..--...........------......---
FBpp0078887  .L.EHN...........Qr..N.....................IVLADQYYFQAL..TI...........SPSNSE......ALA
FBpp0290580  .E.FQD...........G...N.....................EEAARDAL----..--...........------......---
FBpp0085047  .-.---...........-...-.....................------------..--...........------......---
FBpp0296980  .Y.FSQ...........G...A.....................HKEALTA-----..--...........------......---
FBpp0300832  .Y.FSQ...........G...A.....................HKEALTA-----..--...........------......---
FBpp0086380  .Q.SCM...........G...D.....................FRSALN------..--...........------......---
FBpp0083435  .Y.YHL...........K...E.....................FAKAQATIER--..--...........------......---
FBpp0078891  .A.HLT...........G...K.....................PTEAI-------..--...........------......---
FBpp0082419  .-.---...........-...-.....................------------..--...........------......AK-
FBpp0082420  .-.---...........-...-.....................------------..--...........------......AK-
FBpp0306145  .-.---...........-...-.....................------------..--...........------......AK-
FBpp0303989  .YnYQM...........K...K.....................YRDAEQLYMRSI..D-...........------......---
FBpp0305372  .Q.SCM...........G...D.....................FRSALN------..--...........------......---
FBpp0086749  .-.---...........-...-.....................------VYERAL..KE...........LPGSYK......IWH
FBpp0078027  .L.YEL...........N...Q.....................LENAKAELHDNT..RL...........------......---
FBpp0088148  .Y.RNK...........M...D.....................MDRAFRQYEQAM..GT...........------......---
FBpp0088149  .Y.RNK...........M...D.....................MDRAFRQYEQAM..GT...........------......---
FBpp0290863  .K.RSM...........G...L.....................ASEALKDCSRA-..--...........------......---
FBpp0080720  .L.MKQ...........G...K.....................YLEAKNLFKEA-..--...........------......---
FBpp0083319  .Q.LLQ...........G...N.....................RKDAIETL----..--...........------......---
FBpp0071288  .-.---...........-...-.....................------------..--...........------......---
FBpp0081398  .-.---...........-...L.....................NKE---------..--...........------......---
FBpp0301016  .-.---...........-...L.....................NKE---------..--...........------......---
FBpp0085015  .-.---...........-...-.....................------------..--...........------......---
FBpp0084188  .-.---...........-...-.....................------------..--...........------......---
FBpp0293235  .-.---...........-...-.....................------------..--...........------......---
FBpp0290580  .Y.IMT...........F...Q.....................NEEAEELMRK--..--...........------......---
FBpp0085012  .-.---...........-...-.....................------------..--...........------......---
FBpp0086380  .S.FAN...........G...H.....................VGMSLK------..--...........------......---
FBpp0304708  .-.---...........-...-.....................------------..--...........------......---
FBpp0305372  .S.FAN...........G...H.....................VGMSLK------..--...........------......---
FBpp0304707  .-.---...........-...-.....................------------..--...........------......---
FBpp0071879  .L.YDN...........G...D.....................ARKAKMWLLKVR..HL...........VPHDPF......VIF
FBpp0076961  .L.YDL...........N...R.....................FEE---------..--...........------......---
FBpp0075717  .Y.AVM...........G...E.....................PARAEISLKIAE..--...........------......---
FBpp0080267  .A.LKL...........R...N.....................FALCEEHLHELL..HI...........E-----......---
FBpp0070907  .-.---...........-...-.....................------------..--...........------......---
FBpp0085033  .-.---...........-...-.....................------------..--...........------......---
FBpp0082507  .H.ASD...........R...E.....................YSLASELLAVGA..ES...........------......---
FBpp0077738  .L.RER...........G...D.....................IKGALEYFEK--..--...........------......---
FBpp0292775  .L.RER...........G...D.....................IKGALEYFEK--..--...........------......---
FBpp0085676  .L.YEL...........N...Q.....................FENSK-------..--...........------......---
FBpp0087091  .-.---...........-...-.....................------------..--...........------......---
FBpp0082624  .H.IHC...........G...H.....................PELAW-------..--...........------......---
FBpp0070908  .C.---...........-...-.....................------------..--...........------......---
FBpp0070431  .-.---...........-...-.....................------------..--...........------......---
FBpp0075443  .L.FKM...........H...K.....................YGDAEIFLSKWI..--...........------......---
FBpp0305287  .L.FKM...........H...K.....................YGDAEIFLSKWI..--...........------......---
FBpp0305288  .L.FKM...........H...K.....................YGDAEIFLSKWI..--...........------......---
FBpp0070906  .Y.YVHeyst.......G...D.....................FSCAQDHVDKAV..NI...........------......---
FBpp0303990  .Y.YVHeyst.......G...D.....................FSCAQDHVDKAV..NI...........------......---
FBpp0073018  .-.---...........-...-.....................------------..--...........------......---
FBpp0078634  .Y.IGE...........K...R.....................FEEARHHLAAA-..--...........------......---
FBpp0087626  .A.WKL...........K...K.....................------------..--...........------......---
FBpp0075754  .Y.MMM...........R...R.....................YADAIRTFSDIL..LY...........IQRT--......---
FBpp0087625  .A.WKL...........K...K.....................------------..--...........------......---
FBpp0071288  .L.YEF...........Nrl.N.....................IDRVKDILLRGL..QR...........HPDSEA......---
FBpp0085046  .-.---...........-...-.....................------------..--...........------......---
FBpp0110159  .-.---...........-...-.....................------------..--...........------......---
FBpp0072679  .L.YHL...........E...Q.....................FDDLEKCVERLP..EK...........SPLLPK......LAE
FBpp0306202  .L.YHL...........E...Q.....................FDDLEKCVERLP..EK...........SPLLPK......LAE
FBpp0082624  .M.FYL...........G...L.....................YEEAQQLMANAA..--...........------......---
FBpp0084254  .L.FHQ...........N...R.....................RDEAYEKLEVA-..--...........------......---
FBpp0085032  .-.---...........-...-.....................------------..--...........------......---


               0       150                                                                          
               |         |                                                                          
d2fbna1        SYELCVNKLKE...AR-k...................................................................
FBpp0112456  -----------...---redvrsryhifvaaalmeyycskdkeiafrifelglkrfggspeyvmcyidylshlnednntrvlfer
FBpp0297503  -----------...---redvrsryhifvaaalmeyycskdkeiafrifelglkrfggspeyvmcyidylshlnednntrvlfer
FBpp0112455  -----------...---peyvmcyidylshlnednntrvlfervlssgglsphksvevwnrflefesnigdlssivkverrrsav
FBpp0297502  -----------...---peyvmcyidylshlnednntrvlfervlssgglsphksvevwnrflefesnigdlssivkverrrsav
FBpp0070352  NVGVCCMNLK-...---aykeavehlltaltmqahtnaarelpnaamaatfrgqnqmsesiwstlkmvislmgrsdlqsyvsdrn
FBpp0070351  NVGVCCMNLK-...---aykeavehlltaltmqahtnaarelpnaamaatfrgqnqmsesiwstlkmvislmgrsdlqsyvsdrn
FBpp0070402  NFELRYKEID-...---rareiyerfvyvhpdvknwikfarfeeshgfihgsrrvferaveffgddyieerlfiafarfeegqke
FBpp0080138  -----------...---dstyhylyslvciipfelsennlnklfakhteylermdpekldfniedffarfylivdifffdkevpd
FBpp0080139  -----------...---dstyhylyslvciipfelsennlnklfakhteylermdpekldfniedffarfylivdifffdkevpd
FBpp0301685  -----------...---ilnidlwklyltyvketksglsthkekmaqaydfalekigmdlhsfsiwqdyiyflrgveavgnyaen
FBpp0074609  -----------...---sslessllkysakeyffraalchlsvdllnaqhaiekyaqqypafqdsrefklikvlcenleeqnieg
FBpp0084171  SL---------...---ldlfdeirrkyeetemkqspmhyaagsknqkskqmrkevwiypdgirrlhrtddkgnkakgnkatmae
FBpp0085420  -----------...---cytraiqinpafadahsnlasihkdsgnipeaiqsyrtalklkpdfpdaycnlahclqivcdwtdydi
FBpp0085421  -----------...---cytraiqinpafadahsnlasihkdsgnipeaiqsyrtalklkpdfpdaycnlahclqivcdwtdydi
FBpp0085422  -----------...---cytraiqinpafadahsnlasihkdsgnipeaiqsyrtalklkpdfpdaycnlahclqivcdwtdydi
FBpp0085420  NLACVYYEQG-...---lidlaidtyrraielqpn..................................................
FBpp0085421  NLACVYYEQG-...---lidlaidtyrraielqpn..................................................
FBpp0085422  NLACVYYEQG-...---lidlaidtyrraielqpn..................................................
FBpp0077790  SL---------...---seveakike...........................................................
FBpp0082545  NMGNLYLEQKRy..A--ealhhwqhavalnprqpkawaniltmldnkglqddalrisnqalqhlpndvsilfiranvlgklkhyt
FBpp0084693  QMIDLCL----...---qrpkvdeqevveimdkfmaradiepdqkvlfaqrkvefledfgstarglqdaqralqqaltkakeaqk
FBpp0084691  QMIDLCL----...---qrpkvdeqevveimdkfmaradiepdqkvlfaqrkvefledfgstarglqdaqralqqaltkakeaqk
FBpp0084692  QMIDLCL----...---qrpkvdeqevveimdkfmaradiepdqkvlfaqrkvefledfgstarglqdaqralqqaltkakeaqk
FBpp0084694  QMIDLCL----...---qrpkvdeqevveimdkfmaradiepdqkvlfaqrkvefledfgstarglqdaqralqqaltkakeaqk
FBpp0112211  QMIDLCL----...---qrpkvdeqevveimdkfmaradiepdqkvlfaqrkvefledfgstarglqdaqralqqaltkakeaqk
FBpp0072096  -----------...---sygqigrlvvalvmvqlargdsveaektfrewgnccepeevstlqtllqafddedpela.........
FBpp0071560  NSAILLQELGG...---eearrvsrsrlykvlenddqnekvyfnlgmlamdessfdeaeqffkraihlkadfrsalfnlalllad
FBpp0071561  NSAILLQELGG...---eearrvsrsrlykvlenddqnekvyfnlgmlamdessfdeaeqffkraihlkadfrsalfnlalllad
FBpp0077790  GYRQC------...---s...................................................................
FBpp0076600  HRGSIYFSLGKyqeA--lreleelkevvpkesvvfyligkihktlgnmdlalmhfswatdldpkg....................
FBpp0305561  HRGSIYFSLGKyqeA--lreleelkevvpkesvvfyligkihktlgnmdlalmhfswatdldpkg....................
FBpp0271716  -----------...---qvrsleeyikkeidkevakgmvvaggaalvlggilglgiamarnkq......................
FBpp0077790  G----------...---rmet................................................................
FBpp0271718  -----------...---qvrsleeyikkeidkevakgmvvaggaalvlggilglgiamar.........................
FBpp0290895  NLAR-------...---m...................................................................
FBpp0290896  NLAR-------...---m...................................................................
FBpp0081673  -----------...---nlqtksygqvgrlvvalilvqltledyvdakktfkkwgnrcdpqevntlqnllkafddedpelatkm.
FBpp0293601  QLGALYVEQGKlqrA--laiyrealsslpglpqqreilyqrigdvlgrlqqwdeaerhhraalelqpnqvaahlsygitla....
FBpp0077614  QLGALYVEQGKlqrA--laiyrealsslpglpqqreilyqrigdvlgrlqqwdeaerhhraalelqpnqvaahlsygitla....
FBpp0084692  H----------...---ylmhvksnhgddetfvrsqyeravkacglefrsdklwdayirweneskryhrvvqiydrllaiptqgy
FBpp0084694  H----------...---ylmhvksnhgddetfvrsqyeravkacglefrsdklwdayirweneskryhrvvqiydrllaiptqgy
FBpp0112211  H----------...---ylmhvksnhgddetfvrsqyeravkacglefrsdklwdayirweneskryhrvvqiydrllaiptqgy
FBpp0084691  H----------...---ylmhvksnhgddetfvrsqyeravkacglefrsdklwdayirweneskryhrvvqiydrllaiptqgy
FBpp0084693  H----------...---ylmhvksnhgddetfvrsqyeravkacglefrsdklwdayirweneskryhrvvqiydrllaiptqgy
FBpp0296980  GL---------...---vea.................................................................
FBpp0300832  GL---------...---vea.................................................................
FBpp0080535  NLEAARNA---...---rnqpp...............................................................
FBpp0296963  NLEAARNA---...---rnqpp...............................................................
FBpp0296980  NLGLAHLALGHt..A--aalecqqlfla.........................................................
FBpp0300832  NLGLAHLALGHt..A--aalecqqlfla.........................................................
FBpp0072164  SLARINDRLR-...---ki..................................................................
FBpp0084016  K----------...---kylqleenhgtdatvakvkqqaeqwvknyak.....................................
FBpp0296980  GLGHAARCAGD...---asaskrfherqlamalaardklgegracsnlgivyqmlgshdaalklhqahlgiarsl..........
FBpp0300832  GLGHAARCAGD...---asaskrfherqlamalaardklgegracsnlgivyqmlgshdaalklhqahlgiarsl..........
FBpp0296980  ALGQVQQRMGQhaqA--lelhrqdleictelsapalqaralsnlgsvheslgqqaealkcyerqlelst................
FBpp0300832  ALGQVQQRMGQhaqA--lelhrqdleictelsapalqaralsnlgsvheslgqqaealkcyerqlelst................
FBpp0080894  ALGETYEKLDKcenA--vkcywkaidvgdiegiamyklanlheklgdhetavhcyimy...........................
FBpp0305185  ALGETYEKLDKcenA--vkcywkaidvgdiegiamyklanlheklgdhetavhcyimy...........................
FBpp0081606  KF---------...---tecn................................................................
FBpp0081607  KF---------...---tecn................................................................
FBpp0304082  KF---------...---tecn................................................................
FBpp0084559  SLGNAHSAIG-...---gheralkyaeqhlqlakelhdpvgestar.......................................
FBpp0075683  -----------...---aherefgaidsknkpiwqvaeereehkfdnrentpygeyggwhkaakvdsptvtttlknlgalyrrqg
FBpp0303945  -----------...---aherefgaidsknkpiwqvaeereehkfdnrentpygeyggwhkaakvdsptvtttlknlgalyrrqg
FBpp0303946  -----------...---aherefgaidsknkpiwqvaeereehkfdnrentpygeyggwhkaakvdsptvtttlknlgalyrrqg
FBpp0081284  MLQRL------...---hv..................................................................
FBpp0079468  QVIICKQKLKE...---sknkekklyanmftk.....................................................
FBpp0087297  LLGLCLRKLDDmenA--fvalera.............................................................
FBpp0074835  E----------...---aifmetkpqrktksvdalkkcehdphvllavsklfwsehkfskcrdwfnrtvkidpdlgdawayfykf
FBpp0079893  TLGTVEVQR--...---aqltravelfekal......................................................
FBpp0079894  TLGTVEVQR--...---aqltravelfekal......................................................
FBpp0079895  TLGTVEVQR--...---aqltravelfekal......................................................
FBpp0082765  AQ---------...---irlppiinerneklk.....................................................
FBpp0079617  -----------...---eqk.................................................................
FBpp0084440  AVEKLTSMLGE...---va..................................................................
FBpp0305670  -----------...---igteqavkmvn.........................................................
FBpp0080423  -----------...---igteqavkmvn.........................................................
FBpp0305671  -----------...---igteqavkmvn.........................................................
FBpp0080424  -----------...---igteqavkmvn.........................................................
FBpp0305672  -----------...---igteqavkmvn.........................................................
FBpp0085344  ALGKVMEILGDfh.A--sadcfatslqlepscpvl..................................................
FBpp0081552  HYSRLA-----...---paqeqwvlvqqliqysdhqnaipmitqlleispwavpfrqarsdayiaindpllaiadlrqvnrltqd
FBpp0297109  ALGKVMEILGDfh.A--sadcfatslqlepscpvl..................................................
FBpp0087646  QIASVK-----...---ttirmytesiedydtllqrnptylp...........................................
FBpp0083769  -----------...---ci..................................................................
FBpp0070572  -----------...---fd..................................................................
FBpp0070573  -----------...---fd..................................................................
FBpp0070575  -----------...---fd..................................................................
FBpp0305905  -----------...---fd..................................................................
FBpp0074835  -----------...---m...................................................................
FBpp0305670  MLREAKFALK-...---ks..................................................................
FBpp0080424  MLREAKFALK-...---ks..................................................................
FBpp0305672  MLREAKFALK-...---ks..................................................................
FBpp0080423  MLREAKFALK-...---ks..................................................................
FBpp0305671  MLREAKFALK-...---ks..................................................................
FBpp0076113  ELNSTKQL---...---laqynrqq............................................................
FBpp0076114  ELNSTKQL---...---laqynrqq............................................................
FBpp0076115  ELNSTKQL---...---laqynrqq............................................................
FBpp0305988  ELNSTKQL---...---laqynrqq............................................................
FBpp0072561  NIAVVL-----...---sr..................................................................
FBpp0072562  NIAVVL-----...---sr..................................................................
FBpp0072561  ILGSLY-----...---....................................................................
FBpp0072562  ILGSLY-----...---....................................................................
FBpp0085923  -----------...---nhg.................................................................
FBpp0293601  NL---------...---ak..................................................................
FBpp0079893  -----------...---v...................................................................
FBpp0079894  -----------...---v...................................................................
FBpp0079895  -----------...---v...................................................................
FBpp0075683  -----------...---re..................................................................
FBpp0303945  -----------...---re..................................................................
FBpp0303946  -----------...---re..................................................................
FBpp0077614  NL---------...---ak..................................................................
FBpp0085409  -----------...---qvrsleeyikkeidkevakgmvvaggaalvlggilglgiamarnkq......................
FBpp0271717  -----------...---qvrsleeyikkeidkevakgmvvaggaalvlggilglgiamar.........................
FBpp0271719  -----------...---qvrsleeyikkeidkevakgmvvaggaalvlggilglgiamar.........................
FBpp0086749  -----------...---tsavkedemfdmynifikk.................................................
FBpp0073411  -----------...---as..................................................................
FBpp0070907  GLFHSYLAQKRfkeA--nalcnwtirlfqnsprsftmfgrtlflfpdprmrrtarkfaekslkinhiytpavnliadicqvegpt
FBpp0303439  -----------...---as..................................................................
FBpp0070908  GLFHSYLAQKRfkeA--nalcnwtirlfqnsprsftmfgrtlflfpdprmrrtarkfaekslkinhiytpavnliadicqvegpt
FBpp0085842  DLARLFIKA--...---rreehnekemyqkm......................................................
FBpp0300561  G----------...---vqktqea.............................................................
FBpp0077718  NLAVLAAQSGD...---ilgaksylnaakdvmpdaaevttnl...........................................
FBpp0296980  NLGIAR-----...---lnmahyeaaigcleaqlgtlervs............................................
FBpp0300832  NLGIAR-----...---lnmahyeaaigcleaqlgtlervs............................................
FBpp0076600  DLC--------...---llgqdtdaaaifqihstdvfntcqgssvnanamvlfgaeqqgqqhqerqslitnlsnvsnyilttpvd
FBpp0305561  DLC--------...---llgqdtdaaaifqihstdvfntcqgssvnanamvlfgaeqqgqqhqerqslitnlsnvsnyilttpvd
FBpp0071712  G----------...---vqktqea.............................................................
FBpp0086749  -----------...---rkiayyddtetvqarlhrslkvw.............................................
FBpp0085479  -----------...---ia..................................................................
FBpp0112016  G----------...---vqktqea.............................................................
FBpp0292906  -----------...---na..................................................................
FBpp0305602  -----------...---a...................................................................
FBpp0079665  -----------...---a...................................................................
FBpp0079666  -----------...---a...................................................................
FBpp0079664  -----------...---a...................................................................
FBpp0084076  -----------...---ayidky..............................................................
FBpp0111406  -----------...---nskq................................................................
FBpp0074918  NYMLV------...---svdtshwddamrayqrmaelkqhyldq.........................................
FBpp0082818  GIYLCCNHLD-...---n...................................................................
FBpp0074480  GFAMSYHLLGD...---ydmansiletfsqsqtsieahdyrhselllyqnqiliesnrlqqavdhltkyqgqivdklavretmgd
FBpp0082819  -----------...---....................................................................
FBpp0292061  SL---------...---dal.................................................................
FBpp0085279  RIASCF-----...---rn..................................................................
FBpp0081805  SL---------...---dal.................................................................
FBpp0100021  -----------...---qlpk................................................................
FBpp0100023  -----------...---qlpk................................................................
FBpp0074877  -----------...---tqlp................................................................
FBpp0071879  -----------...---....................................................................
FBpp0084559  -----------...---....................................................................
FBpp0075591  -----------...---ar..................................................................
FBpp0076526  -----------...---krfpnkvkk...........................................................
FBpp0079851  YLATINLRLSRnktAL-ecwkva..............................................................
FBpp0290395  RIASCF-----...---rn..................................................................
FBpp0072146  EIISMNKRI--...---skyeeasrdi..........................................................
FBpp0296980  DLQTTCYQ---...---llqvllvalnrnedal....................................................
FBpp0300832  DLQTTCYQ---...---llqvllvalnrnedal....................................................
FBpp0083238  HLFISHVRVEDyk.A--qqavalqlykaqpknayyf.................................................
FBpp0111383  -----------...---df..................................................................
FBpp0080424  MRSKCK-----...---ql..................................................................
FBpp0305672  MRSKCK-----...---ql..................................................................
FBpp0305670  MRSKCK-----...---ql..................................................................
FBpp0071560  -----------...---a...................................................................
FBpp0071561  -----------...---a...................................................................
FBpp0080423  MRSKCK-----...---ql..................................................................
FBpp0305671  MRSKCK-----...---ql..................................................................
FBpp0071879  ILAGMYYADGN...---hklvwsfagnaikftankhiesrnyfqiaksyhatgqfesakkyyllsaksap...............
FBpp0077738  -----------...---a...................................................................
FBpp0077934  -----------...---....................................................................
FBpp0292775  -----------...---a...................................................................
FBpp0087646  -----------...---yh..................................................................
FBpp0292906  QIAHLYEVQNKhk.A--akdg................................................................
FBpp0079664  QIAHLYEVQNKhk.A--akdg................................................................
FBpp0086749  DYL--------...---qeadrldeaaqqlahiv...................................................
FBpp0082652  -----------...---feiaianarllnr.......................................................
FBpp0077619  FLALINLRLGEnykAI-ecw.................................................................
FBpp0086164  LYE--------...---rcvmlqqigriee.......................................................
FBpp0297722  LYE--------...---rcvmlqqigriee.......................................................
FBpp0087232  KRAKL------...---nldamtmikmlqndprtakqeakqqkqkialdqakpvklenefvsplvridsnrqegrfarasadvkp
FBpp0072561  NVASLHYRLGN...---lkmakltlesalkhatsemd................................................
FBpp0072562  NVASLHYRLGN...---lkmakltlesalkhatsemd................................................
FBpp0088148  AL---------...---selfgrlqdndksatyaskaydlsrslql.......................................
FBpp0088149  AL---------...---selfgrlqdndksatyaskaydlsrslql.......................................
FBpp0075786  -----------...---q...................................................................
FBpp0075788  -----------...---q...................................................................
FBpp0306229  -----------...---q...................................................................
FBpp0075787  -----------...---q...................................................................
FBpp0075789  -----------...---q...................................................................
FBpp0301715  -----------...---q...................................................................
FBpp0301716  -----------...---q...................................................................
FBpp0306230  -----------...---q...................................................................
FBpp0075785  -----------...---q...................................................................
FBpp0083319  -----------...---glqplppnlkelrtqvlyrlerydecldsyrdiikntsdeyeeerrtnlsavaanlavdqtkevpevp
FBpp0076498  -----------...---kt..................................................................
FBpp0293529  -----------...---kt..................................................................
FBpp0290580  NVALAHFQKKQ...---r...................................................................
FBpp0290395  -----------...---qteaiesdmesetniiklqqqaepiqqigetdgyqslnnepvtgsvikaegggklnetvkfaatvkhr
FBpp0080720  -----------...---npdaveqaeycl........................................................
FBpp0086164  RKAQLLQKMGEtn.A--smftylkmlplmppdewkmclntaknvaryfhvlekhslaleamegaysvcgarftlediniylelli
FBpp0297722  RKAQLLQKMGEtn.A--smftylkmlplmppdewkmclntaknvaryfhvlekhslaleamegaysvcgarftlediniylelli
FBpp0080741  RKM--------...---anylqaklm...........................................................
FBpp0087297  -----------...---qs..................................................................
FBpp0070720  -----------...---rirntnasdeqqvaslraafnhaweeltvlygdqadtryevlqlwaqveytqlgspdngreiwrqimg
FBpp0089396  -----------...---rirntnasdeqqvaslraafnhaweeltvlygdqadtryevlqlwaqveytqlgspdngreiwrqimg
FBpp0111789  -----------...---rirntnasdeqqvaslraafnhaweeltvlygdqadtryevlqlwaqveytqlgspdngreiwrqimg
FBpp0086683  KITRISK----...---riteledtn...........................................................
FBpp0289328  -----------...---elenpeqlfiqilgdpsehlhrqyikslfkygsttsepsksieeafimvqasqeeldnimsdlnepqn
FBpp0070667  -----------...---tl..................................................................
FBpp0082624  LKGVVHAALGQ...---qlgskehiktaqq.......................................................
FBpp0081552  GIQRAKKLQKQ...---se..................................................................
FBpp0086749  -----------...---cdpritadfwqtwkefevrhgnedtmremlr.....................................
FBpp0087646  -----------...---vvdhgddkaatilvamasmiydfqgea.........................................
FBpp0071879  -----------...---kcrv................................................................
FBpp0080894  LMGH-------...---efmel...............................................................
FBpp0305185  LMGH-------...---efmel...............................................................
FBpp0112213  KYADYEKRKG-...---ikancy..............................................................
FBpp0087233  KRAKL------...---nldamtmikmlqndprtakqeakqqkqkialdqakpvklenefvsplvridsnrqegrfarasadvkp
FBpp0070906  -----------...---sysgleydylglchvyetlhnfek............................................
FBpp0303990  -----------...---sysgleydylglchvyetlhnfek............................................
FBpp0087646  -----------...---aeqllelnpnsnlallvkaldlfaegqvvasrqlalqaqksqpaykvtlellarihmelgayklalql
FBpp0082112  RMAEAC-----...---imeh................................................................
FBpp0086359  SLGE-------...---tmqrlsmksealevygkgvakg..............................................
FBpp0293627  SLGE-------...---tmqrlsmksealevygkgvakg..............................................
FBpp0076526  -----------...---qshpfwtvhdvyqkalrqadkag.............................................
FBpp0085279  -----------...---rf..................................................................
FBpp0074835  TAAKLEEANGN...---ihmvekiidrsltsltvng.................................................
FBpp0303989  -----------...---ek..................................................................
FBpp0078887  NRQ--------...---rtad................................................................
FBpp0290580  -----------...---ldlppraeseldpvtlhnmaltdvegpvaglrklafllelgapscpketfanilliccknelyetaad
FBpp0085047  -----------...---eeyrilekrdltlsdiepieqdk.............................................
FBpp0296980  -----------...---hry.................................................................
FBpp0300832  -----------...---hry.................................................................
FBpp0086380  -----------...---nekety..............................................................
FBpp0083435  -----------...---m...................................................................
FBpp0078891  -----------...---trn.................................................................
FBpp0082419  -----------...---efyplildkl..........................................................
FBpp0082420  -----------...---efyplildkl..........................................................
FBpp0306145  -----------...---efyplildkl..........................................................
FBpp0303989  -----------...---i...................................................................
FBpp0305372  -----------...---nekety..............................................................
FBpp0086749  NYL--------...---rtrrk...............................................................
FBpp0078027  -----------...---ftgnktkmfeqrlvvvdeniedacgpsmtqyisdkeklivhlkevqnkykpdtrplwkilkeqekcdv
FBpp0088148  -----------...---saslgdrmaqmeamdgaarcletlrlqnkicncrplefntrllevassigakflvrkircrlaliyra
FBpp0088149  -----------...---saslgdrmaqmeamdgaarcletlrlqnkicncrplefntrllevassigakflvrkircrlaliyra
FBpp0290863  -----------...---edl.................................................................
FBpp0080720  -----------...---....................................................................
FBpp0083319  -----------...---lslgeakykpgvvsalvslylgtdnktaasallksavdwykknevssgdlsdmwrqaaefhlrggase
FBpp0071288  -----------...---yglackaawpefgelrsdylrylwqersveearkeyaklailppmslalhrqmvqlessaaacdqasl
FBpp0081398  -----------...---gatalrq.............................................................
FBpp0301016  -----------...---gatalrq.............................................................
FBpp0085015  -----------...---aqqtqk..............................................................
FBpp0084188  -----------...---idacellvkenn........................................................
FBpp0293235  -----------...---idacellvkenn........................................................
FBpp0290580  -----------...---v...................................................................
FBpp0085012  -----------...---gnkrfyekeiaq........................................................
FBpp0086380  -----------...---llyra...............................................................
FBpp0304708  -----------...---l...................................................................
FBpp0305372  -----------...---llyra...............................................................
FBpp0304707  -----------...---l...................................................................
FBpp0071879  NLGLAIKKETE...---qalal...............................................................
FBpp0076961  -----------...---nksllhdnvrrhagtalksfenrlvvvdenlkdctgfslanffmehsaqlpgfyahqqeelrradrrp
FBpp0075717  -----------...---km..................................................................
FBpp0080267  -----------...---lnq.................................................................
FBpp0070907  ----L------...---cgqeg...............................................................
FBpp0085033  -----------...---rlwkkt..............................................................
FBpp0082507  -----------...---adeasatylkvlfllsramilmierktndvlallnsagqiidnn........................
FBpp0077738  -----------...---tqn.................................................................
FBpp0292775  -----------...---tqn.................................................................
FBpp0085676  -----------...---aemhn...............................................................
FBpp0087091  -----------...---an..................................................................
FBpp0082624  -----------...---nv..................................................................
FBpp0070908  -----------...---gqeg................................................................
FBpp0070431  -----------...---ltvthgrdhrllteqlymlvlqar............................................
FBpp0075443  -----------...---ne..................................................................
FBpp0305287  -----------...---ne..................................................................
FBpp0305288  -----------...---ne..................................................................
FBpp0070906  -----------...---mqhlvp..............................................................
FBpp0303990  -----------...---mqhlvp..............................................................
FBpp0073018  -----------...---krslnlantwycl.......................................................
FBpp0078634  -----------...---tlima...............................................................
FBpp0087626  -----------...---ia..................................................................
FBpp0075754  -----------...---kqlystrsyqndqinkqae.................................................
FBpp0087625  -----------...---ia..................................................................
FBpp0071288  -----------...---lnkcffdimlkeaalasnernlaentlseqdiklerveavyrnsmanitq..................
FBpp0085046  -----------...---fqeyqnl.............................................................
FBpp0110159  -----------...---fqeyqnl.............................................................
FBpp0072679  -----------...---mlasvgmcseavqahlrfgdqkaavatcvnlrqw..................................
FBpp0306202  -----------...---mlasvgmcseavqahlrfgdqkaavatcvnlrqw..................................
FBpp0082624  -----------...---dnplkqrllfhlahklgneee...............................................
FBpp0084254  -----------...---tk..................................................................
FBpp0085032  -----------...---kks.................................................................


                                                                                                    
                                                                                                    
d2fbna1        .....................................................................................
FBpp0112456  vlssgglsphksvevwnrflefesnigdlssivkverrrsavfenlkeyegketaqlvdrykfldlypctstelksigyae....
FBpp0297503  vlssgglsphksvevwnrflefesnigdlssivkverrrsavfenlkeyegketaqlvdrykfldlypctstelksigyae....
FBpp0112455  fenlkeyegketaqlvdrykfldlypctstelksigyae..............................................
FBpp0297502  fenlkeyegketaqlvdrykfldlypctstelksigyae..............................................
FBpp0070352  laalneafk............................................................................
FBpp0070351  laalneafk............................................................................
FBpp0070402  hdrariiykyaldhlpkdrtqelfkaytkhekkygdragiedvivskrkyqyeqevaanptnydawfdylrlieaegdrdqiret
FBpp0080138  fnalchcvlidlrkilcsqqlrvpepsifkivsilffclsklkminspkvyslhaflvaacsdlmdacivsieqtilaraqdner
FBpp0080139  fnalchcvlidlrkilcsqqlrvpepsifkivsilffclsklkminspkvyslhaflvaacsdlmdacivsieqtilaraqdner
FBpp0301685  qkitavrrvyqkavvtpivgieqlwkdyiafeqninpiisekmslerskdymnarrvakeleyhtkglnrnlpavpptltkeevk
FBpp0074609  fteavkdydsisrldqwyttillrikkaaded.....................................................
FBpp0084171  vnryeemppeeilprivslylyllgklytgtdvdslypllrklqiqigvalrhenllsrskllkivalnlfvvehnkpktsrrem
FBpp0085420  rmkklvsi.............................................................................
FBpp0085421  rmkklvsi.............................................................................
FBpp0085422  rmkklvsi.............................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  eaeaiykrvielephntlyhtnlgvlyhrwdktqeaieayrtaisisaarattarenlskllkrlereaqvm.............
FBpp0084693  ks...................................................................................
FBpp0084691  ks...................................................................................
FBpp0084692  ks...................................................................................
FBpp0084694  ks...................................................................................
FBpp0112211  ks...................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  tkrpldavpflnqlirhhpshvkglillgdiyinhmkdldeaekcyrsilhydphntqglhnlcvvfverkrlakaaaclqyaqr
FBpp0071561  tkrpldavpflnqlirhhpshvkglillgdiyinhmkdldeaekcyrsilhydphntqglhnlcvvfverkrlakaaaclqyaqr
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0305561  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0271718  .....................................................................................
FBpp0290895  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0293601  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084692  nghfdnfqdlinqhdvtitlaneevirlrkdfherqq................................................
FBpp0084694  nghfdnfqdlinqhdvtitlaneevirlrkdfherqq................................................
FBpp0112211  nghfdnfqdlinqhdvtitlaneevirlrkdfherqq................................................
FBpp0084691  nghfdnfqdlinqhdvtitlaneevirlrkdfherqq................................................
FBpp0084693  nghfdnfqdlinqhdvtitlaneevirlrkdfherqq................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0296963  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0305185  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0081607  .....................................................................................
FBpp0304082  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  mfeaa................................................................................
FBpp0303945  mfeaa................................................................................
FBpp0303946  mfeaa................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  ellhgteaqqqevldrcisaepthgeswcrv......................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0085344  .....................................................................................
FBpp0081552  steghykiaqllytighatnalkeireclkfdpeh..................................................
FBpp0297109  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070573  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0305905  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0076114  .....................................................................................
FBpp0076115  .....................................................................................
FBpp0305988  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0293601  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0303945  .....................................................................................
FBpp0303946  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0085409  .....................................................................................
FBpp0271717  .....................................................................................
FBpp0271719  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070907  kaiikllekhviifpkvnllnhlgdimrkqkepvkameyyykalrqdpks...................................
FBpp0303439  .....................................................................................
FBpp0070908  kaiikllekhviifpkvnllnhlgdimrkqkepvkameyyykalrqdpks...................................
FBpp0085842  .....................................................................................
FBpp0300561  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0076600  qqqqqinqnqnqhhnsnmvtpinnnnnnnnlnssismlrgglvqnssmlamledtpmgapqdpagqyqqnqqlydmssgtpfrkq
FBpp0305561  qqqqqinqnqnqhhnsnmvtpinnnnnnnnlnssismlrgglvqnssmlamledtpmgapqdpagqyqqnqqlydmssgtpfrkq
FBpp0071712  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0305602  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0079666  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  lyiklqqqekavpifeslirrnpenvlyyeqyiaarqvtdssavvsiyrvfqeqypralcprrlplniangdefrvvtdeylrrg
FBpp0082819  .....................................................................................
FBpp0292061  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0081805  .....................................................................................
FBpp0100021  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0074877  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0297722  .....................................................................................
FBpp0087232  geellverpfvsvllekfakthcencfmrtvvpvacprcadvlycseqcreeaskkyhkyecgivpiiwrsgasinnhialriia
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0075786  .....................................................................................
FBpp0075788  .....................................................................................
FBpp0306229  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0075789  .....................................................................................
FBpp0301715  .....................................................................................
FBpp0301716  .....................................................................................
FBpp0306230  .....................................................................................
FBpp0075785  .....................................................................................
FBpp0083319  edtyeqyfnsaciqanrqkyaeaerklrtsek.....................................................
FBpp0076498  .....................................................................................
FBpp0293529  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0290395  yvvqalkkdelavyrnerrnavkrsitmivdlispfiednyndgynwcieiiktsnlawlanelelnkalvylrqndvhqaietl
FBpp0080720  .....................................................................................
FBpp0086164  lnkqyakvlrclrertnfelendqeesleliyfceipddyvpelraklcvslihmrahhllgyliqnvqehitltadrvelymdi
FBpp0297722  lnkqyakvlrclrertnfelendqeesleliyfceipddyvpelraklcvslihmrahhllgyliqnvqehitltadrvelymdi
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  ypgssirgllwlnfaqmeseyngghgtrdvlrkalsqpvlenglmvqeffrryercygtyesiaacq..................
FBpp0089396  ypgssirgllwlnfaqmeseyngghgtrdvlrkalsqpvlenglmvqeffrryercygtyesiaacq..................
FBpp0111789  ypgssirgllwlnfaqmeseyngghgtrdvlrkalsqpvlenglmvqeffrryercygtyesiaacq..................
FBpp0086683  .....................................................................................
FBpp0289328  dvevekdlyqvkrspsncelgcrglyrqktnlvcrykstantflrlaplkleeisldpfmamyhevlydseirelkgqsmnmvng
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0305185  .....................................................................................
FBpp0112213  .....................................................................................
FBpp0087233  geellverpfvsvllekfakthcencfmrtvvpvacprcadvlycseqcreeaskkyhkyecgivpiiwrsgasinnhialriia
FBpp0070906  .....................................................................................
FBpp0303990  .....................................................................................
FBpp0087646  wqeigqendayalclshekgvsklreavtilqtlensegnikslarcyfklge................................
FBpp0082112  .....................................................................................
FBpp0086359  .....................................................................................
FBpp0293627  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0303989  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  ilaehtdltykylsqylyelldslitaqtsaelaekklgtlasslagklrslaakvqevratneqqalrdalkdyeqalel....
FBpp0085047  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0082420  .....................................................................................
FBpp0306145  .....................................................................................
FBpp0303989  .....................................................................................
FBpp0305372  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  lsipeieeemlspleiarrsrafdvfnqmfidrswhdviflkhvrknpnlllnqcknsteylqtlstkkydeiksflkilearsp
FBpp0088148  lgdedq...............................................................................
FBpp0088149  lgdedq...............................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  taassleellklnpndtkv..................................................................
FBpp0071288  kywrmcydfmacyfgktqprvwveylaferdhgeaknislltqralstlepqyvaaf............................
FBpp0081398  .....................................................................................
FBpp0301016  .....................................................................................
FBpp0085015  .....................................................................................
FBpp0084188  .....................................................................................
FBpp0293235  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0304708  .....................................................................................
FBpp0305372  .....................................................................................
FBpp0304707  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  lwkilkerkecdvqsridrkevmlsplererrrrktkifyqnylgrswtdffflktlrrhpnclldnhfgssadrtkyleyafqr
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075443  .....................................................................................
FBpp0305287  .....................................................................................
FBpp0305288  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0303990  .....................................................................................
FBpp0073018  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0087626  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0085046  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0306202  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................


                                                                                                    
                                                                                                    
d2fbna1        .....................................................................................
FBpp0112456  .....................................................................................
FBpp0297503  .....................................................................................
FBpp0112455  .....................................................................................
FBpp0297502  .....................................................................................
FBpp0070352  .....................................................................................
FBpp0070351  .....................................................................................
FBpp0070402  yeraisnvppaneknfwrryiylwinyalyeeleaedaertrqiyktcleliphkqftfsklwllyaqfeirckelqrarkalgl
FBpp0080138  fqaeyeerfqefdtvvrksrneyknwlaavgecerkdkklmprphslkdcssdsrdsqhsgeeaktqeaadgdkigeavstrssd
FBpp0080139  fqaeyeerfqefdtvvrksrneyknwlaavgecerkdkklmprphslkdcssdsrdsqhsgeeaktqeaadgdkigeavstrssd
FBpp0301685  qvelwkrfityeksnplrtedtalvtrrvmfateqcllvlthhpavwhqasqfldtsarvltekgvrts................
FBpp0074609  .....................................................................................
FBpp0084171  ryhsfnfansffglmmkktnqllagfvedstnvqclpeedfatvntylqfvnvyvrwlsisldvwepvrseehsfidcwaeltil
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  lapaedyigrhlqivlarlqki...............................................................
FBpp0071561  lapaedyigrhlqivlarlqki...............................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0305561  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0271718  .....................................................................................
FBpp0290895  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0293601  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0296963  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0305185  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0081607  .....................................................................................
FBpp0304082  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0303945  .....................................................................................
FBpp0303946  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0085344  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0297109  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070573  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0305905  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0076114  .....................................................................................
FBpp0076115  .....................................................................................
FBpp0305988  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0293601  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0303945  .....................................................................................
FBpp0303946  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0085409  .....................................................................................
FBpp0271717  .....................................................................................
FBpp0271719  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0303439  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0300561  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0076600  fkylsaispptpsfgimpltspctgndgsfignhtpvmnisyspmpqmlvevnqepkmmgkklkthvgglinrkegslnkpavft
FBpp0305561  fkylsaispptpsfgimpltspctgndgsfignhtpvmnisyspmpqmlvevnqepkmmgkklkthvgglinrkegslnkpavft
FBpp0071712  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0305602  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0079666  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  lrkgipplfvnvrtlhqiperaavieelalqyfenltrsghfsredadagipvepasalvwtalflaqhydymrdtdraleyinv
FBpp0082819  .....................................................................................
FBpp0292061  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0081805  .....................................................................................
FBpp0100021  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0074877  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0297722  .....................................................................................
FBpp0087232  skpldyflklkptideeltpeqlislpkddfrrvaqlerhqgerqpsnffqhvlmarfltnclraggyfgsepkpdevsiicslv
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0075786  .....................................................................................
FBpp0075788  .....................................................................................
FBpp0306229  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0075789  .....................................................................................
FBpp0301715  .....................................................................................
FBpp0301716  .....................................................................................
FBpp0306230  .....................................................................................
FBpp0075785  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076498  .....................................................................................
FBpp0293529  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0290395  q....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  tealmqehkyaeaial.....................................................................
FBpp0297722  tealmqehkyaeaial.....................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  .....................................................................................
FBpp0089396  .....................................................................................
FBpp0111789  .....................................................................................
FBpp0086683  .....................................................................................
FBpp0289328  yasqrngteirdtvvrydwwsntslvrerinqriidmtgfnflkdeklqianyglgtyfqphfdyssdgfetpnittlgdrlasi
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0305185  .....................................................................................
FBpp0112213  .....................................................................................
FBpp0087233  skpldyflklkptideeltpeqlislpkddfrrvaqlerhqgerqpsnffqhvlmarfltnclraggyfgsepkpdevsiicslv
FBpp0070906  .....................................................................................
FBpp0303990  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0082112  .....................................................................................
FBpp0086359  .....................................................................................
FBpp0293627  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0303989  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085047  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0082420  .....................................................................................
FBpp0306145  .....................................................................................
FBpp0303989  .....................................................................................
FBpp0305372  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  myniryqkftnkklmdkfrqeylfrvqyqtrrnmisalrsirylrktksltkltsyveevmgdyvvkktnrimpwkfefinevyn
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0081398  .....................................................................................
FBpp0301016  .....................................................................................
FBpp0085015  .....................................................................................
FBpp0084188  .....................................................................................
FBpp0293235  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0304708  .....................................................................................
FBpp0305372  .....................................................................................
FBpp0304707  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  lktftrmlqarrpmykeyfhrnpqiearmrdanlfriqyqtrrnmvsilrtikvlrgrndikrlrkfveevmgsyvviktnrlmp
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075443  .....................................................................................
FBpp0305287  .....................................................................................
FBpp0305288  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0303990  .....................................................................................
FBpp0073018  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0087626  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0085046  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0306202  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................


                                                                                                    
                                                                                                    
d2fbna1        .....................................................................................
FBpp0112456  .....................................................................................
FBpp0297503  .....................................................................................
FBpp0112455  .....................................................................................
FBpp0297502  .....................................................................................
FBpp0070352  .....................................................................................
FBpp0070351  .....................................................................................
FBpp0070402  aigmcprdklfrgyidleiqlrefercrmlyekflefgpencvtwmkfaelenllgdtdraraifelavqqprldm.........
FBpp0080138  eakesdlktplsckskrrgmrlrrrrrkiaqsddsscydseseldtdfysdeedytdlssnfdtdfsdidaadpgepcgeeryaa
FBpp0080139  eakesdlktplsckskrrgmrlrrrrrkiaqsddsscydseseldtdfysdeedytdlssnfdtdfsdidaadpgepcgeeryaa
FBpp0301685  .....................................................................................
FBpp0074609  .....................................................................................
FBpp0084171  feyieclmgkhklekneilldedvalrgftplgretlsmdylkrgserlqffervrrigqfqeyyvqhqealqqplessftvehl
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0305561  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0271718  .....................................................................................
FBpp0290895  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0293601  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0296963  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0305185  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0081607  .....................................................................................
FBpp0304082  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0303945  .....................................................................................
FBpp0303946  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0085344  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0297109  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070573  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0305905  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0076114  .....................................................................................
FBpp0076115  .....................................................................................
FBpp0305988  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0293601  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0303945  .....................................................................................
FBpp0303946  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0085409  .....................................................................................
FBpp0271717  .....................................................................................
FBpp0271719  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0303439  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0300561  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0076600  qagnitprtpnnnnvgnngnmnvppnpnaavrrssrlfsnsysvkennkspniankfvqprspprkaksrmtkiclnneliedks
FBpp0305561  qagnitprtpnnnnvgnngnmnvppnpnaavrrssrlfsnsysvkennkspniankfvqprspprkaksrmtkiclnneliedks
FBpp0071712  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0305602  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0079666  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  aidhtptliellitkgrifkhagdpveayvwleeaqsmdtadryi........................................
FBpp0082819  .....................................................................................
FBpp0292061  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0081805  .....................................................................................
FBpp0100021  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0074877  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0297722  .....................................................................................
FBpp0087232  lrslqfiqfnthevaelhkfsssgreksifiggaiyptlalfnhscdpgvvryfrgttihinsvrpieaglpinenygpmytqde
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0075786  .....................................................................................
FBpp0075788  .....................................................................................
FBpp0306229  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0075789  .....................................................................................
FBpp0301715  .....................................................................................
FBpp0301716  .....................................................................................
FBpp0306230  .....................................................................................
FBpp0075785  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076498  .....................................................................................
FBpp0293529  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0297722  .....................................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  .....................................................................................
FBpp0089396  .....................................................................................
FBpp0111789  .....................................................................................
FBpp0086683  .....................................................................................
FBpp0289328  lfyasevpqggatvfpeinvtvfpqkgsmlywfnlhddgkpdi..........................................
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0305185  .....................................................................................
FBpp0112213  .....................................................................................
FBpp0087233  lrslqfiqfnthevaelhkfsssgreksifiggaiyptlalfnhscdpgvvryfrgttihinsvrpieaglpinenygpmytqde
FBpp0070906  .....................................................................................
FBpp0303990  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0082112  .....................................................................................
FBpp0086359  .....................................................................................
FBpp0293627  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0303989  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085047  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0082420  .....................................................................................
FBpp0306145  .....................................................................................
FBpp0303989  .....................................................................................
FBpp0305372  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  ilalayvdqytlpknfrfseknallrllrfpmdkskevkhfvfgdrtthqgsetvdpaltksrlmgnrlenrmnfakypieksyl
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0081398  .....................................................................................
FBpp0301016  .....................................................................................
FBpp0085015  .....................................................................................
FBpp0084188  .....................................................................................
FBpp0293235  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0304708  .....................................................................................
FBpp0305372  .....................................................................................
FBpp0304707  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  wkaefmnevynnlalslcegyrlpptrvtpydksamcqllnipvakplehtelifgdrstysyagadkqstdrladqnqieylek
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075443  .....................................................................................
FBpp0305287  .....................................................................................
FBpp0305288  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0303990  .....................................................................................
FBpp0073018  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0087626  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0085046  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0306202  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................


                                                                                                    
                                                                                                    
d2fbna1        .....................................................................................
FBpp0112456  .....................................................................................
FBpp0297503  .....................................................................................
FBpp0112455  .....................................................................................
FBpp0297502  .....................................................................................
FBpp0070352  .....................................................................................
FBpp0070351  .....................................................................................
FBpp0070402  .....................................................................................
FBpp0080138  anyskkerkagggggggvggvvysdnedvvieeekivypneverrsnsqeadseellrsfevlqlnfksaedaqskpvapppvsf
FBpp0080139  anyskkerkagggggggvggvvysdnedvvieeekivypneverrsnsqeadseellrsfevlqlnfksaedaqskpvapppvsf
FBpp0301685  .....................................................................................
FBpp0074609  .....................................................................................
FBpp0084171  n....................................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0305561  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0271718  .....................................................................................
FBpp0290895  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0293601  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0296963  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0305185  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0081607  .....................................................................................
FBpp0304082  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0303945  .....................................................................................
FBpp0303946  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0085344  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0297109  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070573  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0305905  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0076114  .....................................................................................
FBpp0076115  .....................................................................................
FBpp0305988  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0293601  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0303945  .....................................................................................
FBpp0303946  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0085409  .....................................................................................
FBpp0271717  .....................................................................................
FBpp0271719  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0303439  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0300561  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0076600  hhlsekrkekvetitssgannnsggrsaaeeakvllnnslnnaqtmahqlmglkkqsadglmallrglaeayqllsnfqckaaik
FBpp0305561  hhlsekrkekvetitssgannnsggrsaaeeakvllnnslnnaqtmahqlmglkkqsadglmallrglaeayqllsnfqckaaik
FBpp0071712  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0305602  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0079666  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  .....................................................................................
FBpp0082819  .....................................................................................
FBpp0292061  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0081805  .....................................................................................
FBpp0100021  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0074877  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0297722  .....................................................................................
FBpp0087232  rserqarlkdlywfecscdacidnwpkfddlprdvirfrcdapnncsavievppscndfmvkcvtcgeitnilkglkvmqdtemm
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0075786  .....................................................................................
FBpp0075788  .....................................................................................
FBpp0306229  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0075789  .....................................................................................
FBpp0301715  .....................................................................................
FBpp0301716  .....................................................................................
FBpp0306230  .....................................................................................
FBpp0075785  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076498  .....................................................................................
FBpp0293529  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0297722  .....................................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  .....................................................................................
FBpp0089396  .....................................................................................
FBpp0111789  .....................................................................................
FBpp0086683  .....................................................................................
FBpp0289328  .....................................................................................
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0305185  .....................................................................................
FBpp0112213  .....................................................................................
FBpp0087233  rserqarlkdlywfecscdacidnwpkfddlprdvirfrcdapnncsavievppscndfmvkcvtcgeitnilkglkvmqdtemm
FBpp0070906  .....................................................................................
FBpp0303990  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0082112  .....................................................................................
FBpp0086359  .....................................................................................
FBpp0293627  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0303989  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085047  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0082420  .....................................................................................
FBpp0306145  .....................................................................................
FBpp0303989  .....................................................................................
FBpp0305372  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  lhqmaeihlkshrfdeccfsarksieeakkcnsyiwqflcylliikanaalhkvertsealdlalkiskelkekhihnfltacih
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0081398  .....................................................................................
FBpp0301016  .....................................................................................
FBpp0085015  .....................................................................................
FBpp0084188  .....................................................................................
FBpp0293235  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0304708  .....................................................................................
FBpp0305372  .....................................................................................
FBpp0304707  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  rllfarlpiersyllheladrhmqknhfvqslsyaqkaieearvcnsliweflstmlmakshavlhkyerqtevlnsayelaaql
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075443  .....................................................................................
FBpp0305287  .....................................................................................
FBpp0305288  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0303990  .....................................................................................
FBpp0073018  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0087626  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0085046  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0306202  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................


                                                                                                    
                                                                                                    
d2fbna1        .....................................................................................
FBpp0112456  .....................................................................................
FBpp0297503  .....................................................................................
FBpp0112455  .....................................................................................
FBpp0297502  .....................................................................................
FBpp0070352  .....................................................................................
FBpp0070351  .....................................................................................
FBpp0070402  .....................................................................................
FBpp0080138  seppkklvyrnkytkinpnividclhneptiralkmlfdwlrinpeiligcyhsnpefvhkimkllnycnidiftrkvyferdll
FBpp0080139  seppkklvyrnkytkinpnividclhneptiralkmlfdwlrinpeiligcyhsnpefvhkimkllnycnidiftrkvyferdll
FBpp0301685  .....................................................................................
FBpp0074609  .....................................................................................
FBpp0084171  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0305561  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0271718  .....................................................................................
FBpp0290895  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0293601  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0296963  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0305185  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0081607  .....................................................................................
FBpp0304082  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0303945  .....................................................................................
FBpp0303946  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0085344  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0297109  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070573  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0305905  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0076114  .....................................................................................
FBpp0076115  .....................................................................................
FBpp0305988  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0293601  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0303945  .....................................................................................
FBpp0303946  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0085409  .....................................................................................
FBpp0271717  .....................................................................................
FBpp0271719  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0303439  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0300561  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0076600  qlettipkhhlnsswvqsliglaryemreyeaavaifetihktep........................................
FBpp0305561  qlettipkhhlnsswvqsliglaryemreyeaavaifetihktep........................................
FBpp0071712  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0305602  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0079666  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  .....................................................................................
FBpp0082819  .....................................................................................
FBpp0292061  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0081805  .....................................................................................
FBpp0100021  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0074877  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0300832  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0305672  .....................................................................................
FBpp0305670  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0305671  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0297722  .....................................................................................
FBpp0087232  trtakrlyetgeypkalakfvdlirim..........................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0075786  .....................................................................................
FBpp0075788  .....................................................................................
FBpp0306229  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0075789  .....................................................................................
FBpp0301715  .....................................................................................
FBpp0301716  .....................................................................................
FBpp0306230  .....................................................................................
FBpp0075785  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076498  .....................................................................................
FBpp0293529  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0290395  .....................................................................................
FBpp008072