SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from Please contact us if you experience any problems.

TPR-like alignments in Drosophila melanogaster 69_5

These alignments are sequences aligned to the 0052646 model.

Sophisticated options are available for refining alignments:

Jump to [ Top of page · Refine alignments · Add alignments from genomes ]


The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

d2fbna1        akk..................................................................................
FBpp0112455  aqqvvelrpydieswsvmireaqtrpihevrslyeslvnvfpttarywklyiememrsryyerveklfqrclvkilnidlwklyl
FBpp0070351  daykeyefaegnpmsdvenpfekgkeylskgdipsavlc..............................................
FBpp0070402  ednlrknrmv...........................................................................
FBpp0080138  lyrslytaskqlddakrnvqsvgqlfqheieekrsllvqlckqiifkdyqsvgkkvrevmwrrgyyefiafvkknwhkqcqdaat
FBpp0074609  qkalqlmaeaekkltqqkgflgslfggsnkve.....................................................
FBpp0084171  nivhlydqlmvlnqrnlilinwknfcyihdqlqdafkqllleqlkfvcehkvdvffwkllfynvrnylkrqqtdqahthtlllie
FBpp0085420  geiwlaihhfekavtldpnfldayinlgnvlkearifdravaaylralnlspnnavvhgnlacvyyeqglidlaidtyrraielq
FBpp0085420  lelahreyqavdyesaekhcmqlwrqdstntgvllllssihfqcrrldksaqfstlaikqnpvlaeaysnlgnvfkergqlqeal
FBpp0077790  fark.................................................................................
FBpp0082545  e....................................................................................
FBpp0084691  vtarwsfeegikrpyfhvkpleraqlknwkdyldfeiekgdrervlvlfercliacalydefwlkmlrylesledqsgvvdlvrd
FBpp0072096  aeaedlvkqaekslklsml..................................................................
FBpp0071560  pqakpgvsyhariapnhlnvfinlanliaknqtrleead..............................................
FBpp0077790  ek...................................................................................
FBpp0076600  pvtwcvsgncfslqkehetai................................................................
FBpp0271716  medllnevvpqedlerfekkyhheleldgevttdtkfeyafclvrsryt....................................
FBpp0077790  kv...................................................................................
FBpp0290896  eeqlfrsaisinppkalgnlgsvlsaqgryeeaelt.................................................
FBpp0081673  eeaealigqtdsaaneyakagm...............................................................
FBpp0077614  eslyrsaia............................................................................
FBpp0084691  ravkedstdft..........................................................................
FBpp0296980  qs...................................................................................
FBpp0080535  l....................................................................................
FBpp0296980  gdrtgmgkaygnmarmahmagsyeaavkyhkqela..................................................
FBpp0072164  qyk..................................................................................
FBpp0084016  tisfretqelrnmwsallnmelvysnnfddvlkealncndpleiyisvvdilkknkrkdrlssv.....................
FBpp0296980  ckdtqa...............................................................................
FBpp0296980  d....................................................................................
FBpp0080894  petccv...............................................................................
FBpp0081606  .....................................................................................
FBpp0084559  ravefyqenlklmrdlgdrgaq...............................................................
FBpp0075683  e....................................................................................
FBpp0081284  evs..................................................................................
FBpp0079468  rla..................................................................................
FBpp0087297  qqqdeartyfelavqsgrk..................................................................
FBpp0074835  k....................................................................................
FBpp0079893  gtfhllcgsyvesqqdfdaiiandyadpnlrayayikraalyiqldqrekgiadf..............................
FBpp0082765  lta..................................................................................
FBpp0079617  q....................................................................................
FBpp0084440  qf...................................................................................
FBpp0080424  i....................................................................................
FBpp0085344  esfekalkfsfgeqhvwrqyglslmaaekhshalrvlqesmkltpsdplpcllasrlcyesletvkqgldyaqqalkrevkglrp
FBpp0081552  as...................................................................................
FBpp0087646  dcktfeayllcgklhmalknysdalny..........................................................
FBpp0083769  clvengdfnrlfyvahklvdrypdkaiswyavgcyydmigksdparrylskataldrlygpawlayghsfaneneheqamaayfk
FBpp0070572  k....................................................................................
FBpp0070575  k....................................................................................
FBpp0074835  rdqwfqeaieaeksgavnccqsivkavigigveeedrkqtwiddaefcakenafecaravyahalqifpskksiwlraayfeknh
FBpp0080424  m....................................................................................
FBpp0076113  qs...................................................................................
FBpp0072561  ynlarlneamssydva.....................................................................
FBpp0072561  dqshllgrayfcllegdkmdqada.............................................................
FBpp0085923  .....................................................................................
FBpp0079893  e....................................................................................
FBpp0075683  lr...................................................................................
FBpp0077614  eilyqrigdvlgrlqqwdeaerhhraalelqpnqvaahlsygitlarnssraseaem............................
FBpp0086749  rslkvwsmyadleesfgtfktcka.............................................................
FBpp0073411  dekmlats.............................................................................
FBpp0070908  m....................................................................................
FBpp0085842  trk..................................................................................
FBpp0077718  fqflyyheadvqkahslcqavleverqkpsgstgctlswwwqqqmgrcllalhyprraepflqqsltsfphpdtylllsrvyqri
FBpp0296980  fr...................................................................................
FBpp0076600  esd..................................................................................
FBpp0086749  ehfvskhgksnhqlwnelcdlisknphkvhslnvdaiirgglrrytdql....................................
FBpp0085479  la...................................................................................
FBpp0112016  i....................................................................................
FBpp0079665  aln..................................................................................
FBpp0084076  a....................................................................................
FBpp0111406  rv...................................................................................
FBpp0074918  ay...................................................................................
FBpp0082818  pgslrvmkfkamr........................................................................
FBpp0074480  elkqyknglklakqilsnpkymehgetlamkgltlnglgrreeaykyvrl...................................
FBpp0082819  ldtarfdiatkctkqlal...................................................................
FBpp0085279  laealskakeafsldrtlhqfrdqhgenvyhnfdltyaqyersemhiealntysimaknkmfphvnqlklnmgniyysmgiyqka
FBpp0081805  afrsvad..............................................................................
FBpp0100023  wsade................................................................................
FBpp0071879  slqynrglvleelhmftlaaenyksitkeyssyhdcylrlgvmaiqknnhtqaiehlkdilvednlnmtartymgdcfkglsldk
FBpp0084559  gtedlrtl.............................................................................
FBpp0075591  sre..................................................................................
FBpp0076526  ekarsdgnrdqv.........................................................................
FBpp0079851  lhi..................................................................................
FBpp0072146  lh...................................................................................
FBpp0296980  q....................................................................................
FBpp0083238  ev...................................................................................
FBpp0111383  eq...................................................................................
FBpp0071560  qaa..................................................................................
FBpp0080424  yd...................................................................................
FBpp0071879  .....................................................................................
FBpp0292775  mdaalavyhkaedwfsqvkilcylgkiskadai....................................................
FBpp0077934  lrd..................................................................................
FBpp0087646  nghletat.............................................................................
FBpp0079665  deh..................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  a....................................................................................
FBpp0077619  n....................................................................................
FBpp0086164  lta..................................................................................
FBpp0087232  aae..................................................................................
FBpp0072561  y....................................................................................
FBpp0088148  eavrtwrsalkgtcqredcfqllgyly..........................................................
FBpp0075787  l....................................................................................
FBpp0083319  nkfg.................................................................................
FBpp0076499  se...................................................................................
FBpp0290580  .....................................................................................
FBpp0080720  w....................................................................................
FBpp0086164  lm...................................................................................
FBpp0080741  davamarratvliaeigrdknmeif............................................................
FBpp0087297  fv...................................................................................
FBpp0070720  hvwlkylkarlvvtqtdeerkafeeqcakalgyyysiplseyvvnylvdqgnvqnhvlwaklladydverpdfgdklrslistit
FBpp0086683  k....................................................................................
FBpp0289328  nllnqvdqlgekfealrmylssvgyelhrslnekvqyvsnpinafsllrrthedlpkwheyfkeaigegnqsilvdlvkmvpndv
FBpp0070667  dgl..................................................................................
FBpp0082624  qql..................................................................................
FBpp0081552  re...................................................................................
FBpp0086749  rtr..................................................................................
FBpp0087646  ainwyvqneetda........................................................................
FBpp0071879  vaqmylhegelnrskaf....................................................................
FBpp0080894  ygvvlkalnlnqaaeqmlvqairlvpmlwsaylelsplimekkkllslqlgghwmrhffmahtylelylnddglkiyedlqasgf
FBpp0070906  y....................................................................................
FBpp0087646  iklgkhaeaipkcqrllksepenamgylllgaayqnidkaeaaknlrqcikctdgpapaallglancapsnelpeiydqladlqp
FBpp0082112  eyaal................................................................................
FBpp0293629  fl...................................................................................
FBpp0076526  ltssvdyaklkgly.......................................................................
FBpp0085279  el...................................................................................
FBpp0074835  l....................................................................................
FBpp0078887  yte..................................................................................
FBpp0290580  t....................................................................................
FBpp0085047  qynsslkpid...........................................................................
FBpp0296980  v....................................................................................
FBpp0086380  h....................................................................................
FBpp0083435  gingqaveelf..........................................................................
FBpp0078891  whlataivychdgqfenalkilhgstnlesmalsvqcllrlqrvdlakqlvakmq..............................
FBpp0082419  asglptsassedlsqslseytdadesvsapteflaeflsa.............................................
FBpp0086749  eeeilrnaysvkhwlryidhkakapnngvnm......................................................
FBpp0078027  ieqg.................................................................................
FBpp0088148  hra..................................................................................
FBpp0290863  my...................................................................................
FBpp0080720  qreqydkaeqmlhlalrmaqdiqskdg..........................................................
FBpp0083319  vqla.................................................................................
FBpp0071288  qrmiiddmqekfprepglwdllaqrelrgfhlgdleeedldtsdeepaskksrsvngrslkrriqlcvtvyksaveelqttemwn
FBpp0081398  elfsqgsrnflvksydeaadelsqvcqlyeevygeladelgqplllyakaliamaldenkvidvpdeaaddddedvdddeeesae
FBpp0085016  rwr..................................................................................
FBpp0293235  v....................................................................................
FBpp0290580  lrdalkdyeqalelylp....................................................................
FBpp0085012  syvnhdyyhtvlwmneamarmleeptnh.........................................................
FBpp0086380  t....................................................................................
FBpp0071879  n....................................................................................
FBpp0076961  pteqqr...............................................................................
FBpp0075717  lq...................................................................................
FBpp0080267  agnds................................................................................
FBpp0070908  nyk..................................................................................
FBpp0085033  lsv..................................................................................
FBpp0082507  qclqalftfmppskve.....................................................................
FBpp0292775  iwtnlakmcvhtnrldvakvcmghleqarsvralrqaied.............................................
FBpp0085676  sdevlh...............................................................................
FBpp0087091  vef..................................................................................
FBpp0082624  sm...................................................................................
FBpp0070431  lnvwyvktldaafeaa.....................................................................
FBpp0075442  qahd.................................................................................
FBpp0070906  iid..................................................................................
FBpp0089265  lrv..................................................................................
FBpp0078634  ai...................................................................................
FBpp0075754  yfslvgllr............................................................................
FBpp0087625  sknlreegnlmfkesasgsskdsvl............................................................
FBpp0071288  rl...................................................................................
FBpp0110159  la...................................................................................
FBpp0072679  qraeisaf.............................................................................
FBpp0082624  w....................................................................................
FBpp0084254  m....................................................................................
FBpp0085032  t....................................................................................

d2fbna1        .....................................................................................
FBpp0112455  tyvketksglsthkekmaqaydfalekigmdlhsfsiwqdyiyflrgveavgnyaenqkitavrrvyqkavvtpivgieqlwkdy
FBpp0070351  .....................................................................................
FBpp0070402  .....................................................................................
FBpp0080138  aqenmqklerflcagifnykrlsarmeeiydldlkylidfsiisdgyisdmigdtmesshsgthavdksleavsfaldtihssll
FBpp0074609  .....................................................................................
FBpp0084171  qaikfyrmlydklmakcvassrcdsalkvvaqrlliclgdltryrvnh.....................................
FBpp0085420  pnfpdaycnlanalkekgqvkeaedcyntalrlcsnhadslnnlanikreqgyieeat...........................
FBpp0085420  dnyrravrlkpdfidgyinlaaalvaardmesavqa.................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084691  vyrracrih............................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0085344  srsqlfvgighqqlaiqsnlkserdachklaldaleravqfdgndhlaeyylslqyallgqlaealvhirfalalrmehapclhl
FBpp0081552  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  atqlmrgchlpllyigvecgltknlela.........................................................
FBpp0070572  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0074835  gtresle..............................................................................
FBpp0080424  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0077718  kqperallvigevvdsrpfdvtyrleqarihqameqqedalq...........................................
FBpp0296980  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  .....................................................................................
FBpp0082819  .....................................................................................
FBpp0085279  vkmyrmaldsvpkslsqlrlkirenigilfirmgsysdaassfefimteranirssihlllcyfalgdvekvklafrrlcdvqte
FBpp0081805  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0071879  fatfnynmilarqskftntyvsmamgnfc........................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0087232  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076499  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  deneaaafvemlqkhcvtwtcnveqrqmiksvvdkfkqhldettrgwdwseqhkahvydvetlsldddlknavirfifersvakf
FBpp0086683  .....................................................................................
FBpp0289328  dmlsamhgiqriekiydlkiddlaqgvlqgvqynvqlt...............................................
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0087646  eqslnyweklfnlasdsnvapfcftvlkkrvqdtengnftkiqeylgriwvsndfeiapedtqlykttmeallqnsepsarsvvy
FBpp0082112  .....................................................................................
FBpp0293629  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085047  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0071288  myldamlalnsdgkterilkqqcladalqaghrsqlmgvkhyatlrkmlctapsgreaavtiltealkndssvemhelllathiq
FBpp0081398  dgaakkeekkdtkeaangasssngkeldtikegsdeadstgeaeqaqsdekpskkvptgvdevsssnggggaavndderpstsng
FBpp0085016  .....................................................................................
FBpp0293235  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  .....................................................................................
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075442  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0089265  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................

d2fbna1        .....................................................................................
FBpp0112455  iafeqninpiisekmslerskdymnarrvakeleyhtkglnrnlpavpptltkeevkqvelwkrfityeksnplrtedtalvtrr
FBpp0070351  .....................................................................................
FBpp0070402  .....................................................................................
FBpp0080138  slgdlhryfldfridsklsiskeq.............................................................
FBpp0074609  .....................................................................................
FBpp0084171  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0085344  fallltssrrprealgvvedalhefpdnlqllhvkahlqlhledaetalgtvqhmlavwrdvyeaqlageeekhsdtksgvhlah
FBpp0081552  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  .....................................................................................
FBpp0082819  .....................................................................................
FBpp0085279  aiesdmesetniiklqqqaepiqqigetdgyqslnnepvtgsvikaegggklnetvkfaatvkhryvvqalkkdelavyrnerrn
FBpp0081805  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0087232  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076499  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  pivdvlwlsyiefiqfegvtvpenedenevtaemvakrakrlgkgflrnteldlanrgvrshpsvqlnhrfldlmersdfelaev
FBpp0086683  .....................................................................................
FBpp0289328  .....................................................................................
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0087646  krylkwlykkqdyetcvrhacnmteshpkdvygfewicktycehheqseivswqqelrhpiqv......................
FBpp0082112  .....................................................................................
FBpp0293629  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085047  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0071288  sdsepliyelfnkiqksmgsealplwrsvilyyrtrqdslgarrlde......................................
FBpp0081398  evtascsngaapaveeepeeeegvsgslqlaweileaaaqifsrqglsg....................................
FBpp0085016  .....................................................................................
FBpp0293235  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  .....................................................................................
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075442  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0089265  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................

d2fbna1        .....................................................................................
FBpp0112455  vmfateqcllvlthhpavwhqasqfldtsarvltekgvrtsvenispilcvpvvnqiewvmafawwwakdvqaakifadecanil
FBpp0070351  .....................................................................................
FBpp0070402  .....................................................................................
FBpp0080138  .....................................................................................
FBpp0074609  .....................................................................................
FBpp0084171  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0085344  ssqmsdkdsnsvyaaslaavsrveqalseaasslssftqrpgprrpwml....................................
FBpp0081552  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  .....................................................................................
FBpp0082819  .....................................................................................
FBpp0085279  avkrsitmivdlispfiednyndgynwcieiiktsnlawlanelelnkalvylrqndvhqaietlqmydrksegsmtasaltnls
FBpp0081805  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0087232  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076499  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  deeirlilqrivtdmdmtvelhldyla..........................................................
FBpp0086683  .....................................................................................
FBpp0289328  .....................................................................................
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0082112  .....................................................................................
FBpp0293629  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085047  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0081398  .....................................................................................
FBpp0085016  .....................................................................................
FBpp0293235  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  .....................................................................................
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075442  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0089265  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................

                                                                   10        20           30        
                                                                    |         |            |        
d2fbna1        ............................................---SIYDYTDEEKVQSAFDIKEEGNEF.FK..KN...EINE
FBpp0112455  .....................................ersingv-------------------LNRNALLY.FA..YA...DFEE
FBpp0070351  ............................................-----FEVAAKKQPERAEVWQLLGTSQ.TE..NE...MDPQ
FBpp0070402  ............................................----------------VSHWIKYAQWE.EQ..QQ...EIQR
FBpp0080138  ............................................---------------------------.--..--...----
FBpp0074609  ............................................--------------DAIECYQRAGNMF.KM..SK...NWTK
FBpp0084171  ............................................---------------------------.--..--...----
FBpp0085420  ............................................---------------------------.--..--...----
FBpp0085420  ............................................-----YITALQYNPDLYCVRSDLGNLL.KA..LG...RLEE
FBpp0077790  ............................................-------------------EKELGNAA.YK..KK...DFET
FBpp0082545  ............................................---QLFKSALQVCPDNAKVHYNIARLA.TD..MG...NNTK
FBpp0084691  ............................................------------HPDKPSLHLMWAAFE.EC..QM...NFDD
FBpp0072096  ............................................-------KWVPDYDSAADEYSKAATAY.RI..AK...SYDK
FBpp0071560  ............................................---HLYRQAISMRSDYVQAYINRGDIL.MK..LN...RTAQ
FBpp0077790  ............................................----------------AEEEKEQGNLF.FK..KG...DYST
FBpp0076600  ............................................---KFFKRAVQVDPDFVYSYTLLGHEL.VL..TE...EFDK
FBpp0271716  ............................................---------------------------.--..--...----
FBpp0077790  ............................................-----------------NELKEKGNQA.LS..AE...KFDE
FBpp0290896  ............................................-----LRMTLGHRPTMADAHFNLGVVH.QK..QL...NFSS
FBpp0081673  ............................................-------------------YFKAATAY.RI..AK...SFDK
FBpp0077614  ............................................-----------INP--PKALGNLGSVL.SS..QG...RYEE
FBpp0084691  ............................................---------------------------.--..--...----
FBpp0296980  ............................................------------------------NAA.CQ..SG...DFAT
FBpp0080535  ............................................----------------AESIKNEGNRL.MK..EN...KYNE
FBpp0296980  ............................................-----INQAMNDRSAEAATHGNLAVAY.QA..LG...AHDA
FBpp0072164  ............................................---------------KANDIKDRGNTY.VK..QG...EYEK
FBpp0084016  ............................................-----LTTVLNKFKTELRVWPVAAEAY.FW..LG...KSDQ
FBpp0296980  ............................................---------------AAAALTSLGHVY.TA..SG...DYPN
FBpp0296980  ............................................---------------RARALGHLGDCY.AA..LG...DYEE
FBpp0080894  ............................................----------------------IGNYY.SI..RC...DHQV
FBpp0081606  ............................................----------------AEQYKNQGNEM.LK..TK...EFSK
FBpp0084559  ............................................----------------GRACGNLGNTY.YL..LG...DFQA
FBpp0075683  ............................................-----------NHPAVAATLNNLAVLY.GK..RG...KYKD
FBpp0081284  ............................................---------------DAGSYKDKGNEA.FK..AS...RWEE
FBpp0079468  ............................................---------------EAKVYKEKGTNY.FK..KE...NWAL
FBpp0087297  ............................................----------------LESYVRLAELY.RK..DK...QYQK
FBpp0074835  ............................................------------------LWMMKGQIE.EQ..QR...RTDD
FBpp0079893  ............................................------AEAERLNPENPDVYHQRAQIL.LL..LE...QIEP
FBpp0082765  ............................................------------NKEKADKLKVEGNEL.FK..ND...DAEG
FBpp0079617  ............................................-------------------LKEQGNCL.FA..AR...KYDD
FBpp0084440  ............................................----------------AERHRLRGNES.FK..AK...EYEN
FBpp0080424  ............................................----------------AEEKKKLGNDQ.YK..AQ...NYQN
FBpp0085344  ............................................---------------QIEIWLLLADVY.LR..ID...QPNE
FBpp0081552  ............................................-------------PADIENHLELGKEF.LA..RG...QLSD
FBpp0087646  ............................................-----VLKATRLRPHFAECFDYLGKLYpLA..TG...DFSR
FBpp0083769  ............................................--EKFFLQAMNIAPLDVYVLHELGVIK.YE..YE...FFDG
FBpp0070572  ............................................--------ATEEEVEQASELRAQAASA.YG..QQ...KFDE
FBpp0070575  ............................................--------ATEEEVEQASELRAQAASA.YG..QQ...KFDE
FBpp0074835  ............................................---ALLQRAVAHCPKSEILWLMGAKSK.WM..AG...DVPA
FBpp0080424  ............................................--------------------KENGNML.FK..SG...RYRE
FBpp0076113  ............................................-----------------------GNHF.YQ..LG...RYHE
FBpp0072561  ............................................--DKLYKEILKEHPNYIDCYLRLGCMA.RD..KG...LIFV
FBpp0072561  ............................................----QFNFVLNQSPSNIPSLLGKACIA.FN..RK...DYRG
FBpp0085923  ............................................-------------PTEIEVYKKEGNDF.LE..NG...KLVD
FBpp0079893  ............................................----------------ANNYKTEGNNC.YR..NG...KYDE
FBpp0075683  ............................................------------------TLHNLVIQY.AS..QG...RYEV
FBpp0077614  ............................................----WFKRALKLAPEQASVYHHYAEFL.SL..QS...RHHE
FBpp0086749  ............................................----VYERIIDLKICTPQIIINYGMFL.EE..HN...YFEE
FBpp0073411  ............................................------------------TLRERGNNF.YK..AS...RFTE
FBpp0070908  ............................................--------------------MALGKCL.YY..NG...DYFQ
FBpp0085842  ............................................--------------------KERANFF.YK..RS...EFTT
FBpp0077718  ............................................----LYRLAAKLHPINVESLASIAVGY.FY..DN...NPEM
FBpp0296980  ............................................------------------ALGNIGDIL.IR..TG...SHEE
FBpp0076600  ............................................-----------------ETIFLLATSY.FR..SN...QVHQ
FBpp0086749  ............................................----------------GHLWNSLADYY.VR..SG...LFDR
FBpp0085479  ............................................-----------------LNYKEDGNFY.MK..HK...KFRM
FBpp0112016  ............................................---------------------ALGLKE.IK..NA...NPEN
FBpp0079665  ............................................----FLQKSIEADPKSGQSLYLLGRCY.AG..IN...KVHD
FBpp0084076  ............................................-----------------ELQRSQGNEA.FR..SQ...KYEK
FBpp0111406  ............................................----------------AQNFRKLGNAE.YR..KG...NYEA
FBpp0074918  ............................................----------------------WGNHF.YR..SA...DYAQ
FBpp0082818  ............................................--------------------------Y.EA..LE...QYDE
FBpp0074480  ............................................--------GLRNDLRSHVCWHVYGLLQ.RS..DK...KYDE
FBpp0082819  ............................................-----------EFPGSLRVMKFKAMRY.EA..LE...QYDE
FBpp0085279  fiyikmashcvnqlheigslknnapglinagivelgshnlilas---ERFEGALQLQPMNFEARYNLGLVA.LA..QN...DYEL
FBpp0081805  ............................................-----------------------GIEH.FK..NG...QQVE
FBpp0100023  ............................................-------------------CL------.--..--...----
FBpp0071879  ............................................-------------LEKLQNWIAEGNFR.AA..RK...QQEK
FBpp0084559  ............................................----------------SAIYSQLGNAY.FY..LG...DYNK
FBpp0075591  ............................................-------------------LELKAIAL.SE..SG...ELDG
FBpp0076526  ............................................----------------AVSCNQLGDFY.NQ..QG...KYTD
FBpp0079851  ............................................----------------------NGSVE.YS..RG...RCDE
FBpp0072146  ............................................---------------------LHGKDS.VK..LG...RYQS
FBpp0296980  ............................................----------------ARALSNLGSVH.ES..LG...QQAE
FBpp0083238  ............................................---------------------------.--..-G...NNRK
FBpp0111383  ............................................------------REDVAETFRRMGNYE.YR..KL...NFSL
FBpp0071560  ............................................---------------------------.--..--...---L
FBpp0080424  ............................................---------------------------.--..TK...SYRN
FBpp0071879  ............................................-------------PKNILALIGRACLA.YN..RQ...DYIG
FBpp0292775  ............................................----------ARQSGDRAACYHLARHY.EN..VG...KFQE
FBpp0077934  ............................................-------------------LVDKGLIA.VA..KN...DFPE
FBpp0087646  ............................................---KACKMAIKECSNRWQNWNLLGVIN.MNseNE...NLPL
FBpp0079665  ............................................---------------YVNALCKLGHLH.LL..LG...EYSE
FBpp0086749  ............................................---------------------------.--..--...-YEE
FBpp0082652  ............................................-----------------DSFRRLGNEE.YR..RT...NYEK
FBpp0077619  ............................................-----------------------GNVE.FQ..RG...NLEE
FBpp0086164  ............................................--------------DRVELYMDITEAL.MQ..EH...KYAE
FBpp0087232  ............................................-------------------IKERATSA.FK..AK...KWLE
FBpp0072561  ............................................---------------------GLGQMY.IY..RG...DTEN
FBpp0088148  ............................................------------------------QAH.MD..WG...KFRE
FBpp0075787  ............................................--------------------LEDGNVL.YR..KN...RFQE
FBpp0083319  ............................................---------------------------.-N..NQ...EFDK
FBpp0076499  ............................................----------------------KASSC.MH..LN...LLDD
FBpp0290580  ............................................----------------------LGHCY.YH..AQ...KYEE
FBpp0080720  ............................................----------------------FGQLL.MK..QG...KYLE
FBpp0086164  ............................................---------------------GEANLS.FV..YG...RYET
FBpp0080741  ............................................----------------CDTFLERAYFL.ME..IG...NFNS
FBpp0087297  ............................................----------------------QGLID.RE..EG...NHIE
FBpp0070720  ............................................---------------------------.Y-..--...----
FBpp0086683  ............................................----------------AHTLFQAGKLW.MR..RM...RYHD
FBpp0289328  ............................................----------------YRDLIAMGNSM.YQ..QS...DYQT
FBpp0070667  ............................................----------QHHPASWKFHTLSSYYW.RM..RG...NARE
FBpp0082624  ............................................---------------------SLASMH.YM..RA...HYQE
FBpp0081552  ............................................---------------------------.--..EK...HFAE
FBpp0086749  ............................................---------------------------.--..--...----
FBpp0087646  ............................................---------------TPASLSFQGFLY.AR..KN...LYRQ
FBpp0071879  ............................................-----LESFLTSEPDEPVVMDLLAKIY.LE..YKcpeKIDK
FBpp0080894  ............................................-------------SKSIYLIAQMALVY.HN..KR...DVDK
FBpp0070906  ............................................---------------------------.-S..TG...DFSC
FBpp0087646  ............................................---------------------------.--..--...----
FBpp0082112  ............................................----------------------KAQQY.YI..MK...DFQM
FBpp0293629  ............................................---------------------------.--..-G...HHRQ
FBpp0076526  ............................................--------------------EKLGDGC.CH..LM...NYEK
FBpp0085279  ............................................---------------------NKALVY.LR..QN...DVHQ
FBpp0074835  ............................................---------------------------.--..--...----
FBpp0078887  ............................................---------------------------.--..--...----
FBpp0290580  ............................................----------------ADTLNDEGCLL.FQ..AD...QHEA
FBpp0085047  ............................................-------------------CLAIGLHL.MN..NS...RWYA
FBpp0296980  ............................................-----------------------GQEL.LQ..AT...QYSA
FBpp0086380  ............................................-------------PSTILEYTHLSLYS.FA..NG...HVGM
FBpp0083435  ............................................---------------------------.--..--...----
FBpp0078891  ............................................----------EISDDATLTQLAQAWVA.LA..QGte.QMQD
FBpp0082419  ............................................---------------------------.--..--...----
FBpp0086749  ............................................---------------------------.--..--...----
FBpp0078027  ............................................------------------IYKDWGTYY.SR..RR...RENL
FBpp0088148  ............................................---------------------------.--..--...----
FBpp0290863  ............................................---------------------------.--..--...----
FBpp0080720  ............................................---------------ITYVFDLMANLA.ME..RE...QFKK
FBpp0083319  ............................................------------------------YVL.QL..QG...KTKE
FBpp0071288  ............................................---------------------------.--..--...----
FBpp0081398  ............................................------------LPYLAEVQTELANIE.FE..NG...ILEA
FBpp0085016  ............................................------------------ECYEIGVQL.FD..LG...EYQR
FBpp0293235  ............................................-----------------------ARLY.MK..VQ...EYPK
FBpp0290580  ............................................------------------VVMARAWIS.WR..DD...DFVG
FBpp0085012  ............................................---------------------------.--..--...----
FBpp0086380  ............................................---------------DAYNFYTTGQAK.IQ..QG...LFKE
FBpp0071879  ............................................---------------------------.--..--...----
FBpp0076961  ............................................-----------------WIYRSWGQYF.AR..MR...KNTF
FBpp0075717  ............................................---------------------------.--..--...---Q
FBpp0080267  ............................................--------------------------Y.RK..ER...HPLK
FBpp0070908  ............................................---------------------------.--..ER...NYRA
FBpp0085033  ............................................-----------------------GAYL.FM..KN...RPSD
FBpp0082507  ............................................----------------ARTHLQMGQIL.MAy.TK...NIDL
FBpp0292775  ............................................--------------DDLETEAKVAVLA.IE..LG...MIEE
FBpp0085676  ............................................-----------------DIYRDWGTYY.SR..RR...RENF
FBpp0087091  ............................................--------------------RMLGNEQ.FS..LKnr.NYFQ
FBpp0082624  ............................................-----------------------ASAF.FL..YE...QFEE
FBpp0070431  ............................................---------------------------.IE..VG...KWSD
FBpp0075442  ............................................--------------------------M.VR..RR...SWAR
FBpp0070906  ............................................------------------VLRQAAKAC.VV..KR...DFAR
FBpp0089265  ............................................---------------------------.--..-R...DYYN
FBpp0078634  ............................................--------------------NELSIVL.AS..KE...EYNK
FBpp0075754  ............................................---------------------------.--..--...----
FBpp0087625  ............................................---------------------------.--..--...---K
FBpp0071288  ............................................---------------------------.--..--...----
FBpp0110159  ............................................----------------------MGRHL.MN..QS...RWTI
FBpp0072679  ............................................---------------------------.--..YG...EFEE
FBpp0082624  ............................................---------------------------.--..--...----
FBpp0084254  ............................................----------------AMSMYEVARVA.MH..KE...NFDE
FBpp0085032  ............................................--------------------YAMGQIL.FD..QK...NYLA

                  40        50        60                                                            
                   |         |         |                                                            
d2fbna1        AIVKYKEALDFFIHTEEWDDQILLDKKKNIE......................................................
FBpp0112455  GRLKYEKVHTMYNKLLQ--------LPDIDP......................................................
FBpp0070351  AIAALKRAYDL--------------QPDNQQvlmalaacytneglqnnavrmlcnwltvhpkyqhlvaahpelqaegtslassli
FBpp0070402  ARSIWERALDN--------------EHRN--......................................................
FBpp0080138  -------------------------------......................................................
FBpp0074609  AGECFCEAATL--------------HARAGSrhdagtcyvdasncykkvdvesavnclmksidiytdmgrftma...........
FBpp0084171  -------------------------------......................................................
FBpp0085420  --RLYLKALEV--------------FPDF--......................................................
FBpp0085420  AKACYLKAIET--------------CPGF--......................................................
FBpp0077790  ALKHYHAAIEH--------------DPTD--......................................................
FBpp0082545  AFQHYHRAIEL--------------YPNY--......................................................
FBpp0084691  AAEILQRIDQR--------------CPNL--......................................................
FBpp0072096  SKECFLKAIDA--------------YKNNKSwfhaakayeqiillskdadklhev..............................
FBpp0071560  AQEVYEQALLY--------------DNEN--......................................................
FBpp0077790  AVKHYTEAIKR--------------NPDD--......................................................
FBpp0076600  AMDYFRAAVVR--------------DPRH--......................................................
FBpp0271716  -------------------------------......................................................
FBpp0077790  AVAAYTEAIAL--------------DDQN--......................................................
FBpp0290896  AIPCFRRAIEL--------------RPQL--......................................................
FBpp0081673  RKDCLLKAIDC--------------YENNKSwfhaaksyeqiillaketdklse...............................
FBpp0077614  AKQVLQEAIRF--------------RPNM--......................................................
FBpp0084691  -------------------------------......................................................
FBpp0296980  AVLLYTDALQL--------------DPGN--......................................................
FBpp0080535  ALLQYNRAIAF--------------DPKN--......................................................
FBpp0296980  ALTHYRAHLAT--------------ARSLKDtage..................................................
FBpp0072164  AIVAYSTAIAV--------------YPHD--......................................................
FBpp0084016  VHNLLQRALRA--------------LPNQEH......................................................
FBpp0296980  ALASHKQCVQL--------------FKQLGDrlqe..................................................
FBpp0296980  ALKCHDRQLQLALGLTS--------HRDQ--......................................................
FBpp0080894  AISYFQRALKL--------------NPKY--......................................................
FBpp0081606  AIDMYTKAIEL--------------HPNS--......................................................
FBpp0084559  AIEHHQERLRI--------------AREFGDraae..................................................
FBpp0075683  AEPLCKRALEIREKVLGKD------HPDV--......................................................
FBpp0081284  AVEHYGKAIKA--------------GSKHKEl.....................................................
FBpp0079468  AIKMYTKCKNI--------------LPTTVHtneevkkik.............................................
FBpp0087297  AIEILENCLHL--------------TPENSEvlieisvlylkinetqkahdrlaevvsierkcspkgllafgailqsrndidgal
FBpp0074835  AAATYTLGLKK--------------CPTS--......................................................
FBpp0079893  ALAEFEKAVSI--------------APNHAIafvqkcyaeyrlsllagdqrrlesvmhtfqnaierfpsc...............
FBpp0082765  AAKTYTEALDI--------------CPSASSker...................................................
FBpp0079617  AINCYSKAIIK--------------NPTN--......................................................
FBpp0084440  AIEEYNCSIIY--------------DPENA-......................................................
FBpp0080424  ALKLYTDAISL--------------CPDS--......................................................
FBpp0085344  ALNCIHEASQI--------------YPLS--......................................................
FBpp0081552  ALTHYHAAVEG--------------DANN--......................................................
FBpp0087646  ARKCYEKCISL--------------NPLAEEavdalsfiyqeqgeeelnetlllntlshlgsnes....................
FBpp0083769  AATIFQCTVDI-------------------Vkqraksnneeissrw.......................................
FBpp0070572  AIALYTKAIEL--------------SPGN--......................................................
FBpp0070575  AIALYTKAIEL--------------SPGN--......................................................
FBpp0074835  ARGILSLAFQA--------------NPNS--......................................................
FBpp0080424  AHVIYTDALKI--------------DEHNKDin....................................................
FBpp0076113  ARAKYRKANRY--------------YHYLSRqfgwqqlnplkkhlvdedllkvdgfs............................
FBpp0072561  ASDFFKDALNI--------------NNDNPDarsllgnlhlakmqfalgqknfetilknpststdayslialgnfslqtlhqpsr
FBpp0072561  AMAFYKKALRT--------------NPNCPAnvrigmahcflkmgnpekaklaferalqldqqcvgaliglavlklnqlepesnk
FBpp0085923  AIDAYSAALAK--------------YPQG--......................................................
FBpp0079893  AIKFYDKAIDK--------------CPKEHRtdm...................................................
FBpp0075683  AVPLCKQALEDLERTSGHD------HPDV--......................................................
FBpp0077614  SAIYHRRAAEL--------------APND--......................................................
FBpp0086749  AYRAYEKGISL------------FKWPNV--......................................................
FBpp0073411  AETCYREAVGIVEQLMLKE------KPHDEEwqelaaik..............................................
FBpp0070908  AEDIFSSTLCA--------------NPDNVEaiglmavlcgqeggceqdsadmdylfakvssevkyt..................
FBpp0085842  AIHLYRRALDFLDNRDG--------DPDSEFdkedlelsnsdtqtlledr...................................
FBpp0077718  ALMYYRRILSL--------------GAQS--......................................................
FBpp0296980  AIKLYQRQLAL--------------ARAAGDrsme..................................................
FBpp0076600  AYWLLKEKARR--------------SP----......................................................
FBpp0086749  ARDIYEEAIQTVTTVRDFT-----------Qvfdeyaqfeelslnrrmeqvaaneaateeddidvelrlsrfeylmerrllllns
FBpp0085479  AIYSFTEGIKT--------------KTDNPDvl....................................................
FBpp0112016  AIHFFCKALEL--------------NSTD--......................................................
FBpp0079665  AFLAYRNSVEK--------------SEGN--......................................................
FBpp0084076  AILHYDKAIIK--------------VKDS--......................................................
FBpp0111406  AMKVYTEAIEN--------------IRDS--......................................................
FBpp0074918  AMDHFEISLEI--------------NNLQ--......................................................
FBpp0082818  ADEVLDAIIAK--------------DETNAAprkrkiailkargrrleaikelneylkkfmsd......................
FBpp0074480  AIKCYRNALKW--------------EKDN--......................................................
FBpp0082819  ADEVLDAIIAK--------------DETNAAprkrkiailkargrrleaikelneylkkfmsd......................
FBpp0085279  AEERFELLKEQLM------------LPSSVQhshvfyqlaklqerrlesglisnftpgaalqaylqvvgisasdid.........
FBpp0081805  AFQCLNKALNI--------------DPRN--......................................................
FBpp0100023  -------------------------------......................................................
FBpp0071879  ALQCFGKILDC--------------NPKN--......................................................
FBpp0084559  AMQYHKHDLTL--------------AKSMNDrlge..................................................
FBpp0075591  ALELFQQSLNL--------------AQR---......................................................
FBpp0076526  AVREYVQEAQI--------------YASMGKeletakakrmvgemytllcdydaakdhindylkiakrlknqveeqrayatlgrv
FBpp0079851  ALKYFQELLSVV-------------DPMDNLlf....................................................
FBpp0072146  AATAFERAVSSLNYCR--------------Mandeeerkqtell.........................................
FBpp0296980  ALKCYERQLEL--------------STDRLAk.....................................................
FBpp0083238  ALQESEKLLRK--------------HPNL--......................................................
FBpp0111383  AKDYYSKGIQY--------------IKDS--......................................................
FBpp0071560  AILLLTHALKT--------------HQRNLDwrteyslfmsgvhvnqrn....................................
FBpp0080424  VVFYLDSALKL--------------APAC--......................................................
FBpp0071879  ALGYFKSVLLI--------------QPQGM-......................................................
FBpp0292775  AIMFFTRAQTF--------------SNAIRIckendfqeelwtvasssrqrdkaiaaayfeecgnfkhavelyhragmlhkalem
FBpp0077934  AYVIFQKALHL--------------DTGN--......................................................
FBpp0087646  AQHCFIQAVVL--------------EKKC--......................................................
FBpp0079665  ALSAYQKYLRF--------------RENNYWtn....................................................
FBpp0086749  VNSAFERALVF--------------MHKM--......................................................
FBpp0082652  AVYFYSKAIQY--------------VADS--......................................................
FBpp0077619  AALYYESALTL--------------PPPEVNerdff.................................................
FBpp0086164  AIALMSPITDG--------------DTVECP......................................................
FBpp0087232  AMMLYTRSYVA--------------LPSENVaei...................................................
FBpp0072561  AAQCFEKVLKI--------------QPGN--......................................................
FBpp0088148  AIEFSHQQLGI--------------SEELDSpnmr..................................................
FBpp0075787  AAHRYQYALRK--------------ISGLEQllernaifaqlr..........................................
FBpp0083319  AVKAVNRILGV--------------APDD--......................................................
FBpp0076499  ALKFCNASLEK--------------SPAN--......................................................
FBpp0290580  AATCYEQLCQL--------------APKE--......................................................
FBpp0080720  AKNLFKEAFDTLINVYGAV------NDAS--......................................................
FBpp0086164  AERICMEIIRQ--------------NPLA--......................................................
FBpp0080741  AQQCLEQIKTQILACTEYRF-----VKLN--......................................................
FBpp0087297  ALRHLQKSAEL--------------NPRN--......................................................
FBpp0070720  -------------------------------......................................................
FBpp0086683  AQRAFEKAITRLKTCK--------------Tssfeqqcrkkdm..........................................
FBpp0289328  AAKWYRIACKR--------------------......................................................
FBpp0070667  ALPCARLAALL--------------APPIFK......................................................
FBpp0082624  AIDVYKRVLVD--------------NKEY--......................................................
FBpp0081552  CIAAGEAVLRN--------------EPEETMir....................................................
FBpp0086749  --EIYEKAIES--------------LPEQNM......................................................
FBpp0087646  AIEAFTRACKLC-------------EPGADR......................................................
FBpp0071879  AIEMLVKVVES--------------ASYHQN......................................................
FBpp0080894  AIELYQALLES--------------DPYR--......................................................
FBpp0070906  AQDHVDKAVNIMQHLVPSNH----------Lmlasakrvkallleeialdkmadgideedlllqseelhnfalllslqvfgevnv
FBpp0087646  ---Y---------------------------......................................................
FBpp0082112  AAKQLMRINNECTQAG--------------Titpqls................................................
FBpp0293629  ATTIHELLINR--------------LPED--......................................................
FBpp0076526  ALTYYQKMLEN--------------AELNQEsgksl.................................................
FBpp0085279  AIETLQMYDRK--------------SEGSMT......................................................
FBpp0074835  -------------------------------......................................................
FBpp0078887  -------AEQT--------------NIKE--......................................................
FBpp0290580  AVQRFQAALQV--------------GGFN--......................................................
FBpp0085047  AEQWISASIEAYDQKSSQTDMELLRGPKL--......................................................
FBpp0296980  AVTVLEAALRI--------------GSCSLKlr....................................................
FBpp0086380  SLKLLYRARYLMVLICGED------HPEV--......................................................
FBpp0083435  -------------------------------......................................................
FBpp0078891  AFHIYQEFCEK--------------FKPT--......................................................
FBpp0082419  -------------------------------......................................................
FBpp0086749  -------------------------------......................................................
FBpp0078027  GMYYFDKALKL--------------GPAD--......................................................
FBpp0088148  -------------------------------......................................................
FBpp0290863  -------------------------------......................................................
FBpp0080720  AEKIFTDVMKRLFAEGHTEE-----SPKI--......................................................
FBpp0083319  ASSIYADCLRH--------------KPKDAAlvavasnnlvvvnkdqnvfdskkkiraaladacesrltsrqkqvialnncllal
FBpp0071288  -------------------------------......................................................
FBpp0081398  AREDYEKALKI--------------HGELPTrnrral................................................
FBpp0085016  SLEWLQVAFILLRNSP--------------Reekdadhyl.............................................
FBpp0293235  AIEYLNGYLRV--------------RDD---......................................................
FBpp0290580  AEREFHASAEF--------------CSEN--......................................................
FBpp0085012  ------------------------------Tqsftk.................................................
FBpp0086380  GYELISGALNLLNNVFGAL------HQEN--......................................................
FBpp0071879  -------------------------------......................................................
FBpp0076961  AQKYFDKCITE--------------NESTD-......................................................
FBpp0075717  ALMAANLAVMR--------------APDRNAdpvldegltl............................................
FBpp0080267  ASDLFTEAIFL--------------APARNTlaa...................................................
FBpp0070908  ALRHFDEIIHKRRLMMRHKNAVLVAIESSYPefgdaeqrrraaecyrqigntdmaietllqvpptlrsprinlmlarlqhhgsrh
FBpp0085033  AIQWLQEVPQR--------------LQEELLiqprhlpike............................................
FBpp0082507  ARQHLEKAWSI--------------SEPLPNfdvk..................................................
FBpp0292775  AKDLYRRCKRF--------------DLLN--......................................................
FBpp0085676  ALHYLNKALAL--------------EPTD--......................................................
FBpp0087091  ALELYNKSICY--------------AEPNSEhl....................................................
FBpp0082624  VLVYMNSIRSY--------------FVND--......................................................
FBpp0070431  ALDYGQRLLPGFRKYHGPW------NPLL--......................................................
FBpp0075442  AVALYDQLIAP--------------SPGQGSggqsagsraqkdqq........................................
FBpp0070906  ANLLICQAVRRAREYFGPT------HQKY--......................................................
FBpp0089265  ALSALHRALDR--------------SPVRLMsqekgy................................................
FBpp0078634  GLEILLEAEKI--------------YEDFKAsglkplaiqdvfnppeegqqsheagpkelesly.....................
FBpp0075754  -------------------------------......................................................
FBpp0087625  ACRLYSEAVFE--------------AENAVEel....................................................
FBpp0071288  ----YREALAK--------------FNHD--......................................................
FBpp0110159  AEQWILAGIKAQDRKGPQTEMILLRGPTK--......................................................
FBpp0072679  AEKLYLDADRR--------------DLAIELrmtlcdwfrvvqlyrmggsgvsdqqm............................
FBpp0082624  -------------------------------......................................................
FBpp0084254  ALLILLEADEL--------------FSQCDSkllegvdny.............................................
FBpp0085032  AASWIYQSVVL--------------MEAFSMaapleisk..............................................

d2fbna1        .....................................................................................
FBpp0112455  .....................................................................................
FBpp0070351  gpsklrdlqqiyleavrqhpsevd.............................................................
FBpp0070402  .....................................................................................
FBpp0080138  .....................................................................................
FBpp0074609  .....................................................................................
FBpp0084171  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  skysqianaepei........................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0085344  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0072561  dkekerkhqekalaifkqvlrndprniwatngigavlahkgcvieardifaqvreatadf.........................
FBpp0072561  lgvqmlskaytidnanpmvlnhlanhfffkkdyqkvhhlalhafhnteneamr................................
FBpp0085923  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0086749  vllrqnphnvhewhkrvtlyedkpaeiistyteavqtvqpkqavgkl......................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  .....................................................................................
FBpp0082819  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0081805  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  hllhgqsladssasgsmeqlklaeknflrslllikdlsgqiskleqldmq...................................
FBpp0079851  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0292775  afesqqpeileiiasdlapdsd...............................................................
FBpp0077934  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0087232  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076499  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  .....................................................................................
FBpp0086683  .....................................................................................
FBpp0289328  .....................................................................................
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0070906  qt...................................................................................
FBpp0087646  .....................................................................................
FBpp0082112  .....................................................................................
FBpp0293629  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085047  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  ytnagdqvqqlsqklaqtypqve..............................................................
FBpp0071288  .....................................................................................
FBpp0081398  .....................................................................................
FBpp0085016  .....................................................................................
FBpp0293235  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  .....................................................................................
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070908  gttkkseavlaykevirecpmalqvieallelgvngneinslvmhaatvpdhfdwlskwikalaqmfnfkhsdasqtflmlhdnt
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075442  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0089265  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................

                      70        80                                                                  
                       |         |                                                                  
d2fbna1        .....ISCNLNLATCYNKN...K...D..........................................................
FBpp0112455  .....TLVYVQYMKFARRA...E...G..........................................................
FBpp0070351  .....AEVQDALGVLYNLS...G...E..........................................................
FBpp0070402  .....VTLWLKYAEMEMKN...K...Q..........................................................
FBpp0080138  .....--------------...-...-..........................................................
FBpp0074609  .....AKHHQSIAEMYESDp..N...N..........................................................
FBpp0084171  .....-----------VKA...T...D..........................................................
FBpp0085420  .....AAAHSNLASVLQQQ...G...K..........................................................
FBpp0085420  .....AVAWSNLGCVFNAQ...G...E..........................................................
FBpp0077790  .....ITFYNNIAAVHFER...K...E..........................................................
FBpp0082545  .....ESALMNLGNLYREH...G...Q..........................................................
FBpp0084691  .....LQLSYRRINVERRR...G...A..........................................................
FBpp0072096  .....EEYANKSASLYQQH...G...S..........................................................
FBpp0071560  .....ADIYYNLGVVFLEQ...G...K..........................................................
FBpp0077790  .....PKLYSNRAACYTKL...A...A..........................................................
FBpp0076600  .....YNAWYGIGTIYSKQ...E...K..........................................................
FBpp0271716  .....--------------...N...D..........................................................
FBpp0077790  .....HVLYSNRSAAFAKA...G...K..........................................................
FBpp0290896  .....AVAYLNLGTSLISL...G...Dhrqeaisvlrtgarlegsgvrdrgahvearytcylqlsvlyrsdgrlqdaaaalresl
FBpp0081673  .....VEDYANRACCLYQQh..G...S..........................................................
FBpp0077614  .....ADVHFNLGILHQNQ...Q...V..........................................................
FBpp0084691  .....--GWTYLLQYVDNE...S...D..........................................................
FBpp0296980  .....HILYSNRSAALLKQ...G...Q..........................................................
FBpp0080535  .....PIFYCNRAAAHIRL...G...E..........................................................
FBpp0296980  .....ACALLNLGNCLSGR...Q...E..........................................................
FBpp0072164  .....PIYHINRALCYLKQ...E...S..........................................................
FBpp0084016  .....IPCIVSFAKLYAKH...D...N..........................................................
FBpp0296980  .....AREIGNVGAVYLAL...G...E..........................................................
FBpp0296980  .....ERAYRGLGQARRAL...G...Q..........................................................
FBpp0080894  .....LAAWTLMGHEFMEL...K...N..........................................................
FBpp0081606  .....AIYYANRSLAHLRQ...E...S..........................................................
FBpp0084559  .....RRANSNLGNSHIFL...G...Q..........................................................
FBpp0075683  .....AKQLNNLALLCQNQ...G...K..........................................................
FBpp0081284  .....AVFYKNRAAAYLKL...G...K..........................................................
FBpp0079468  .....VATHSNIALCHQKS...N...D..........................................................
FBpp0087297  .....AELWNNIGLCFFKK...Q...K..........................................................
FBpp0074835  .....IPLWILSANLEERK...G...V..........................................................
FBpp0079893  .....VECYSLTAQVLADQ...Q...Q..........................................................
FBpp0082765  .....AVLYGNRAAAKIKL...E...A..........................................................
FBpp0079617  .....ATYFTNRALCNLKL...K...R..........................................................
FBpp0084440  .....VHAYNNRAVAHLKL...K...K..........................................................
FBpp0080424  .....AAYYGNRAACYMML...L...N..........................................................
FBpp0085344  .....HQIMFMRGQVHVYL...E...Q..........................................................
FBpp0081552  .....YLTLFKRGTVYLAL...G...K..........................................................
FBpp0087646  .....IRLQYKLGLHFSHV...K...K..........................................................
FBpp0083769  .....EPLFINLGHSLRKV...H...K..........................................................
FBpp0070572  .....ALFHAKRGQAFLKL...K...K..........................................................
FBpp0070575  .....ALFHAKRGQAFLKL...K...K..........................................................
FBpp0074835  .....EDIWLAAVKLESEN...S...E..........................................................
FBpp0080424  .....SKLLYNRALVNTRI...G...N..........................................................
FBpp0076113  .....VVNNINAAAVDLKV...G...N..........................................................
FBpp0072561  .....CDVWLNIAHVYVEQ...K...Q..........................................................
FBpp0072561  .....AESCYQLARSFHAQ...S...D..........................................................
FBpp0085923  .....EVLYLNRATALMRR...GwfgD..........................................................
FBpp0079893  .....AIFYQNRAASYEML...K...K..........................................................
FBpp0075683  .....ATMLNILALVYRDQ...N...K..........................................................
FBpp0077614  .....YTLVVAAATAMRLL...D...R..........................................................
FBpp0086749  .....YDIWNSYLTKFLERyggT...K..........................................................
FBpp0073411  .....TPLLLNYAQCRLIA...G...D..........................................................
FBpp0070908  .....ASHWFAHAQLLYDE...G...K..........................................................
FBpp0085842  .....LIVYNNLAMTQIKI...A...A..........................................................
FBpp0077718  .....PELYCNIALCCLYG...G...Q..........................................................
FBpp0296980  .....AAACGALGLAHRLM...R...R..........................................................
FBpp0076600  .....-QCRFLQAKCAYEL...K...K..........................................................
FBpp0086749  .....HTLWVEFAKFYEAN...G...Q..........................................................
FBpp0085479  .....AVLYNNRSAAHFFI...K...N..........................................................
FBpp0112016  .....INALISRSKCYLLL...G...E..........................................................
FBpp0079665  .....ADTWCSIGVLYQQQ...N...Q..........................................................
FBpp0084076  .....AITYCNRALCYIKL...Q...N..........................................................
FBpp0111406  .....HILYINRALCFIKS...G...K..........................................................
FBpp0074918  .....EAILLRCGYCAIQL...E...R..........................................................
FBpp0082818  .....QEAWHELCNMYLAE...G...E..........................................................
FBpp0074480  .....--------------...-...-..........................................................
FBpp0082819  .....QEAWHELCNMYLAE...G...E..........................................................
FBpp0085279  .....SRLFEKVGSLYEQI...Q...D..........................................................
FBpp0081805  .....VEALVARGALYANR...G...S..........................................................
FBpp0100023  .....-----MLGLMYLFL...K...D..........................................................
FBpp0071879  .....LWAANGIGAVLSSC...N...N..........................................................
FBpp0084559  .....AKSSGNLGNTLKVM...G...R..........................................................
FBpp0075591  .....ASVLNNRAQTLRLA...K...R..........................................................
FBpp0076526  .....ARCYLNIGVVKEHM...E...A..........................................................
FBpp0079851  .....KLSFLRLGQLALQR...K...Q..........................................................
FBpp0072146  .....TTLNQNLMIVYNKM...N...K..........................................................
FBpp0296980  .....AMACLALGRVHHQL...E...Q..........................................................
FBpp0083238  .....LCARALKGLSLLRL...G...R..........................................................
FBpp0111383  .....PVLYVNRALCFIKL...R...E..........................................................
FBpp0071560  .....AKLYNNVGHALENE...G...K..........................................................
FBpp0080424  .....LKYRLLKAECLAFL...G...R..........................................................
FBpp0071879  .....ADVWVGIGHCFWKM...G...E..........................................................
FBpp0292775  .....AELINRCADFFCSI...E...Q..........................................................
FBpp0077934  .....TMILNNMGVCLLYA...G...K..........................................................
FBpp0087646  .....YTAWTNLGVLYIKL...N...E..........................................................
FBpp0079665  .....HAFIYGIGVAYFKL...R...C..........................................................
FBpp0086749  .....PRIWMDYGAFMTSQ...C...K..........................................................
FBpp0082652  .....PVLYCNRALAKIKK...R...D..........................................................
FBpp0077619  .....EVSRLRLGYISYEL...G...N..........................................................
FBpp0086164  .....AFVWLRQAECLRQL...N...R..........................................................
FBpp0087232  .....RVVLANRSATLYHM...Q...K..........................................................
FBpp0072561  .....YETMKILGSLYAHS...NsqtK..........................................................
FBpp0088148  .....AETYLNLSRAHASL...G...G..........................................................
FBpp0075787  .....TNLLLNLSRCKRKL...N...E..........................................................
FBpp0083319  .....PTALHCKVVCLVQL...S...K..........................................................
FBpp0076499  .....FKSLCLRAEVLLKL...S...H..........................................................
FBpp0290580  .....AKYRFYYAQSLYQA...G...I..........................................................
FBpp0080720  .....VTILNNISVAYVNL...E...K..........................................................
FBpp0086164  .....SEPFYTLAEIYENR...D...E..........................................................
FBpp0080741  .....IKYYLIQGQCSEIF...E...H..........................................................
FBpp0087297  .....IETYKEIGRTLYIM...G...R..........................................................
FBpp0070720  .....--------------...-...-..........................................................
FBpp0086683  .....LIALFESLMICFNK...M...R..........................................................
FBpp0289328  .....--------------...-...-..........................................................
FBpp0070667  .....DIPLLSLGTILFRM...G...R..........................................................
FBpp0082624  .....QAINVYLALCFYKL...D...Y..........................................................
FBpp0081552  .....YEGHKVLCTCYTGD...E...Q..........................................................
FBpp0086749  .....RHMCVKFAELETKL...G...E..........................................................
FBpp0087646  .....DKLYTNLGYLYLKI...D...Q..........................................................
FBpp0071879  .....TNSWLNLAFAYEQK...R...L..........................................................
FBpp0080894  .....LDNVDTYSNLLFVK...E...M..........................................................
FBpp0070906  .....AKHYGNLGRLYQTM...N...R..........................................................
FBpp0087646  .....--------------...-...-..........................................................
FBpp0082112  .....TCIANNMGVIHLRV...R...H..........................................................
FBpp0293629  .....PRLRNQLSLTYLMV...N...N..........................................................
FBpp0076526  .....VPIYVSLYQTYRDN...G...Q..........................................................
FBpp0085279  .....ASALTNLSFIYIKM...A...Shcvnqlheigslknnapglinagivelgshn...........................
FBpp0074835  .....--------------...E...N..........................................................
FBpp0078887  .....ALGALRMAQDLYLA...G...K..........................................................
FBpp0290580  .....PLVAYNVALAHFQK...K...Q..........................................................
FBpp0085047  .....ADLCRILGQVQMKQ...R...N..........................................................
FBpp0296980  .....GSVFSALSSAHWAL...N...Q..........................................................
FBpp0086380  .....ALIDSNISLILHAL...G...E..........................................................
FBpp0083435  .....IQIQTNLAACLLQE...K...R..........................................................
FBpp0078891  .....PALLNGQAVVHLGL...E...R..........................................................
FBpp0082419  .....-----------VML...K...D..........................................................
FBpp0086749  .....--------------...-...-..........................................................
FBpp0078027  .....FTTLYRRSQSKRKN...A...Q..........................................................
FBpp0088148  .....--ALLRMAVSLRKQ...G...E..........................................................
FBpp0290863  .....----SDWAMFFFTQ...Q...R..........................................................
FBpp0080720  .....LHISSKIAHMSQLQ...G...D..........................................................
FBpp0083319  .....FEALLIRCTQLAKD...R...K..........................................................
FBpp0071288  .....--------------...-...-..........................................................
FBpp0081398  .....AELHYKIGLTYLMQ...Q...-..........................................................
FBpp0085016  .....SDIREYASMANFEL...G...N..........................................................
FBpp0293235  .....AVGHNMIATCYSRL...Npp.D..........................................................
FBpp0290580  .....SIWRLNAGHVLFMQ...Gd..K..........................................................
FBpp0085012  .....ADILEYLAFSTYKE...G...N..........................................................
FBpp0086380  .....GSCLRMLARLSYLL...G...D..........................................................
FBpp0071879  .....------SAHIALVS...G...Q..........................................................
FBpp0076961  .....HKALYLRSKFKRSV...A...L..........................................................
FBpp0075717  .....ALAYRSRASILIRL...G...E..........................................................
FBpp0080267  .....ALAHANRSLVLFDC...G...L..........................................................
FBpp0070908  tlrcnEHLMMALGKCLYYN...G...D..........................................................
FBpp0085033  .....VDALRLLAEAQIKD...Q...N..........................................................
FBpp0082507  .....FDTASLLAQLHLQT...Dr..N..........................................................
FBpp0292775  .....--------KLLQSI...G...H..........................................................
FBpp0085676  .....HMTLYKRCQSKRKA...A...Q..........................................................
FBpp0087091  .....SIGYANRSAVLFEW...K...R..........................................................
FBpp0082624  .....DVFNYNFAQAKCAT...G...Y..........................................................
FBpp0070431  .....GLLHMKLGKIQLYE...G...H..........................................................
FBpp0075442  .....IACLLGRCECLLEL...G...K..........................................................
FBpp0070906  .....GDALLDYGFFLLNV...D...S..........................................................
FBpp0089265  .....QYFCVNLAVLHATF...G...H..........................................................
FBpp0078634  .....TLVSFYMAQMYGHL...G...E..........................................................
FBpp0075754  .....---------VHSLL...G...D..........................................................
FBpp0087625  .....SLAFANRGIALQEY...G...Y..........................................................
FBpp0071288  .....RRLWSNWI-KFSRK...S...N..........................................................
FBpp0110159  .....AELFRTLGKVRFER...R...N..........................................................
FBpp0072679  .....EIAWREIGHHFANL...R...S..........................................................
FBpp0082624  .....------IAFCNFHL...G...D..........................................................
FBpp0084254  .....ALINLDIVWCYLRL...K...N..........................................................
FBpp0085032  .....NEVRMVYAETLLKL...N...Q..........................................................

d2fbna1        .....................................................................................
FBpp0112455  .....................................................................................
FBpp0070351  .....................................................................................
FBpp0070402  .....................................................................................
FBpp0080138  .....................................................................................
FBpp0074609  .....................................................................................
FBpp0084171  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0290896  kalpllpqkqravlhlrlgeilaelqdwneaehqqrlamqlqpeqgaayvtygqtlarngsrlaeaeswfkralqlaplepsshh
FBpp0081673  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0085344  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  .....................................................................................
FBpp0082819  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0081805  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0087232  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076499  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  .....................................................................................
FBpp0086683  .....................................................................................
FBpp0289328  .....................................................................................
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0082112  .....................................................................................
FBpp0293629  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085047  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0081398  .....................................................................................
FBpp0085016  .....................................................................................
FBpp0293235  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  .....................................................................................
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075442  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0089265  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................

d2fbna1        .............................................YPKAIDHASKVLK.I.........................
FBpp0112455  .............................................IKSARSIFKKARE.D.........................
FBpp0070351  .............................................FDKAVDCYQSALQ.V.........................
FBpp0070402  .............................................VNHARNLWDRAVT.I.........................
FBpp0080138  .............................................---VAKYYLEAFK.L.........................
FBpp0074609  .............................................LAKSIQHYEQAAD.Y.........................
FBpp0084171  .............................................YMEAARYYQRAQE.L.........................
FBpp0085420  .............................................LKEALMHYKEAIR.I.........................
FBpp0085420  .............................................IWLAIHHFEKAVT.L.........................
FBpp0077790  .............................................YEECIKQCEKGIE.V.........................
FBpp0082545  .............................................LSTAEEYIRLALQ.A.........................
FBpp0084691  .............................................LDKCRELYKHYIE.S.........................
FBpp0072096  .............................................PEAAASALDKAAK.Ltesk.....................
FBpp0071560  .............................................SQQAQVYFNKAIE.L.........................
FBpp0077790  .............................................FDLGLKDCDTCIK.L.........................
FBpp0076600  .............................................YELAEIHYVKALK.I.........................
FBpp0271716  .............................................VRKGIMILEELAR.T.........................
FBpp0077790  .............................................FQEALEDAEKTIQ.L.........................
FBpp0290896  hyadfleqqerhhealglrlraaalapqdytlqscvadalrllnrLAEAELWYRKAVT.L.........................
FBpp0081673  .............................................PEAAAAALDKAAK.Mtesk.....................
FBpp0077614  .............................................YPAAVECFQRAIK.F.........................
FBpp0084691  .............................................AEAAREAYDTFLS.H.........................
FBpp0296980  .............................................FTAALQDATQARD.L.........................
FBpp0080535  .............................................NERAVTDCKSALV.Y.........................
FBpp0296980  .............................................YEEAVPHYESYLM.L.........................
FBpp0072164  .............................................FDQCVEDCEAAIA.L.........................
FBpp0084016  .............................................NDMAQTLLDDVVT.S.........................
FBpp0296980  .............................................CEAALDCHSQHLR.L.........................
FBpp0296980  .............................................LPAALVCLEKRLV.V.........................
FBpp0080894  .............................................TNAAIQSYRKAVE.V.........................
FBpp0081606  .............................................FGFALQDGVSAVK.A.........................
FBpp0084559  .............................................FEDAAEHYKRTLA.L.........................
FBpp0075683  .............................................YDEVEKYYQRALD.Iyesklgpd.................
FBpp0081284  .............................................YENAVEDCTESLK.A.........................
FBpp0079468  .............................................HFEAKQECNEVLA.L.........................
FBpp0087297  .............................................FIVAISSLRKSVW.L.........................
FBpp0074835  .............................................LTKARSILERGRL.R.........................
FBpp0079893  .............................................FTQAEEYYKKAMV.L.........................
FBpp0082765  .............................................NKAAIDDCTKAIE.L.........................
FBpp0079617  .............................................WELCCQDSRRALD.I.........................
FBpp0084440  .............................................YFSAISDCQACLQ.I.........................
FBpp0080424  .............................................YNSALTDARHAIR.I.........................
FBpp0085344  .............................................WFDAKQCFLNAVA.A.........................
FBpp0081552  .............................................TRFAVQDFSRVLE.L.........................
FBpp0087646  .............................................WDSAIQCFRIAIK.N.........................
FBpp0083769  .............................................YEEALYNFQYALL.L.........................
FBpp0070572  .............................................PNACIRDCDVALE.L.........................
FBpp0070575  .............................................PNACIRDCDVALE.L.........................
FBpp0074835  .............................................YERARRLLAKARG.S.........................
FBpp0080424  .............................................LREAVADCNRVLE.L.........................
FBpp0076113  .............................................YTSAREVCNEAIR.L.........................
FBpp0072561  .............................................YISAIQMYENCMK.Kfy.......................
FBpp0072561  .............................................YDQAFQYYYQSTQ.I.........................
FBpp0085923  .............................................IYAALRDCHEALR.L.........................
FBpp0079893  .............................................WSNVKEDCTASLE.F.........................
FBpp0075683  .............................................YKEAANLLNDALS.Irgktlgen.................
FBpp0077614  .............................................KVDAEMWYRKAVA.L.........................
FBpp0086749  .............................................LERARDLFEQCLD.Q.........................
FBpp0073411  .............................................FYAVIEHCNEVLT.L.........................
FBpp0070908  .............................................FERGLNFVEKCLD.S.........................
FBpp0085842  .............................................YDAALQSVEHVLR.C.........................
FBpp0077718  .............................................IDLVLPCFQRALA.Tat.......................
FBpp0296980  .............................................WDKALGHHTQELT.L.........................
FBpp0076600  .............................................YAEAESALISTGF.A.........................
FBpp0086749  .............................................VEDARVVFERGTE.Veyvk.....................
FBpp0085479  .............................................YRSSLSDAQRALF.Y.........................
FBpp0112016  .............................................ASKALQDAETALG.E.........................
FBpp0079665  .............................................PTDALQAYICAVQ.L.........................
FBpp0084076  .............................................YKRALKDCQYVLE.Kl........................
FBpp0111406  .............................................FKRGIVDCDFVLN.Kl........................
FBpp0074918  .............................................WEPAVKYYLAYTH.L.........................
FBpp0082818  .............................................FGKAAFCMEEVLL.H.........................
FBpp0074480  .............................................-------------.-.........................
FBpp0082819  .............................................FGKAAFCMEEVLL.H.........................
FBpp0085279  .............................................HQEANQYYNEAYR.I.........................
FBpp0081805  .............................................FLKGLQDFEKALH.L.........................
FBpp0100023  .............................................YNQSENWLELALY.H.........................
FBpp0071879  .............................................LSAGGAIFKQIIE.C.........................
FBpp0084559  .............................................FDEAAICCERHLT.L.........................
FBpp0075591  .............................................DEEALDDLNKALE.L.........................
FBpp0076526  .............................................FQESIEYIDKAIK.I.........................
FBpp0079851  .............................................YELAEKAFNICLP.A.........................
FBpp0072146  .............................................PKRACIMMKALRH.L.........................
FBpp0296980  .............................................HNQAVDYLRQGLA.S.........................
FBpp0083238  .............................................YDESHGCLQTVAE.E.........................
FBpp0111383  .............................................FKLGIIDCDYVLA.Ki........................
FBpp0071560  .............................................FEEALLYFQQAVR.I.........................
FBpp0080424  .............................................CDEALDIAVSVMK.L.........................
FBpp0071879  .............................................LEKAQLSFQIALE.H.........................
FBpp0292775  .............................................FQKAVHLLAKTRH.Leralgicsekgvpvteelsemltpe
FBpp0077934  .............................................LKDAINLYERAIN.L.........................
FBpp0087646  .............................................VRLANEAFTRAQQ.S.........................
FBpp0079665  .............................................FKWAIKSFQELLY.L.........................
FBpp0086749  .............................................ITRTRHVFDRALR.A.........................
FBpp0082652  .............................................FKLALFDLDYVIFnL.........................
FBpp0077619  .............................................YNKCIEALSFPFA.G.........................
FBpp0086164  .............................................TNEAIQSYEKVVQ.L.........................
FBpp0087232  .............................................YQECLIDIKRALD.L.........................
FBpp0072561  .............................................RDMAKTHLKKVTE.Q.........................
FBpp0088148  .............................................LERSLSYARHSLY.N.........................
FBpp0075787  .............................................LDASIDLATQAIA.Q.........................
FBpp0083319  .............................................FEEAYKFIEK---.-.........................
FBpp0076499  .............................................YQSSLADIENALR.T.........................
FBpp0290580  .............................................FADALRVLKQMGD.Qedelreqclqlqsailys.......
FBpp0080720  .............................................YAEARETLLEAME.L.........................
FBpp0086164  .............................................VK-FLNFSTLAAH.L.........................
FBpp0080741  .............................................VEKATSCYKRALR.L.........................
FBpp0087297  .............................................FSQALGVFREAEQ.Rs........................
FBpp0070720  .............................................-------------.-.........................
FBpp0086683  .............................................QSRCVCYVMKELR.Llti......................
FBpp0289328  .............................................-------------.-.........................
FBpp0070667  .............................................LADADLILTAAVE.H.........................
FBpp0082624  .............................................YDMSQEVLDVYLS.Q.........................
FBpp0081552  .............................................FGKALQQCKEALD.I.........................
FBpp0086749  .............................................VDRARAIYAHCSQ.V.........................
FBpp0087646  .............................................PEQAAHALNTVAH.-.........................
FBpp0071879  .............................................WAHGVNAYQKAID.I.........................
FBpp0080894  .............................................KTEMAQLAHKAVS.I.........................
FBpp0070906  .............................................FEEAERMHKKAIK.I.........................
FBpp0087646  .............................................-------------.-.........................
FBpp0082112  .............................................YAIAAKFFQNALN.F.........................
FBpp0293629  .............................................LQQVEKVAVETLK.L.........................
FBpp0076526  .............................................FDKALEYLWKEFE.L.........................
FBpp0085279  .............................................LILASERFEGALQ.L.........................
FBpp0074835  .............................................PDDARILLSRAVE.C.........................
FBpp0078887  .............................................DDKAARLFEHALA.L.........................
FBpp0290580  .............................................RAQALDYTSEIVE.Rgmrnhp...................
FBpp0085047  .............................................HEGALQAYQVALK.L.........................
FBpp0296980  .............................................LDQAIGYMQQDLA.V.........................
FBpp0086380  .............................................YELSLRFIEHALK.L.........................
FBpp0083435  .............................................YEHVIYHTQFVET.E.........................
FBpp0078891  .............................................YEEADSVLRESLL.K.........................
FBpp0082419  .............................................YKKALKYCKLILQ.Y.........................
FBpp0086749  .............................................-------------.-.........................
FBpp0078027  .............................................ADGALKDSLEAKR.L.........................
FBpp0088148  .............................................LGDAQDYCKEATK.Lslisgd...................
FBpp0290863  .............................................YANGLRYFNSALD.L.........................
FBpp0080720  .............................................LEKSFQGFTWTLQ.Qlakllekmp................
FBpp0083319  .............................................HKEAIEQLQKFAA.A.........................
FBpp0071288  .............................................----------I--.-.........................
FBpp0081398  .............................................-------------.-.........................
FBpp0085016  .............................................PKKAARLLSQILE.S.........................
FBpp0293235  .............................................VTEALQHYQRSIQ.I.........................
FBpp0290580  .............................................YNEAAAFYEPIVR.Q.........................
FBpp0085012  .............................................IESALTMTNELLQ.L.........................
FBpp0086380  .............................................AQDALAIQQRAVI.Mservngmd.................
FBpp0071879  .............................................YRLAIQTYERCLK.Dh........................
FBpp0076961  .............................................TQDALEDSLRAME.V.........................
FBpp0075717  .............................................GEAALNDLKLAIN.Fgle......................
FBpp0080267  .............................................YAESYDDCLCALD.Lgyp......................
FBpp0070908  .............................................YFQAEDIFSSTLC.A.........................
FBpp0085033  .............................................YSEALPLLHNCLK.L.........................
FBpp0082507  .............................................SHQAKAMLRRAVE.L.........................
FBpp0292775  .............................................LDEAVELAEAEDR.I.........................
FBpp0085676  .............................................MLGALDDSRAAAK.L.........................
FBpp0087091  .............................................YRQCLDNIKLARQ.-.........................
FBpp0082624  .............................................YKEAEELLMQISD.M.........................
FBpp0070431  .............................................SKEALHHLEEAQR.I.........................
FBpp0075442  .............................................FEGCLADAYKVLT.L.........................
FBpp0070906  .............................................VFQSVNIYKEALA.V.........................
FBpp0089265  .............................................RDEALAALRESIM.L.........................
FBpp0078634  .............................................PEKSAKCCHRTLH.Rqleskty..................
FBpp0075754  .............................................YYQAIKVLEP-IE.I.........................
FBpp0087625  .............................................YREAYDDCSNALE.Cg........................
FBpp0071288  .............................................PVEVAGIYEKMLL.Y.........................
FBpp0110159  .............................................EEGALKAYQAALK.H.........................
FBpp0072679  .............................................WESAREYYEKSHY.L.........................
FBpp0082624  .............................................YQQALAQYKAIQQ.G.........................
FBpp0084254  .............................................ITQ-LPDAQRRLD.Icergfvksygeqfirlfsik.....
FBpp0085032  .............................................HADALKVVNIALT.D.........................

                       100                                                                      110 
                         |                                                                        | 
d2fbna1        .....DK..NN..............................................................VKALYKLG.VA.
FBpp0112455  .....VR..SR..............................................................YHIFVAAA.LMe
FBpp0070351  .....DP..QN..............................................................AKTWNRLG.AS.
FBpp0070402  .....MP..RV..............................................................NQFWYKYT.YM.
FBpp0080138  .....NP..AI..............................................................GMAQNQLG.TL.
FBpp0074609  .....FK..GEesvssa........................................................NKCMLKVA.QY.
FBpp0084171  .....VP..GN..............................................................GAPFNQLA.VI.
FBpp0085420  .....QP..TF..............................................................ADAYSNMG.NT.
FBpp0085420  .....DP..NF..............................................................LDAYINLG.NV.
FBpp0077790  .....GR..ESradfkli.......................................................AKSFARIG.NT.
FBpp0082545  .....YP..AF..............................................................PAAWMNLG.IV.
FBpp0084691  .....TK..NKgiag..........................................................SLAIKYAR.FL.
FBpp0072096  .....HP..DMalrfyqhalevimiedsvrqa.........................................AEYASKVS.RI.
FBpp0071560  .....--..--..............................................................--------.--.
FBpp0077790  .....DE..KF..............................................................IKGYIRKG.KI.
FBpp0076600  .....NP..QN..............................................................SVILVHIG.AM.
FBpp0271716  .....HP..DGr.............................................................RDYIYYLA.FG.
FBpp0077790  .....NP..TW..............................................................PKGYSRKG.AA.
FBpp0290896  .....QP..MA..............................................................AHAHANLG.AI.
FBpp0081673  .....HP..DL..............................................................ALGFYKRA.LA.
FBpp0077614  .....RP..NL..............................................................AVAYLNLG.IS.
FBpp0084691  .....YP..YC..............................................................YGYWRKYA.DY.
FBpp0296980  .....CP..QW..............................................................PKAYFRQG.VA.
FBpp0080535  .....NN..NY..............................................................SKAYCRLG.VA.
FBpp0296980  .....AQ..ELgdvaae........................................................GKACHLLG.YA.
FBpp0072164  .....DK..LC..............................................................VKAYYRRM.QA.
FBpp0084016  .....YP..KR..............................................................IDIWSVYV.DM.
FBpp0296980  .....AR..KLhdqvee........................................................ARAYSNLG.SA.
FBpp0296980  .....AH..ELhspeik........................................................ALAYGDLG.HV.
FBpp0080894  .....NK..RD..............................................................YRAWYGLG.QA.
FBpp0081606  .....DP..AY..............................................................LKGYYRRA.AA.
FBpp0084559  .....AV..ELgereve........................................................AQSCYSLG.NT.
FBpp0075683  .....DP..NV..............................................................AKTKNNLA.GC.
FBpp0081284  .....AP..GD..............................................................PKALFRRA.QA.
FBpp0079468  .....DK..NN..............................................................VKALYRRG.QC.
FBpp0087297  .....SP..LN..............................................................YNALYNLS.LI.
FBpp0074835  .....NP..KV..............................................................AVLWLEAI.RV.
FBpp0079893  .....AP..TN..............................................................PALIVHQAiMV.
FBpp0082765  .....WP..EY..............................................................VRVLLRRA.KL.
FBpp0079617  .....DG..NL..............................................................LKGHFFLG.QG.
FBpp0084440  .....DP..MN..............................................................IKAHLRMA.EA.
FBpp0080424  .....DP..GF..............................................................EKAYVRVA.KC.
FBpp0085344  .....NP..NH..............................................................TEALRALG.EA.
FBpp0081552  .....KP..DF..............................................................MAARIQRG.VV.
FBpp0087646  .....DS..RC..............................................................ISYWESLG.DA.
FBpp0083769  .....KP..QS..............................................................PTTYTSIG.FI.
FBpp0070572  .....NS..DL..............................................................AAGYKFRG.RA.
FBpp0070575  .....NS..DL..............................................................AAGYKFRG.RA.
FBpp0074835  .....AP..T-..............................................................PRVMMKSA.RL.
FBpp0080424  .....NS..QY..............................................................LKALLLRA.RC.
FBpp0076113  .....DP..KC..............................................................SKAFYRRA.QA.
FBpp0072561  .....KH..NN..............................................................VEVMQYLA.RA.
FBpp0072561  .....AP..ANf.............................................................VLPHYGLG.QM.
FBpp0085923  .....DP..SY..............................................................VKAHFRLA.RA.
FBpp0079893  .....NP..RY..............................................................AKAYYRRA.RA.
FBpp0075683  .....HP..AV..............................................................AATLNNLA.VL.
FBpp0077614  .....RP..GD..............................................................AHAHTNLG.AI.
FBpp0086749  .....CP..PEha............................................................KYFYLLYA.KL.
FBpp0073411  .....DP..RN..............................................................VKALFRRA.KA.
FBpp0070908  .....EP..RN..............................................................HEALILRG.RL.
FBpp0085842  .....QP..NN..............................................................SKALYRKG.RI.
FBpp0077718  .....QP..GQk.............................................................SDIWYNLS.FV.
FBpp0296980  .....RQ..ELgdlsge........................................................CRAHGHLG.AV.
FBpp0076600  .....DA..KNcdelqrdfgdla..................................................CFAYQLMA.QI.
FBpp0086749  .....VE..DL..............................................................AAVWCEWA.EM.
FBpp0085479  .....KP..DY..............................................................TKARWRSA.QC.
FBpp0112016  .....DK..NN..............................................................IRAIYQKA.ES.
FBpp0079665  .....DK..DH..............................................................KAAWTNLG.IL.
FBpp0084076  .....QE..SN..............................................................LRAWLYQA.HA.
FBpp0111406  .....DE..KN..............................................................LRAWMYRA.MA.
FBpp0074918  .....EP..NG..............................................................FESWNNLA.KA.
FBpp0082818  .....NP..HS..............................................................HLIHQRLA.EI.
FBpp0074480  .....--..--..............................................................LQILKDLS.LL.
FBpp0082819  .....NP..HS..............................................................HLIHQRLA.EI.
FBpp0085279  .....NM..SD..............................................................IGIASSIG.SY.
FBpp0081805  .....NK..YHvnarkym.......................................................GETLVALG.RS.
FBpp0100023  .....YD..DNvspevlkiklwny.................................................PNLLESLV.EA.
FBpp0071879  .....GN..KC..............................................................IPAIINSA.HI.
FBpp0084559  .....AR..QLgdrlse........................................................GRALYNLG.NV.
FBpp0075591  .....AN..DQqtrtk.........................................................CHAHCQRG.VL.
FBpp0076526  .....SK..THelwdlt........................................................HLCYISMS.LL.
FBpp0079851  .....RR..KN..............................................................FIANYGMG.LT.
FBpp0072146  .....TM..GNps............................................................CKALFQEG.RA.
FBpp0296980  .....AQ..TTgkseee........................................................AKIRHQLG.LA.
FBpp0083238  .....KP..TD..............................................................DSTLQVLS.FC.
FBpp0111383  .....DE..HY..............................................................LRAWLYRA.AA.
FBpp0071560  .....QT..DD..............................................................IGAHINVG.RT.
FBpp0080424  .....DT..TS..............................................................ADAIYVRG.LC.
FBpp0071879  .....NG..QC..............................................................LNAALALA.LV.
FBpp0292775  kgefeEA..TR..............................................................VHILVQLG.EF.
FBpp0077934  .....NP..QKsln...........................................................ESLLVNLS.TL.
FBpp0087646  .....SP..VY..............................................................ANAWIGQA.MV.
FBpp0079665  .....SP..NFtca...........................................................NEVHLRLG.LM.
FBpp0086749  .....LPitQH..............................................................GRIWPLYL.QF.
FBpp0082652  .....DP..IH..............................................................LRAWLYRA.GA.
FBpp0077619  .....QL..LS..............................................................IVANYMIG.KS.
FBpp0086164  .....AP..FC..............................................................YDARFTLS.AL.
FBpp0087232  .....SY..SKdli...........................................................YKLYERQA.RC.
FBpp0072561  .....FP..ED..............................................................IEAWIELA.QI.
FBpp0088148  .....EC..GTkcrs..........................................................GLVHLTVA.RV.
FBpp0075787  .....KP..HS..............................................................YEGYYARA.KA.
FBpp0083319  .....-N..RL..............................................................SSLFFEKA.YC.
FBpp0076499  .....RC..TS..............................................................PKAHYLRA.LA.
FBpp0290580  .....S-..-Edfagaqsllnqraggt..............................................ADTLNDEG.CL.
FBpp0080720  .....TK..ELkdatqe........................................................GILQANLG.LV.
FBpp0086164  .....NP..QD..............................................................RDMWIRVS.DL.
FBpp0080741  .....SR..LYthrdle........................................................AEILLHLG.KI.
FBpp0087297  .....SR..QD..............................................................HEIYHYLG.EL.
FBpp0070720  .....--..--..............................................................--------.--.
FBpp0086683  .....NN..PS..............................................................ALALCQHG.RA.
FBpp0289328  .....--..--..............................................................--------.--.
FBpp0070667  .....AP..NV..............................................................AENHVVLA.SA.
FBpp0082624  .....HG..DStiainlkacnrfrlfngrvaeqeikniadngtfgadllrhnlvvfrngegalrvlpgllniiPEARLNLA.IY.
FBpp0081552  .....MK..-D..............................................................AQVYCDRA.DA.
FBpp0086749  .....--..--..............................................................--------.--.
FBpp0087646  .....--..AT..............................................................FKPIIGLA.QA.
FBpp0071879  .....YL..SQghqip.........................................................IEWLNNLA.SS.
FBpp0080894  .....NK..YR..............................................................PETCCVIG.NY.
FBpp0070906  .....KS..ELlghfdyev......................................................GLSIGHLA.SL.
FBpp0087646  .....--..--..............................................................--------.--.
FBpp0082112  .....DQ..QLarnlrqstlqtmssars.............................................CEILYNLG.VA.
FBpp0293629  .....WP..NN..............................................................AVAQLHYG.LA.
FBpp0076526  .....NQ..DApsea..........................................................FTTLCTIA.EI.
FBpp0085279  .....QP..MN..............................................................FEARYNLG.LV.
FBpp0074835  .....CN..TS..............................................................VELWLALA.--.
FBpp0078887  .....AP..RH..............................................................PEVLLRYG.EF.
FBpp0290580  .....E-..-Lgigaqmdipdggarsvgnpitmaisgi...................................TQALNLKA.AI.
FBpp0085047  .....SP..HD..............................................................PEIY----.--.
FBpp0296980  .....AK..SLgdtage........................................................CRAHGNLG.SA.
FBpp0086380  .....NL..KYfgdkdmhv......................................................ALSYHLMA.RT.
FBpp0083435  .....ES..PS..............................................................EKSIYRRA.LA.
FBpp0078891  .....KH..ND..............................................................YDTLINLM.VH.
FBpp0082419  .....EP..DN..............................................................AT------.--.
FBpp0086749  .....--..--..............................................................--------.--.
FBpp0078027  .....LK..NLqryd..........................................................APINLEVC.DA.
FBpp0088148  .....QA..TY..............................................................TRSIRVMG.DI.
FBpp0290863  .....NP..FN..............................................................ERALMRRS.QL.
FBpp0080720  .....D-..-Dkdilely.......................................................GLTKNWFG.QL.
FBpp0083319  .....HK..SHe.............................................................FVSKFAII.QL.
FBpp0071288  .....--..--..............................................................--------.--.
FBpp0081398  .....--..--..............................................................--------.--.
FBpp0085016  .....QP..TH..............................................................S-------.--.
FBpp0293235  .....DP..RQ..............................................................SEVV----.--.
FBpp0290580  .....HS..DDimsvs.........................................................AAVLANLC.VS.
FBpp0085012  .....LP..HH..............................................................ERAN----.--.
FBpp0086380  .....HP..ST..............................................................ILEYTHLS.LY.
FBpp0071879  .....LP..KNr.............................................................VDVMHCLA.KA.
FBpp0076961  .....RQ..AWd.............................................................ANVSMELG.DA.
FBpp0075717  .....LK..SS..............................................................VDYYLKMA.KA.
FBpp0080267  .....EE..YL..............................................................PLIKLRQA.AC.
FBpp0070908  .....NP..DN..............................................................VEAIGLMA.V-.
FBpp0085033  .....QP..HD..............................................................ARVL----.--.
FBpp0082507  .....SQ..NNvywh..........................................................CKLLLQLA.QI.
FBpp0292775  .....HL..--..............................................................KHTYYQKA.QE.
FBpp0085676  .....AR..SKdgeek.........................................................AIINLDIC.DV.
FBpp0087091  .....--..--..............................................................--------.--.
FBpp0082624  .....DI..KNq.............................................................HTYCMILA.KC.
FBpp0070431  .....--..--..............................................................--------.--.
FBpp0075442  .....LS..EQteclasv.......................................................SRARRWLV.HA.
FBpp0070906  .....RR..GIfgnmnfhv......................................................AIAHEDLS.YA.
FBpp0089265  .....AQ..EHg.............................................................D-------.--.
FBpp0078634  .....DPi.DF..............................................................ALNTATLS.QF.
FBpp0075754  .....HK..KSayshipacq.....................................................ISTSYYVG.FA.
FBpp0087625  .....YP..ERlr............................................................HKVIMRQA.FC.
FBpp0071288  .....HG..DS..............................................................PDLWVDAA.LW.
FBpp0110159  .....SP..HD..............................................................LEI-----.--.
FBpp0072679  .....E-..--..............................................................-----GYM.EA.
FBpp0082624  .....SS..TPd.............................................................GKLDLNLA.VC.
FBpp0084254  .....GP..SSperali........................................................MRLHLLQG.VL.
FBpp0085032  .....NP..HD..............................................................IKLLL---.--.

                                                          120         130                        140
                                                            |           |                          |
d2fbna1        N.MYF...........G...F.....................LEEAKENLYKAA..SL...........NPNNLD......IRNS
FBpp0112455  Y.YCS...........K...D.....................KEIAFRIFELGL..KR...........FGGS--......----
FBpp0070351  L.ANG...........S...R.....................SVEAVEAYQQAL..QL...........QPGFIR......VRYN
FBpp0070402  E.EML...........E...N.....................VAGARQVFERWM..EW...........QPEEQAwq....TYVN
FBpp0080138  H.YGQ...........N...H.....................DL----------..--...........------......----
FBpp0074609  A.AQL...........E...D.....................YEKAISIYEQVA..A-...........------......----
FBpp0084171  S.IYH...........H...K.....................RFDAVYYYVRSL..LT...........SNSIQS......AKES
FBpp0085420  L.KEL...........Q...D.....................VSGALQ------..--...........------......----
FBpp0085420  L.KEA...........R...I.....................FDRAVAAYLRAL..NL...........SPNNAV......VHGN
FBpp0077790  Y.RKL...........E...N.....................YKQAKVYYEKAM..SE...........HRT-PE......IKTS
FBpp0082545  Q.SAQ...........G...K.....................YDKALASYEKAL..KY...........RANFAV......CYYN
FBpp0084691  N.KIC...........H...D.....................LDAGLAALQQAL..ER...........DPANTR......VALQ
FBpp0072096  L.VKL...........R...R.....................YDEATNALKKEI..SL...........NQQTE-......----
FBpp0071560  -.---...........-...-.....................------------..--...........YPEHEQ......ALLN
FBpp0077790  L.QGM...........Q...Q.....................QSKAQAAYQKAL..EL...........DPNNAE......AIEG
FBpp0076600  Q.FYM...........K...K.....................KDLSLQTLNTAA..TL...........DPKNPL......TRFH
FBpp0271716  N.ARI...........K...E.....................YTSGLKYCRAFL..DI...........ESND--......----
FBpp0077790  A.AGL...........N...D.....................FMKAFEAYNEGL..KY...........DPTNAI......LLQG
FBpp0290896  L.QMR...........G...L.....................RKEAVACYHKAL..EL...........QPGHAI......SRAN
FBpp0081673  V.VLI...........G...DsthqasefaskvsrilvrlkkYEEATKALKKEI..SL...........------......----
FBpp0077614  F.IAL...........G...K.....................RQQAIEILQAGS..NLdgaavrdrtahDQARSS......AYLQ
FBpp0084691  E.KRK...........G...I.....................KANCYKVFERGL..EA...........IPLSVD......LWIH
FBpp0296980  L.QCL...........G...R.....................YGEALAAFASGL..AQ...........EPSNKQ......LMAG
FBpp0080535  Y.SNM...........G...N.....................FEKAEQAYAKAI..EL...........EPDNEV......YKSN
FBpp0296980  H.FSL...........G...N.....................YRAAVRYYDQDL..ALakdaqh.....RPNMGR......AYCN
FBpp0072164  N.ESL...........G...N.....................NMEALKDCTTVL..AI...........EPKNIE......AKRS
FBpp0084016  L.IKA...........G...L.....................IDSARNVLERAVvqKL...........KPNKMQ......VIYK
FBpp0296980  H.HQR...........R...Q.....................FTQAAACHEQVL..RI...........AQALGDrsmeaaAYAG
FBpp0296980  H.AAL...........G...N.....................HAQALNCLEHQR..EL...........AQGLQDralesdAMCA
FBpp0080894  Y.EII...........K...M.....................HYYSLYYFKIAH..QL...........RPYDSR......MLVA
FBpp0081606  H.MSL...........G...K.....................FKQALCDFEFVA..KC...........RPNDKD......AKLK
FBpp0084559  Y.TLL...........H...E.....................FNTAIEYHNRHL..AI...........AQELGDrigearACWS
FBpp0075683  Y.LKQ...........G...R.....................YTEAEILYKQVL..TR...........------......----
FBpp0081284  Y.EAL...........E...K.....................FEEAYKDATALF..KA...........DPGNKT......VQPM
FBpp0079468  N.LTI...........N...E.....................LEDALEDFQKVI..QL...........EPGNKA......AANQ
FBpp0087297  Y.IAS...........E...Q.....................YASAFHTLAAAI..NL...........RKDNAE......CYML
FBpp0074835  E.LRA...........G...L.....................KEIASTMMARAL..QE...........CPNAGE......LWAE
FBpp0079893  L.QWR...........G...D.....................INLAVQLLNKAI..EV...........DPKCEL......AYET
FBpp0082765  Y.EQE...........D...K.....................PDEALEDYKKVT..EI...........DPGQQE......AREA
FBpp0079617  L.MEI...........D...N.....................FDEAIKHLQRAY..DL...........SK----......----
FBpp0084440  H.NAE...........G...K.....................HLESLNVYKKLL..DF...........EPDNAI......AKKA
FBpp0080424  C.LAL...........G...D.....................I-----------..--...........------......----
FBpp0085344  H.LVL...........G...E.....................PRLAEKMLKDAA..KL...........DPSCPK......IWFA
FBpp0081552  H.MKS...........G...E.....................YEQAIQDFDQVL..QE...........EPNNGL......VLEH
FBpp0087646  Y.AGR...........G...S.....................YNSAIRVFQKIL..EL...........SPENNY......ALLQ
FBpp0083769  H.ALL...........G...N.....................LDPAIEAFHKSL..AL...........NRD---......----
FBpp0070572  R.RLL...........G...D.....................FELAAHDLRQAC..KL...........D-----......----
FBpp0070575  R.RLL...........G...D.....................FELAAHDLRQAC..KL...........D-----......----
FBpp0074835  E.WAL...........E...K.....................FDEALRLLEEAV..EV...........FPDFPK......LW--
FBpp0080424  Y.NDL...........E...K.....................FEESVADYETAL..QL...........E-KTPE......IKRM
FBpp0076113  Q.RGL...........R...N.....................YEEAINDLKTAH..NL...........LPENKQ......ILNE
FBpp0072561  Y.LRA...........N...K.....................LVDAKAVLLKAR..RV...........APQDTV......LLFN
FBpp0072561  Y.IYR...........G...D.....................TENAAQCFEKVL..KI...........QPGNYE......TMKI
FBpp0085923  L.LEL...........H...R.....................PQDADQCLQALI..QR...........FPDFAN......----
FBpp0079893  H.EAT...........K...D.....................MNECLDD-----..--...........------......----
FBpp0075683  Y.GKR...........G...K.....................YKDAEPLCKRAL..EI...........------......----
FBpp0077614  L.HLL...........G...R.....................TNHAAASYKAAL..RL...........QPGDAI......TLGN
FBpp0086749  E.EEH...........G...L.....................ARHAMSVYDRA-..--...........------......----
FBpp0073411  H.AGA...........W...N.....................PAQARRDFLDAL..AL...........D-----......----
FBpp0070908  L.IAL...........E...R.....................HTQAVCAFRTAQ..MV...........APYRFE......IYRG
FBpp0085842  L.EGK...........A...D.....................TQGAIKLLQKVA..TL...........EPENRA......VQSD
FBpp0077718  A.VTS...........G...D.....................FNLAKRCLQLCL..TS...........DAQNGA......ALNN
FBpp0296980  H.MAL...........C...S.....................WTNAVKCYQEQL..ER...........AQEQRDaaveaqAHGN
FBpp0076600  C.MRT...........E...R.....................NKLAVSALRRAL..KL...........NPFMWH......AFAD
FBpp0086749  E.LRQ...........Q...Q.....................FEAALKLMQRAT..AM...........PK----......----
FBpp0085479  A.YEL...........E...R.....................FDLCTQMCEELL..EV...........DVDNEV......A---
FBpp0112016  L.YYL...........G...Q.....................FEQSLMFFHRGL..RA...........RPELAL......FRLG
FBpp0079665  Y.ESC...........G...Q.....................LRDAYACYLN--..--...........------......----
FBpp0084076  Y.KGL...........K...Q.....................DDKFEESVVKAR..EH...........NPKQL-......----
FBpp0111406  Y.KGL...........N...D.....................ESNFENCVKYAR..KF...........------......----
FBpp0074918  L.IKL...........G...D.....................KQRAHRVLGEAL..KC...........NYSNWK......VWEN
FBpp0082818  R.YTM...........GgveN.....................MESARTYYSQAL..KL...........NPHNLR......ALYG
FBpp0074480  Q.IQM...........R...D.....................LEGYKETRHHLF..TL...........RPSQHA......SWIG
FBpp0082819  R.YTM...........GgveN.....................MESARTYYSQAL..KL...........NPHNLR......ALY-
FBpp0085279  Y.IKL...........Q...A.....................TERALFYYERAV..LA...........DPNDPN......LMLR
FBpp0081805  Y.EEE...........N...R.....................IAEAVKAYSDCL..NL...........LPLHEE......ARQS
FBpp0100023  N.KGL...........G...H.....................YFEAKKYANELL..SI...........NPNHTY......ML--
FBpp0071879  A.LVS...........G...Q.....................YRLAIQTYERCL..K-...........------......----
FBpp0084559  Y.HAK...........G...K.....................------------..--...........------......----
FBpp0075591  Y.RKL...........D...N.....................LEAARADFEAAA..QL...........GSKF--......----
FBpp0076526  Y.ICKk..........N...D.....................ATAALRFCNMAL..EV...........A-----......----
FBpp0079851  L.YHL...........N...R.....................LEEAIPYLSRCT..EV...........DIFIPD......VWGY
FBpp0072146  L.AAL...........G...E.....................YNLARNAYLQAQ..AK...........QPANKE......ISDE
FBpp0296980  L.RSS...........G...D.....................AEGAHIQLETAA..QLlesvrheqr..SPETRQ......ALYD
FBpp0083238  Y.REM...........E...Q.....................LDKIVELYQHAV..KQ...........NPGNEE......LLAH
FBpp0111383  Y.KRL...........N...D.....................EPNFEYSVDRAR..RF...........NRSDA-......----
FBpp0071560  F.NNL...........K...R.....................YAEAEQAYVQAK..AL...........FPQ---......----
FBpp0080424  L.YYT...........D...N.....................LDKGILHFERAL..TL...........DPDHYK......SKQM
FBpp0071879  K.FEH...........N...Deqs..................YQDGKMLLTAAY..KE...........NNKNPD......LLSI
FBpp0292775  L.QQQ...........G...D.....................YHSATKKFTQ--..--...........------......----
FBpp0077934  Y.ELE...........S...N.....................NSKAKKY-----..--...........------......----
FBpp0087646  A.ELI...........G...D.....................REEAFDLFRHCQ..QF...........D-----......----
FBpp0079665  L.KHC...........G...E.....................FHIALKHLQLAL..LYt..........YPSTFSelq...VKFQ
FBpp0086749  V.RRF...........E...M.....................PETALRVYRRYL..KL...........FPEDTE......EYVD
FBpp0082652  L.ARL...........N...N.....................ESE---------..--...........------......----
FBpp0077619  Y.YKL...........D...L.....................LDLALESFANAT..HM...........DTHVPN......VWGF
FBpp0086164  L.KQQ...........G...R.....................HEEAVQALEQPG..EA...........EGQPLI......ARLL
FBpp0087232  Y.MAL...........K...D.....................YPHTIDSFKKCI..TA...........MDDSTL......ASDK
FBpp0072561  L.E-Q...........N...D.....................LQASLSAYGTAS..SI...........LRDKAKyeipaeIQNN
FBpp0088148  Y.LEM...........G...G.....................FSRALEGLQGAY..KIataig......DPSLELq.....VYVA
FBpp0075787  R.MEL...........G...A.....................LNEALVDANEAM..Q-...........------......----
FBpp0083319  E.YQL...........N...K.....................QQQALKTIDDA-..--...........------......----
FBpp0076499  L.SGL...........G...R.....................LEEALYNGFLAI..CL...........DK----......----
FBpp0290580  L.FQA...........D...Q.....................HEAAVQRFQAAL..QV...........GGFNPL......VAYN
FBpp0080720  Y.LRE...........G...L.....................MSQAENACRLAW..KL...........GKQHQ-......----
FBpp0086164  L.VQQ...........G...N.....................LARARLIYTKAI..KM...........LPKVYQ......LRLR
FBpp0080741  F.AKDt..........Q...M.....................TSIAKKCYEHAK..RI...........YVDFND......LHSR
FBpp0087297  L.YRAattqsqkdvasQ...Q.....................QDEARTYFELAV..--...........------......----
FBpp0070720  -.---...........-...-.....................------------..--...........------......----
FBpp0086683  L.SDL...........G...K.....................YHPSRLCYIKAL..KK...........RPRDQG......IKDK
FBpp0289328  -.---...........-...-.....................------------..--...........------......----
FBpp0070667  L.AMK...........H...D.....................FNRSLQHFDEAE..RL...........DPS---......----
FBpp0082624  Y.LKQ...........G...D.....................VQEAHALMK---..EL...........QPTSPH......EYIL
FBpp0081552  L.LGT...........E...M.....................YDDAIHSFQAAL..DL...........EESNTR......AKEG
FBpp0086749  -.---...........-...-.....................------------..--...........------......----
FBpp0087646  Y.YLA...........G...Q.....................LQESYSIYNSVL..GN...........------......----
FBpp0071879  Q.LMA...........K...M.....................PEKALNTLDDAL..S-...........------......----
FBpp0080894  Y.SIR...........C...D.....................HQVAISYFQRAL..KL...........NPKYLA......AWTL
FBpp0070906  YnYQM...........K...K.....................YRDAEQLYMRSI..DIslrlfg.....N-----......----
FBpp0087646  -.---...........-...-.....................------------..--...........------......----
FBpp0082112  M.LHL...........R...R.....................PKEAFQCFLVPV..KQ...........FHSNPR......LWLR
FBpp0293629  L.RQF...........Ha..D.....................YAKALPYLKYAV..ES...........GEEGTQeaf...FYLS
FBpp0076526  C.EQ-...........-...-.....................------------..--...........------......----
FBpp0085279  A.LAQ...........N...D.....................YELAEE------..--...........------......----
FBpp0074835  -.-RL...........E...T.....................YENARKVLNKAR..EN...........IPTDRQ......IWTT
FBpp0078887  L.EHN...........Qr..N.....................IVLADQYYFQAL..TI...........SPSNSE......ALAN
FBpp0290580  E.FQD...........G...N.....................EEAARDAL----..--...........------......----
FBpp0085047  -.---...........-...-.....................------------..--...........------......----
FBpp0296980  Y.FSQ...........G...A.....................HKEALTA-----..--...........------......----
FBpp0086380  Q.SCM...........G...D.....................FRSALN------..--...........------......----
FBpp0083435  Y.YHL...........K...E.....................FAKAQATIER--..--...........------......----
FBpp0078891  A.HLT...........G...K.....................PTEAI-------..--...........------......----
FBpp0082419  -.---...........-...-.....................------------..--...........------......AK--
FBpp0086749  -.---...........-...-.....................------VYERAL..KE...........LPGSYK......IWHN
FBpp0078027  L.YEL...........N...Q.....................LENAKAELHDNT..RL...........------......----
FBpp0088148  Y.RNK...........M...D.....................MDRAFRQYEQAM..GT...........------......----
FBpp0290863  K.RSM...........G...L.....................ASEALKDCSRA-..--...........------......----
FBpp0080720  L.MKQ...........G...K.....................YLEAKNLFKEA-..--...........------......----
FBpp0083319  Q.LLQ...........G...N.....................RKDAIETL----..--...........------......----
FBpp0071288  -.---...........-...-.....................------------..--...........------......----
FBpp0081398  -.---...........-...L.....................NKE---------..--...........------......----
FBpp0085016  -.---...........-...-.....................------------..--...........------......----
FBpp0293235  -.---...........-...-.....................------------..--...........------......----
FBpp0290580  Y.IMT...........F...Q.....................NEEAEELMRK--..--...........------......----
FBpp0085012  -.---...........-...-.....................------------..--...........------......----
FBpp0086380  S.FAN...........G...H.....................VGMSLK------..--...........------......----
FBpp0071879  L.YDN...........G...D.....................ARKAKMWLLKVR..HL...........VPHDPF......VIFN
FBpp0076961  L.YDL...........N...R.....................FEE---------..--...........------......----
FBpp0075717  Y.AVM...........G...E.....................PARAEISLKIAE..--...........------......----
FBpp0080267  A.LKL...........R...N.....................FALCEEHLHELL..HI...........E-----......----
FBpp0070908  -.---...........-...-.....................------------..--...........------......----
FBpp0085033  -.---...........-...-.....................------------..--...........------......----
FBpp0082507  H.ASD...........R...E.....................YSLASELLAVGA..ES...........------......----
FBpp0292775  L.RER...........G...D.....................IKGALEYFEK--..--...........------......----
FBpp0085676  L.YEL...........N...Q.....................FENSK-------..--...........------......----
FBpp0087091  -.---...........-...-.....................------------..--...........------......----
FBpp0082624  H.IHC...........G...H.....................PELAW-------..--...........------......----
FBpp0070431  -.---...........-...-.....................------------..--...........------......----
FBpp0075442  L.FKM...........H...K.....................YGDAEIFLSKWI..--...........------......----
FBpp0070906  Y.YVHeyst.......G...D.....................FSCAQDHVDKAV..NI...........------......----
FBpp0089265  -.---...........-...-.....................------------..--...........------......----
FBpp0078634  Y.IGE...........K...R.....................FEEARHHLAAA-..--...........------......----
FBpp0075754  Y.MMM...........R...R.....................YADAIRTFSDIL..LY...........IQRT--......----
FBpp0087625  A.WKL...........K...K.....................------------..--...........------......----
FBpp0071288  L.YEF...........Nrl.N.....................IDRVKDILLRGL..QR...........HPDSEA......----
FBpp0110159  -.---...........-...-.....................------------..--...........------......----
FBpp0072679  L.YHL...........E...Q.....................FDDLEKCVERLP..EK...........SPLLPK......LAE-
FBpp0082624  M.FYL...........G...L.....................YEEAQQLMANAA..--...........------......----
FBpp0084254  L.FHQ...........N...R.....................RDEAYEKLEVA-..--...........------......----
FBpp0085032  -.---...........-...-.....................------------..--...........------......----

d2fbna1        YELCVNKLKE...AR-k....................................................................
FBpp0112455  ----------...---peyvmcyidylshlnednntrvlfervlssgglsphksvevwnrflefesnigdlssivkverrrsavf
FBpp0070351  VGVCCMNLK-...---aykeavehlltaltmqahtnaarelpnaamaatfrgqnqmsesiwstlkmvislmgrsdlqsyvsdrnl
FBpp0070402  FELRYKEID-...---rareiyerfvyvhpdvknwikfarfeeshgfihgsrrvferaveffgddyieerlfiafarfeegqkeh
FBpp0080138  ----------...---dstyhylyslvciipfelsennlnklfakhteylermdpekldfniedffarfylivdifffdkevpdf
FBpp0074609  ----------...---sslessllkysakeyffraalchlsvdllnaqhaiekyaqqypafqdsrefklikvlcenleeqniegf
FBpp0084171  L---------...---ldlfdeirrkyeetemkqspmhyaagsknqkskqmrkevwiypdgirrlhrtddkgnkakgnkatmaev
FBpp0085420  ----------...---cytraiqinpafadahsnlasihkdsgnipeaiqsyrtalklkpdfpdaycnlahclqivcdwtdydir
FBpp0085420  LACVYYEQG-...---lidlaidtyrraielqpn...................................................
FBpp0077790  L---------...---seveakike............................................................
FBpp0082545  MGNLYLEQKRy..A--ealhhwqhavalnprqpkawaniltmldnkglqddalrisnqalqhlpndvsilfiranvlgklkhyte
FBpp0084691  MIDLCL----...---qrpkvdeqevveimdkfmaradiepdqkvlfaqrkvefledfgstarglqdaqralqqaltkakeaqkk
FBpp0072096  ----------...---sygqigrlvvalvmvqlargdsveaektfrewgnccepeevstlqtllqafddedpela..........
FBpp0071560  SAILLQELGG...---eearrvsrsrlykvlenddqnekvyfnlgmlamdessfdeaeqffkraihlkadfrsalfnlallladt
FBpp0077790  YRQC------...---s....................................................................
FBpp0076600  RGSIYFSLGKyqeA--lreleelkevvpkesvvfyligkihktlgnmdlalmhfswatdldpkg.....................
FBpp0271716  ----------...---qvrsleeyikkeidkevakgmvvaggaalvlggilglgiamarnkq.......................
FBpp0077790  ----------...---rmet.................................................................
FBpp0290896  LAR-------...---m....................................................................
FBpp0081673  ----------...---nlqtksygqvgrlvvalilvqltledyvdakktfkkwgnrcdpqevntlqnllkafddedpelatkm..
FBpp0077614  LGALYVEQGKlqrA--laiyrealsslpglpqqreilyqrigdvlgrlqqwdeaerhhraalelqpnqvaahlsygitla.....
FBpp0084691  ----------...---ylmhvksnhgddetfvrsqyeravkacglefrsdklwdayirweneskryhrvvqiydrllaiptqgyn
FBpp0296980  L---------...---vea..................................................................
FBpp0080535  LEAARNA---...---rnqpp................................................................
FBpp0296980  LGLAHLALGHt..A--aalecqqlfla..........................................................
FBpp0072164  LARINDRLR-...---ki...................................................................
FBpp0084016  ----------...---kylqleenhgtdatvakvkqqaeqwvknyak......................................
FBpp0296980  LGHAARCAGD...---asaskrfherqlamalaardklgegracsnlgivyqmlgshdaalklhqahlgiarsl...........
FBpp0296980  LGQVQQRMGQhaqA--lelhrqdleictelsapalqaralsnlgsvheslgqqaealkcyerqlelst.................
FBpp0080894  LGETYEKLDKcenA--vkcywkaidvgdiegiamyklanlheklgdhetavhcyimy............................
FBpp0081606  F---------...---tecn.................................................................
FBpp0084559  LGNAHSAIG-...---gheralkyaeqhlqlakelhdpvgestar........................................
FBpp0075683  ----------...---aherefgaidsknkpiwqvaeereehkfdnrentpygeyggwhkaakvdsptvtttlknlgalyrrqgm
FBpp0081284  LQRL------...---hv...................................................................
FBpp0079468  VIICKQKLKE...---sknkekklyanmftk......................................................
FBpp0087297  LGLCLRKLDDmenA--fvalera..............................................................
FBpp0074835  ----------...---aifmetkpqrktksvdalkkcehdphvllavsklfwsehkfskcrdwfnrtvkidpdlgdawayfykfe
FBpp0079893  LGTVEVQR--...---aqltravelfekal.......................................................
FBpp0082765  Q---------...---irlppiinerneklk......................................................
FBpp0079617  ----------...---eqk..................................................................
FBpp0084440  VEKLTSMLGE...---va...................................................................
FBpp0080424  ----------...---igteqavkmvn..........................................................
FBpp0085344  LGKVMEILGDfh.A--sadcfatslqlepscpvl...................................................
FBpp0081552  YSRLA-----...---paqeqwvlvqqliqysdhqnaipmitqlleispwavpfrqarsdayiaindpllaiadlrqvnrltqds
FBpp0087646  IASVK-----...---ttirmytesiedydtllqrnptylp............................................
FBpp0083769  ----------...---ci...................................................................
FBpp0070572  ----------...---fd...................................................................
FBpp0070575  ----------...---fd...................................................................
FBpp0074835  ----------...---m....................................................................
FBpp0080424  LREAKFALK-...---ks...................................................................
FBpp0076113  LNSTKQL---...---laqynrqq.............................................................
FBpp0072561  IAVVL-----...---sr...................................................................
FBpp0072561  LGSLY-----...---.....................................................................
FBpp0085923  ----------...---nhg..................................................................
FBpp0079893  ----------...---v....................................................................
FBpp0075683  ----------...---re...................................................................
FBpp0077614  L---------...---ak...................................................................
FBpp0086749  ----------...---tsavkedemfdmynifikk..................................................
FBpp0073411  ----------...---as...................................................................
FBpp0070908  LFHSYLAQKRfkeA--nalcnwtirlfqnsprsftmfgrtlflfpdprmrrtarkfaekslkinhiytpavnliadicqvegptk
FBpp0085842  LARLFIKA--...---rreehnekemyqkm.......................................................
FBpp0077718  LAVLAAQSGD...---ilgaksylnaakdvmpdaaevttnl............................................
FBpp0296980  LGIAR-----...---lnmahyeaaigcleaqlgtlervs.............................................
FBpp0076600  LC--------...---llgqdtdaaaifqihstdvfntcqgssvnanamvlfgaeqqgqqhqerqslitnlsnvsnyilttpvdq
FBpp0086749  ----------...---rkiayyddtetvqarlhrslkvw..............................................
FBpp0085479  ----------...---ia...................................................................
FBpp0112016  ----------...---vqktqea..............................................................
FBpp0079665  ----------...---a....................................................................
FBpp0084076  ----------...---ayidky...............................................................
FBpp0111406  ----------...---nskq.................................................................
FBpp0074918  YMLV------...---svdtshwddamrayqrmaelkqhyldq..........................................
FBpp0082818  IYLCCNHLD-...---n....................................................................
FBpp0074480  FAMSYHLLGD...---ydmansiletfsqsqtsieahdyrhselllyqnqiliesnrlqqavdhltkyqgqivdklavretmgdl
FBpp0082819  ----------...---.....................................................................
FBpp0085279  IASCF-----...---rn...................................................................
FBpp0081805  L---------...---dal..................................................................
FBpp0100023  ----------...---tqlp.................................................................
FBpp0071879  ----------...---.....................................................................
FBpp0084559  ----------...---.....................................................................
FBpp0075591  ----------...---ar...................................................................
FBpp0076526  ----------...---krfpnkvkk............................................................
FBpp0079851  LATINLRLSRnktAL-ecwkva...............................................................
FBpp0072146  IISMNKRI--...---skyeeasrdi...........................................................
FBpp0296980  LQTTCYQ---...---llqvllvalnrnedal.....................................................
FBpp0083238  LFISHVRVEDyk.A--qqavalqlykaqpknayyf..................................................
FBpp0111383  ----------...---df...................................................................
FBpp0071560  ----------...---a....................................................................
FBpp0080424  RSKCK-----...---ql...................................................................
FBpp0071879  LAGMYYADGN...---hklvwsfagnaikftankhiesrnyfqiaksyhatgqfesakkyyllsaksap................
FBpp0292775  ----------...---a....................................................................
FBpp0077934  ----------...---.....................................................................
FBpp0087646  ----------...---yh...................................................................
FBpp0079665  IAHLYEVQNKhk.A--akdg.................................................................
FBpp0086749  YL--------...---qeadrldeaaqqlahiv....................................................
FBpp0082652  ----------...---feiaianarllnr........................................................
FBpp0077619  LALINLRLGEnykAI-ecw..................................................................
FBpp0086164  YE--------...---rcvmlqqigriee........................................................
FBpp0087232  RAKL------...---nldamtmikmlqndprtakqeakqqkqkialdqakpvklenefvsplvridsnrqegrfarasadvkpg
FBpp0072561  VASLHYRLGN...---lkmakltlesalkhatsemd.................................................
FBpp0088148  L---------...---selfgrlqdndksatyaskaydlsrslql........................................
FBpp0075787  ----------...---q....................................................................
FBpp0083319  ----------...---glqplppnlkelrtqvlyrlerydecldsyrdiikntsdeyeeerrtnlsavaanlavdqtkevpevpe
FBpp0076499  ----------...---kt...................................................................
FBpp0290580  VALAHFQKKQ...---r....................................................................
FBpp0080720  ----------...---npdaveqaeycl.........................................................
FBpp0086164  KAQLLQKMGEtn.A--smftylkmlplmppdewkmclntaknvaryfhvlekhslaleamegaysvcgarftlediniylellil
FBpp0080741  KM--------...---anylqaklm............................................................
FBpp0087297  ----------...---qs...................................................................
FBpp0070720  ----------...---rirntnasdeqqvaslraafnhaweeltvlygdqadtryevlqlwaqveytqlgspdngreiwrqimgy
FBpp0086683  ITRISK----...---riteledtn............................................................
FBpp0289328  ----------...---elenpeqlfiqilgdpsehlhrqyikslfkygsttsepsksieeafimvqasqeeldnimsdlnepqnd
FBpp0070667  ----------...---tl...................................................................
FBpp0082624  KGVVHAALGQ...---qlgskehiktaqq........................................................
FBpp0081552  IQRAKKLQKQ...---se...................................................................
FBpp0086749  ----------...---cdpritadfwqtwkefevrhgnedtmremlr......................................
FBpp0087646  ----------...---vvdhgddkaatilvamasmiydfqgea..........................................
FBpp0071879  ----------...---kcrv.................................................................
FBpp0080894  MGH-------...---efmel................................................................
FBpp0070906  ----------...---sysgleydylglchvyetlhnfek.............................................
FBpp0087646  ----------...---aeqllelnpnsnlallvkaldlfaegqvvasrqlalqaqksqpaykvtlellarihmelgayklalqlw
FBpp0082112  MAEAC-----...---imeh.................................................................
FBpp0293629  LGE-------...---tmqrlsmksealevygkgvakg...............................................
FBpp0076526  ----------...---qshpfwtvhdvyqkalrqadkag..............................................
FBpp0085279  ----------...---rf...................................................................
FBpp0074835  AAKLEEANGN...---ihmvekiidrsltsltvng..................................................
FBpp0078887  RQ--------...---rtad.................................................................
FBpp0290580  ----------...---ldlppraeseldpvtlhnmaltdvegpvaglrklafllelgapscpketfanilliccknelyetaadi
FBpp0085047  ----------...---eeyrilekrdltlsdiepieqdk..............................................
FBpp0296980  ----------...---hry..................................................................
FBpp0086380  ----------...---nekety...............................................................
FBpp0083435  ----------...---m....................................................................
FBpp0078891  ----------...---trn..................................................................
FBpp0082419  ----------...---efyplildkl...........................................................
FBpp0086749  YL--------...---rtrrk................................................................
FBpp0078027  ----------...---ftgnktkmfeqrlvvvdeniedacgpsmtqyisdkeklivhlkevqnkykpdtrplwkilkeqekcdvl
FBpp0088148  ----------...---saslgdrmaqmeamdgaarcletlrlqnkicncrplefntrllevassigakflvrkircrlaliyral
FBpp0290863  ----------...---edl..................................................................
FBpp0080720  ----------...---.....................................................................
FBpp0083319  ----------...---lslgeakykpgvvsalvslylgtdnktaasallksavdwykknevssgdlsdmwrqaaefhlrggaset
FBpp0071288  ----------...---yglackaawpefgelrsdylrylwqersveearkeyaklailppmslalhrqmvqlessaaacdqaslk
FBpp0081398  ----------...---gatalrq..............................................................
FBpp0085016  ----------...---aqqtqk...............................................................
FBpp0293235  ----------...---idacellvkenn.........................................................
FBpp0290580  ----------...---v....................................................................
FBpp0085012  ----------...---gnkrfyekeiaq.........................................................
FBpp0086380  ----------...---llyra................................................................
FBpp0071879  LGLAIKKETE...---qalal................................................................
FBpp0076961  ----------...---nksllhdnvrrhagtalksfenrlvvvdenlkdctgfslanffmehsaqlpgfyahqqeelrradrrpl
FBpp0075717  ----------...---km...................................................................
FBpp0080267  ----------...---lnq..................................................................
FBpp0070908  ---L------...---cgqeg................................................................
FBpp0085033  ----------...---rlwkkt...............................................................
FBpp0082507  ----------...---adeasatylkvlfllsramilmierktndvlallnsagqiidnn.........................
FBpp0292775  ----------...---tqn..................................................................
FBpp0085676  ----------...---aemhn................................................................
FBpp0087091  ----------...---an...................................................................
FBpp0082624  ----------...---nv...................................................................
FBpp0070431  ----------...---ltvthgrdhrllteqlymlvlqar.............................................
FBpp0075442  ----------...---ne...................................................................
FBpp0070906  ----------...---mqhlvp...............................................................
FBpp0089265  ----------...---krslnlantwycl........................................................
FBpp0078634  ----------...---tlima................................................................
FBpp0075754  ----------...---kqlystrsyqndqinkqae..................................................
FBpp0087625  ----------...---ia...................................................................
FBpp0071288  ----------...---lnkcffdimlkeaalasnernlaentlseqdiklerveavyrnsmanitq...................
FBpp0110159  ----------...---fqeyqnl..............................................................
FBpp0072679  ----------...---mlasvgmcseavqahlrfgdqkaavatcvnlrqw...................................
FBpp0082624  ----------...---dnplkqrllfhlahklgneee................................................
FBpp0084254  ----------...---tk...................................................................
FBpp0085032  ----------...---kks..................................................................

d2fbna1        .....................................................................................
FBpp0112455  enlkeyegketaqlvdrykfldlypctstelksigyae...............................................
FBpp0070351  aalneafk.............................................................................
FBpp0070402  drariiykyaldhlpkdrtqelfkaytkhekkygdragiedvivskrkyqyeqevaanptnydawfdylrlieaegdrdqirety
FBpp0080138  nalchcvlidlrkilcsqqlrvpepsifkivsilffclsklkminspkvyslhaflvaacsdlmdacivsieqtilaraqdnerf
FBpp0074609  teavkdydsisrldqwyttillrikkaaded......................................................
FBpp0084171  nryeemppeeilprivslylyllgklytgtdvdslypllrklqiqigvalrhenllsrskllkivalnlfvvehnkpktsrremr
FBpp0085420  mkklvsi..............................................................................
FBpp0085420  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  aeaiykrvielephntlyhtnlgvlyhrwdktqeaieayrtaisisaarattarenlskllkrlereaqvm..............
FBpp0084691  s....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  krpldavpflnqlirhhpshvkglillgdiyinhmkdldeaekcyrsilhydphntqglhnlcvvfverkrlakaaaclqyaqrl
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084691  ghfdnfqdlinqhdvtitlaneevirlrkdfherqq.................................................
FBpp0296980  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  feaa.................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  llhgteaqqqevldrcisaepthgeswcrv.......................................................
FBpp0079893  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0085344  .....................................................................................
FBpp0081552  teghykiaqllytighatnalkeireclkfdpeh...................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070908  aiikllekhviifpkvnllnhlgdimrkqkepvkameyyykalrqdpks....................................
FBpp0085842  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0076600  qqqqinqnqnqhhnsnmvtpinnnnnnnnlnssismlrgglvqnssmlamledtpmgapqdpagqyqqnqqlydmssgtpfrkqf
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  yiklqqqekavpifeslirrnpenvlyyeqyiaarqvtdssavvsiyrvfqeqypralcprrlplniangdefrvvtdeylrrgl
FBpp0082819  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0081805  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0087232  eellverpfvsvllekfakthcencfmrtvvpvacprcadvlycseqcreeaskkyhkyecgivpiiwrsgasinnhialriias
FBpp0072561  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0083319  dtyeqyfnsaciqanrqkyaeaerklrtsek......................................................
FBpp0076499  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  nkqyakvlrclrertnfelendqeesleliyfceipddyvpelraklcvslihmrahhllgyliqnvqehitltadrvelymdit
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  pgssirgllwlnfaqmeseyngghgtrdvlrkalsqpvlenglmvqeffrryercygtyesiaacq...................
FBpp0086683  .....................................................................................
FBpp0289328  vevekdlyqvkrspsncelgcrglyrqktnlvcrykstantflrlaplkleeisldpfmamyhevlydseirelkgqsmnmvngy
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0087646  qeigqendayalclshekgvsklreavtilqtlensegnikslarcyfklge.................................
FBpp0082112  .....................................................................................
FBpp0293629  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  laehtdltykylsqylyelldslitaqtsaelaekklgtlasslagklrslaakvqevratneqqalrdalkdyeqalel.....
FBpp0085047  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  sipeieeemlspleiarrsrafdvfnqmfidrswhdviflkhvrknpnlllnqcknsteylqtlstkkydeiksflkilearspm
FBpp0088148  gdedq................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  aassleellklnpndtkv...................................................................
FBpp0071288  ywrmcydfmacyfgktqprvwveylaferdhgeaknislltqralstlepqyvaaf.............................
FBpp0081398  .....................................................................................
FBpp0085016  .....................................................................................
FBpp0293235  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  wkilkerkecdvqsridrkevmlsplererrrrktkifyqnylgrswtdffflktlrrhpnclldnhfgssadrtkyleyafqrl
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075442  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0089265  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................

d2fbna1        .....................................................................................
FBpp0112455  .....................................................................................
FBpp0070351  .....................................................................................
FBpp0070402  eraisnvppaneknfwrryiylwinyalyeeleaedaertrqiyktcleliphkqftfsklwllyaqfeirckelqrarkalgla
FBpp0080138  qaeyeerfqefdtvvrksrneyknwlaavgecerkdkklmprphslkdcssdsrdsqhsgeeaktqeaadgdkigeavstrssde
FBpp0074609  .....................................................................................
FBpp0084171  yhsfnfansffglmmkktnqllagfvedstnvqclpeedfatvntylqfvnvyvrwlsisldvwepvrseehsfidcwaeltilf
FBpp0085420  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  apaedyigrhlqivlarlqki................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0085344  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0076600  kylsaispptpsfgimpltspctgndgsfignhtpvmnisyspmpqmlvevnqepkmmgkklkthvgglinrkegslnkpavftq
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  rkgipplfvnvrtlhqiperaavieelalqyfenltrsghfsredadagipvepasalvwtalflaqhydymrdtdraleyinva
FBpp0082819  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0081805  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0087232  kpldyflklkptideeltpeqlislpkddfrrvaqlerhqgerqpsnffqhvlmarfltnclraggyfgsepkpdevsiicslvl
FBpp0072561  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076499  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  ealmqehkyaeaial......................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  .....................................................................................
FBpp0086683  .....................................................................................
FBpp0289328  asqrngteirdtvvrydwwsntslvrerinqriidmtgfnflkdeklqianyglgtyfqphfdyssdgfetpnittlgdrlasil
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0082112  .....................................................................................
FBpp0293629  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085047  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  yniryqkftnkklmdkfrqeylfrvqyqtrrnmisalrsirylrktksltkltsyveevmgdyvvkktnrimpwkfefinevyni
FBpp0088148  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0081398  .....................................................................................
FBpp0085016  .....................................................................................
FBpp0293235  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  ktftrmlqarrpmykeyfhrnpqiearmrdanlfriqyqtrrnmvsilrtikvlrgrndikrlrkfveevmgsyvviktnrlmpw
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075442  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0089265  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................

d2fbna1        .....................................................................................
FBpp0112455  .....................................................................................
FBpp0070351  .....................................................................................
FBpp0070402  igmcprdklfrgyidleiqlrefercrmlyekflefgpencvtwmkfaelenllgdtdraraifelavqqprldm..........
FBpp0080138  akesdlktplsckskrrgmrlrrrrrkiaqsddsscydseseldtdfysdeedytdlssnfdtdfsdidaadpgepcgeeryaaa
FBpp0074609  .....................................................................................
FBpp0084171  eyieclmgkhklekneilldedvalrgftplgretlsmdylkrgserlqffervrrigqfqeyyvqhqealqqplessftvehln
FBpp0085420  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0085344  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0076600  agnitprtpnnnnvgnngnmnvppnpnaavrrssrlfsnsysvkennkspniankfvqprspprkaksrmtkiclnneliedksh
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  idhtptliellitkgrifkhagdpveayvwleeaqsmdtadryi.........................................
FBpp0082819  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0081805  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0087232  rslqfiqfnthevaelhkfsssgreksifiggaiyptlalfnhscdpgvvryfrgttihinsvrpieaglpinenygpmytqder
FBpp0072561  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076499  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  .....................................................................................
FBpp0086683  .....................................................................................
FBpp0289328  fyasevpqggatvfpeinvtvfpqkgsmlywfnlhddgkpdi...........................................
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0082112  .....................................................................................
FBpp0293629  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085047  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  lalayvdqytlpknfrfseknallrllrfpmdkskevkhfvfgdrtthqgsetvdpaltksrlmgnrlenrmnfakypieksyll
FBpp0088148  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0081398  .....................................................................................
FBpp0085016  .....................................................................................
FBpp0293235  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  kaefmnevynnlalslcegyrlpptrvtpydksamcqllnipvakplehtelifgdrstysyagadkqstdrladqnqieylekr
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075442  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0089265  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................

d2fbna1        .....................................................................................
FBpp0112455  .....................................................................................
FBpp0070351  .....................................................................................
FBpp0070402  .....................................................................................
FBpp0080138  nyskkerkagggggggvggvvysdnedvvieeekivypneverrsnsqeadseellrsfevlqlnfksaedaqskpvapppvsfs
FBpp0074609  .....................................................................................
FBpp0084171  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0085344  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0076600  hlsekrkekvetitssgannnsggrsaaeeakvllnnslnnaqtmahqlmglkkqsadglmallrglaeayqllsnfqckaaikq
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  .....................................................................................
FBpp0082819  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0081805  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0087232  serqarlkdlywfecscdacidnwpkfddlprdvirfrcdapnncsavievppscndfmvkcvtcgeitnilkglkvmqdtemmt
FBpp0072561  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076499  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  .....................................................................................
FBpp0086683  .....................................................................................
FBpp0289328  .....................................................................................
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0082112  .....................................................................................
FBpp0293629  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085047  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  hqmaeihlkshrfdeccfsarksieeakkcnsyiwqflcylliikanaalhkvertsealdlalkiskelkekhihnfltacihc
FBpp0088148  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0081398  .....................................................................................
FBpp0085016  .....................................................................................
FBpp0293235  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  llfarlpiersyllheladrhmqknhfvqslsyaqkaieearvcnsliweflstmlmakshavlhkyerqtevlnsayelaaqlk
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075442  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0089265  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................

d2fbna1        .....................................................................................
FBpp0112455  .....................................................................................
FBpp0070351  .....................................................................................
FBpp0070402  .....................................................................................
FBpp0080138  eppkklvyrnkytkinpnividclhneptiralkmlfdwlrinpeiligcyhsnpefvhkimkllnycnidiftrkvyferdllt
FBpp0074609  .....................................................................................
FBpp0084171  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0085344  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0076600  lettipkhhlnsswvqsliglaryemreyeaavaifetihktep.........................................
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  .....................................................................................
FBpp0082819  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0081805  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0087232  rtakrlyetgeypkalakfvdlirim...........................................................
FBpp0072561  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076499  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  .....................................................................................
FBpp0086683  .....................................................................................
FBpp0289328  .....................................................................................
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0082112  .....................................................................................
FBpp0293629  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085047  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  neee.................................................................................
FBpp0088148  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0081398  .....................................................................................
FBpp0085016  .....................................................................................
FBpp0293235  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  spqlctfielcr.........................................................................
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075442  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0089265  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................

d2fbna1        .....................................................................................
FBpp0112455  .....................................................................................
FBpp0070351  .....................................................................................
FBpp0070402  .....................................................................................
FBpp0080138  tanvrdslvelfdvranvpltedfafknfdifqstqitldwetiirervtpqeesilrifkmvdfgffickqkkfnyrfcvktrr
FBpp0074609  .....................................................................................
FBpp0084171  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0085344  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  .....................................................................................
FBpp0082819  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0081805  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0087232  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076499  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  .....................................................................................
FBpp0086683  .....................................................................................
FBpp0289328  .....................................................................................
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0082112  .....................................................................................
FBpp0293629  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085047  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0081398  .....................................................................................
FBpp0085016  .....................................................................................
FBpp0293235  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  .....................................................................................
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075442  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0089265  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................

d2fbna1        ............
FBpp0112455  ............
FBpp0070351  ............
FBpp0070402  ............
FBpp0080138  ftetqkkkqree
FBpp0074609  ............
FBpp0084171  ............
FBpp0085420  ............
FBpp0085420  ............
FBpp0077790  ............
FBpp0082545  ............
FBpp0084691  ............
FBpp0072096  ............
FBpp0071560  ............
FBpp0077790  ............
FBpp0076600  ............
FBpp0271716  ............
FBpp0077790  ............
FBpp0290896  ............
FBpp0081673  ............
FBpp0077614  ............
FBpp0084691  ............
FBpp0296980  ............
FBpp0080535  ............
FBpp0296980  ............
FBpp0072164  ............
FBpp0084016  ............
FBpp0296980  ............
FBpp0296980  ............
FBpp0080894  ............
FBpp0081606  ............
FBpp0084559  ............
FBpp0075683  ............
FBpp0081284  ............
FBpp0079468  ............
FBpp0087297  ............
FBpp0074835  ............
FBpp0079893  ............
FBpp0082765  ............
FBpp0079617  ............
FBpp0084440  ............
FBpp0080424  ............
FBpp0085344  ............
FBpp0081552  ............
FBpp0087646  ............
FBpp0083769  ............
FBpp0070572  ............
FBpp0070575  ............
FBpp0074835  ............
FBpp0080424  ............
FBpp0076113  ............
FBpp0072561  ............
FBpp0072561  ............
FBpp0085923  ............
FBpp0079893  ............
FBpp0075683  ............
FBpp0077614  ............
FBpp0086749  ............
FBpp0073411  ............
FBpp0070908  ............
FBpp0085842  ............
FBpp0077718  ............
FBpp0296980  ............
FBpp0076600  ............
FBpp0086749  ............
FBpp0085479  ............
FBpp0112016  ............
FBpp0079665  ............
FBpp0084076  ............
FBpp0111406  ............
FBpp0074918  ............
FBpp0082818  ............
FBpp0074480  ............
FBpp0082819  ............
FBpp0085279  ............
FBpp0081805  ............
FBpp0100023  ............
FBpp0071879  ............
FBpp0084559  ............
FBpp0075591  ............
FBpp0076526  ............
FBpp0079851  ............
FBpp0072146  ............
FBpp0296980  ............
FBpp0083238  ............
FBpp0111383  ............
FBpp0071560  ............
FBpp0080424  ............
FBpp0071879  ............
FBpp0292775  ............
FBpp0077934  ............
FBpp0087646  ............
FBpp0079665  ............
FBpp0086749  ............
FBpp0082652  ............
FBpp0077619  ............
FBpp0086164  ............
FBpp0087232  ............
FBpp0072561  ............
FBpp0088148  ............
FBpp0075787  ............
FBpp0083319  ............
FBpp0076499  ............
FBpp0290580  ............
FBpp0080720  ............
FBpp0086164  ............
FBpp0080741  ............
FBpp0087297  ............
FBpp0070720  ............
FBpp0086683  ............
FBpp0289328  ............
FBpp0070667  ............
FBpp0082624  ............
FBpp0081552  ............
FBpp0086749  ............
FBpp0087646  ............
FBpp0071879  ............
FBpp0080894  ............
FBpp0070906  ............
FBpp0087646  ............
FBpp0082112  ............
FBpp0293629  ............
FBpp0076526  ............
FBpp0085279  ............
FBpp0074835  ............
FBpp0078887  ............
FBpp0290580  ............
FBpp0085047  ............
FBpp0296980  ............
FBpp0086380  ............
FBpp0083435  ............
FBpp0078891  ............
FBpp0082419  ............
FBpp0086749  ............
FBpp0078027  ............
FBpp0088148  ............
FBpp0290863  ............
FBpp0080720  ............
FBpp0083319  ............
FBpp0071288  ............
FBpp0081398  ............
FBpp0085016  ............
FBpp0293235  ............
FBpp0290580  ............
FBpp0085012  ............
FBpp0086380  ............
FBpp0071879  ............
FBpp0076961  ............
FBpp0075717  ............
FBpp0080267  ............
FBpp0070908  ............
FBpp0085033  ............
FBpp0082507  ............
FBpp0292775  ............
FBpp0085676  ............
FBpp0087091  ............
FBpp0082624  ............
FBpp0070431  ............
FBpp0075442  ............
FBpp0070906  ............
FBpp0089265  ............
FBpp0078634  ............
FBpp0075754  ............
FBpp0087625  ............
FBpp0071288  ............
FBpp0110159  ............
FBpp0072679  ............
FBpp0082624  ............
FBpp0084254  ............
FBpp0085032  ............

Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:

Model: 0052646 (list models)
Initial SAMT99 seed:

Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues

Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.

Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Drosophila melanogaster 58 (pseudogenes) - Fruit fly
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Bathycoccus prasinos
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Cyanidioschyzon merolae strain 10D 22
NoYes   Cyanidioschyzon merolae
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Giardia lamblia 2.3
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Ichthyophthirius multifiliis strain G5
NoYes   Cryptosporidium hominis
NoYes   Cryptosporidium muris
NoYes   Cryptosporidium parvum Iowa II
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Babesia bovis T2Bo
NoYes   Theileria parva
NoYes   Theileria annulata
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Plasmodium yoelii ssp. yoelii 1
NoYes   Plasmodium chabaudi
NoYes   Plasmodium berghei ANKA
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Acholeplasma laidlawii PG-8A
NoYes   Thermobaculum terrenum ATCC BAA-798
NoYes   Leptolyngbya sp. PCC 7376
NoYes   Pseudanabaena sp. PCC 7367
NoYes   Acaryochloris marina MBIC11017
NoYes   Synechocystis sp. PCC 6803
NoYes   Thermosynechococcus sp. NK55
NoYes   Thermosynechococcus elongatus BP-1
NoYes   Synechococcus sp. PCC 7502
NoYes   Synechococcus sp. PCC 6312
NoYes   Synechococcus sp. CC9311
NoYes   Synechococcus elongatus PCC 7942
NoYes   Prochlorococcus marinus str. MIT 9515
NoYes   Microcoleus sp. PCC 7113
NoYes   Trichodesmium erythraeum IMS101
NoYes   Geitlerinema sp. PCC 7407
NoYes   Cyanothece sp. PCC 8802
NoYes   Gloeocapsa sp. PCC 7428
NoYes   cyanobacterium UCYN-A
NoYes   Halothece sp. PCC 7418
NoYes   Microcystis aeruginosa NIES-843
NoYes   Gloeobacter violaceus PCC 7421
NoYes   Rivularia sp. PCC 7116
NoYes   Calothrix sp. PCC 7507
NoYes   Anabaena variabilis ATCC 29413
NoYes   'Nostoc azollae' 0708
NoYes   Nostoc sp. PCC 7107
NoYes   Nostoc punctiforme PCC 73102
NoYes   Nostoc sp. PCC 7120
NoYes   Nostoc sp. PCC 7524
NoYes   Anabaena sp. 90
NoYes   Conexibacter woesei DSM 14684
NoYes   Cryptobacterium curtum DSM 15641
NoYes   Eggerthella sp. YY7918
NoYes   Eggerthella lenta DSM 2243
NoYes   Slackia heliotrinireducens DSM 20476
NoYes   Olsenella uli DSM 7084
NoYes   Atopobium parvulum DSM 20469
NoYes   Coriobacterium glomerans PW2
NoYes   Rubrobacter xylanophilus DSM 9941
NoYes   Ilumatobacter coccineus
NoYes   Acidimicrobium ferrooxidans DSM 10331
NoYes   Thermobispora bispora DSM 43833
NoYes   Nakamurella multipartita DSM 44233
NoYes   Acidothermus cellulolyticus 11B
NoYes   Modestobacter marinus
NoYes   Blastococcus saxobsidens DD2
NoYes   Geodermatophilus obscurus DSM 43160
NoYes   Kineococcus radiotolerans SRS30216
NoYes   Catenulispora acidiphila DSM 44928
NoYes   Stackebrandtia nassauensis DSM 44728
NoYes   Frankia symbiont of Datisca glomerata
NoYes   Frankia sp. EAN1pec
NoYes   Frankia alni ACN14a
NoYes   Thermobifida fusca YX
NoYes   Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111
NoYes   Thermomonospora curvata DSM 43183
NoYes   Streptosporangium roseum DSM 43021
NoYes   Kitasatospora setae KM-6054
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces sp. PAMC26508
NoYes   Streptomyces flavogriseus ATCC 33331
NoYes   Streptomyces sp. SirexAA-E
NoYes   Streptomyces griseus subsp. griseus NBRC 13350
NoYes   Streptomyces bingchenggensis BCW-1
NoYes   Streptomyces violaceusniger Tu 4113
NoYes   Streptomyces avermitilis MA-4680
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces scabiei 87.22
NoYes   Streptomyces hygroscopicus subsp. jinggangensis 5008
NoYes   Actinosynnema mirum DSM 43827
NoYes   Saccharomonospora viridis DSM 43017
NoYes   Pseudonocardia dioxanivorans CB1190
NoYes   Saccharopolyspora erythraea NRRL 2338
NoYes   Amycolatopsis mediterranei U32
NoYes   Kribbella flavida DSM 17836
NoYes   Nocardioides sp. JS614
NoYes   Propionibacterium propionicum F0230a
NoYes   Propionibacterium acnes SK137
NoYes   Microlunatus phosphovorus NM-1
NoYes   Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1
NoYes   Salinispora arenicola CNS-205
NoYes   Salinispora tropica CNB-440
NoYes   Verrucosispora maris AB-18-032
NoYes   Micromonospora sp. L5
NoYes   Micromonospora aurantiaca ATCC 27029
NoYes   Actinoplanes sp. N902-109
NoYes   Actinoplanes sp. SE50/110
NoYes   Actinoplanes missouriensis 431
NoYes   Segniliparus rotundus DSM 44985
NoYes   Tsukamurella paurometabola DSM 20162
NoYes   Gordonia sp. KTR9
NoYes   Gordonia polyisoprenivorans VH2
NoYes   Gordonia bronchialis DSM 43247
NoYes   Rhodococcus jostii RHA1
NoYes   Rhodococcus equi 103S
NoYes   Rhodococcus opacus B4
NoYes   Rhodococcus erythropolis PR4
NoYes   Nocardia cyriacigeorgica GUH-2
NoYes   Nocardia farcinica IFM 10152
NoYes   Amycolicicoccus subflavus DQS3-9A1
NoYes   Mycobacterium massiliense str. GO 06
NoYes   Mycobacterium abscessus ATCC 19977
NoYes   Mycobacterium sp. JLS
NoYes   Mycobacterium intracellulare ATCC 13950
NoYes   Mycobacterium avium 104
NoYes   Mycobacterium vanbaalenii PYR-1
NoYes   Mycobacterium canettii CIPT 140010059
NoYes   Mycobacterium africanum GM041182
NoYes   Mycobacterium tuberculosis KZN 1435
NoYes   Mycobacterium tuberculosis
NoYes   Mycobacterium bovis BCG str. Pasteur 1173P2
NoYes   Mycobacterium rhodesiae NBB3
NoYes   Mycobacterium ulcerans Agy99
NoYes   Mycobacterium gilvum PYR-GCK
NoYes   Mycobacterium chubuense NBB4
NoYes   Mycobacterium marinum M
NoYes   Mycobacterium smegmatis str. MC2 155
NoYes   Mycobacterium leprae Br4923
NoYes   Corynebacterium resistens DSM 45100
NoYes   Corynebacterium aurimucosum ATCC 700975
NoYes   Corynebacterium kroppenstedtii DSM 44385
NoYes   Corynebacterium efficiens YS-314
NoYes   Corynebacterium ulcerans 0102
NoYes   Corynebacterium urealyticum DSM 7109
NoYes   Corynebacterium jeikeium K411
NoYes   Corynebacterium variabile DSM 44702
NoYes   Corynebacterium pseudotuberculosis 316
NoYes   Corynebacterium glutamicum R
NoYes   Corynebacterium diphtheriae NCTC 13129
NoYes   Sanguibacter keddieii DSM 10542
NoYes   Kytococcus sedentarius DSM 20547
NoYes   Beutenbergia cavernae DSM 12333
NoYes   Leifsonia xyli subsp. xyli str. CTCB07
NoYes   Microbacterium testaceum StLB037
NoYes   Clavibacter michiganensis subsp. michiganensis NCPPB 382
NoYes   Jonesia denitrificans DSM 20603
NoYes   Intrasporangium calvum DSM 43043
NoYes   Brachybacterium faecium DSM 4810
NoYes   Isoptericola variabilis 225
NoYes   Xylanimonas cellulosilytica DSM 15894
NoYes   Cellulomonas flavigena DSM 20109
NoYes   Cellulomonas fimi ATCC 484
NoYes   [Cellvibrio] gilvus ATCC 13127
NoYes   Arthrobacter phenanthrenivorans Sphe3
NoYes   Arthrobacter chlorophenolicus A6
NoYes   Arthrobacter aurescens TC1
NoYes   Arthrobacter arilaitensis Re117
NoYes   Kocuria rhizophila DC2201
NoYes   Rothia mucilaginosa DY-18
NoYes   Rothia dentocariosa ATCC 17931
NoYes   Arthrobacter sp. Rue61a
NoYes   Arthrobacter sp. FB24
NoYes   Renibacterium salmoninarum ATCC 33209
NoYes   Micrococcus luteus NCTC 2665
NoYes   Gardnerella vaginalis 409-05
NoYes   Bifidobacterium longum subsp. longum JDM301
NoYes   Bifidobacterium animalis subsp. lactis Bl-04
NoYes   Bifidobacterium dentium Bd1
NoYes   Bifidobacterium breve ACS-071-V-Sch8b
NoYes   Bifidobacterium bifidum S17
NoYes   Bifidobacterium adolescentis ATCC 15703
NoYes   Arcanobacterium haemolyticum DSM 20595
NoYes   Mobiluncus curtisii ATCC 43063
NoYes   Actinomyces sp. F0330
NoYes   Caldilinea aerophila DSM 14535 = NBRC 104270
NoYes   Dehalococcoides ethenogenes 195
NoYes   Dehalococcoides sp. BAV1
NoYes   Dehalogenimonas lykanthroporepellens BL-DC-9
NoYes   Anaerolinea thermophila UNI-1
NoYes   Thermomicrobium roseum DSM 5159
NoYes   Sphaerobacter thermophilus DSM 20745
NoYes   Herpetosiphon aurantiacus DSM 785
NoYes   Roseiflexus sp. RS-1
NoYes   Roseiflexus castenholzii DSM 13941
NoYes   Chloroflexus sp. MS-G
NoYes   Chloroflexus sp. Y-400-fl
NoYes   Chloroflexus aggregans DSM 9485
NoYes   Chloroflexus aurantiacus J-10-fl
NoYes   Truepera radiovictrix DSM 17093
NoYes   Deinococcus gobiensis I-0
NoYes   Deinococcus deserti VCD115
NoYes   Deinococcus maricopensis DSM 21211
NoYes   Deinococcus geothermalis DSM 11300
NoYes   Deinococcus proteolyticus MRP
NoYes   Deinococcus radiodurans R1
NoYes   Oceanithermus profundus DSM 14977
NoYes   Marinithermus hydrothermalis DSM 14884
NoYes   Meiothermus silvanus DSM 9946
NoYes   Meiothermus ruber DSM 1279
NoYes   Thermus sp. CCB_US3_UF1
NoYes   Thermus scotoductus SA-01
NoYes   Thermus thermophilus HB27
NoYes   Anaerococcus prevotii DSM 20548
NoYes   Finegoldia magna ATCC 29328
NoYes   Veillonella parvula DSM 2008
NoYes   Megasphaera elsdenii DSM 20460
NoYes   Acidaminococcus intestini RyC-MR95
NoYes   Acidaminococcus fermentans DSM 20731
NoYes   Megamonas hypermegale
NoYes   Selenomonas sputigena ATCC 35185
NoYes   Selenomonas ruminantium subsp. lactilytica TAM6421
NoYes   Erysipelothrix rhusiopathiae str. Fujisawa
NoYes   Natranaerobius thermophilus JW/NM-WN-LF
NoYes   Symbiobacterium thermophilum IAM 14863
NoYes   Clostridiales genomosp. BVAB3 str. UPII9-5
NoYes   Clostridium clariflavum DSM 19732
NoYes   Eubacterium siraeum
NoYes   Clostridium cellulolyticum H10
NoYes   Clostridium thermocellum ATCC 27405
NoYes   Ethanoligenens harbinense YUAN-3
NoYes   Faecalibacterium prausnitzii
NoYes   Ruminococcus sp.
NoYes   Ruminococcus bromii
NoYes   Ruminococcus albus 7
NoYes   Thermaerobacter marianensis DSM 12885
NoYes   Sulfobacillus acidophilus DSM 10332
NoYes   Oscillibacter valericigenes Sjm18-20
NoYes   butyrate-producing bacterium SS3/4
NoYes   butyrate-producing bacterium SM4/1
NoYes   Candidatus Desulforudis audaxviator MP104C
NoYes   Thermincola potens JR
NoYes   Pelotomaculum thermopropionicum SI
NoYes   Desulfosporosinus acidiphilus SJ4
NoYes   Desulfosporosinus orientis DSM 765
NoYes   Dehalobacter sp. DCA
NoYes   Dehalobacter sp. CF
NoYes   Syntrophobotulus glycolicus DSM 8271
NoYes   Desulfitobacterium hafniense Y51
NoYes   Desulfitobacterium dehalogenans ATCC 51507
NoYes   Desulfotomaculum reducens MI-1
NoYes   Desulfotomaculum acetoxidans DSM 771
NoYes   Desulfotomaculum kuznetsovii DSM 6115
NoYes   Desulfotomaculum carboxydivorans CO-1-SRB
NoYes   Desulfotomaculum ruminis DSM 2154
NoYes   Acetobacterium woodii DSM 1030
NoYes   Eubacterium eligens ATCC 27750
NoYes   Eubacterium limosum KIST612
NoYes   Clostridium difficile 630
NoYes   Clostridium sticklandii DSM 519
NoYes   Filifactor alocis ATCC 35896
NoYes   Clostridium saccharolyticum WM1
NoYes   Clostridium phytofermentans ISDg
NoYes   Clostridium lentocellum DSM 5427
NoYes   [Ruminococcus] obeum
NoYes   [Ruminococcus] torques
NoYes   Eubacterium rectale M104/1
NoYes   Eubacterium rectale ATCC 33656
NoYes   Coprococcus sp. ART55/1
NoYes   Roseburia hominis A2-183
NoYes   Roseburia intestinalis
NoYes   Butyrivibrio proteoclasticus B316
NoYes   Butyrivibrio fibrisolvens
NoYes   Syntrophothermus lipocalidus DSM 12680
NoYes   Syntrophomonas wolfei subsp. wolfei str. Goettingen
NoYes   Heliobacterium modesticaldum Ice1
NoYes   Alkaliphilus oremlandii OhILAs
NoYes   Alkaliphilus metalliredigens QYMF
NoYes   Candidatus Arthromitus sp. SFB-mouse-Japan
NoYes   Clostridium sp. BNL1100
NoYes   Clostridium novyi NT
NoYes   Clostridium ljungdahlii DSM 13528
NoYes   Clostridium kluyveri DSM 555
NoYes   Clostridium beijerinckii NCIMB 8052
NoYes   Clostridium tetani E88
NoYes   Clostridium perfringens ATCC 13124
NoYes   Clostridium cellulovorans 743B
NoYes   Clostridium botulinum A str. ATCC 3502
NoYes   Clostridium acetobutylicum ATCC 824
NoYes   Mahella australiensis 50-1 BON
NoYes   Thermosediminibacter oceani DSM 16646
NoYes   Caldicellulosiruptor obsidiansis OB47
NoYes   Caldicellulosiruptor kronotskyensis 2002
NoYes   Caldicellulosiruptor hydrothermalis 108
NoYes   Caldicellulosiruptor owensensis OL
NoYes   Caldicellulosiruptor lactoaceticus 6A
NoYes   Caldicellulosiruptor kristjanssonii 177R1B
NoYes   Caldicellulosiruptor saccharolyticus DSM 8903
NoYes   Caldicellulosiruptor bescii DSM 6725
NoYes   Thermoanaerobacterium xylanolyticum LX-11
NoYes   Thermoanaerobacterium thermosaccharolyticum DSM 571
NoYes   Thermodesulfobium narugense DSM 14796
NoYes   Coprothermobacter proteolyticus DSM 5265
NoYes   Tepidanaerobacter acetatoxydans Re1
NoYes   Thermoanaerobacter tengcongensis MB4
NoYes   Carboxydothermus hydrogenoformans Z-2901
NoYes   Moorella thermoacetica ATCC 39073
NoYes   Ammonifex degensii KC4
NoYes   Thermoanaerobacter mathranii subsp. mathranii str. A3
NoYes   Thermoanaerobacter pseudethanolicus ATCC 33223
NoYes   Thermoanaerobacter sp. X514
NoYes   Thermoanaerobacter italicus Ab9
NoYes   Thermoanaerobacter wiegelii Rt8.B1
NoYes   Thermoanaerobacter brockii subsp. finnii Ako-1
NoYes   Acetohalobium arabaticum DSM 5501
NoYes   Halothermothrix orenii H 168
NoYes   Halanaerobium hydrogeniformans
NoYes   Halanaerobium praevalens DSM 2228
NoYes   Carnobacterium sp. 17-4
NoYes   Carnobacterium sp. WN1359
NoYes   Aerococcus urinae ACS-120-V-Col10a
NoYes   Tetragenococcus halophilus NBRC 12172
NoYes   Melissococcus plutonius DAT561
NoYes   Enterococcus sp. 7L76
NoYes   Enterococcus hirae ATCC 9790
NoYes   Enterococcus faecium Aus0004
NoYes   Enterococcus faecalis 62
NoYes   Weissella koreensis KACC 15510
NoYes   Oenococcus oeni PSU-1
NoYes   Leuconostoc sp. C2
NoYes   Leuconostoc kimchii IMSNU 11154
NoYes   Leuconostoc citreum KM20
NoYes   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
NoYes   Leuconostoc gasicomitatum LMG 18811
NoYes   Lactobacillus casei ATCC 334
NoYes   Lactobacillus kefiranofaciens ZW3
NoYes   Lactobacillus crispatus ST1
NoYes   Lactobacillus rhamnosus Lc 705
NoYes   Lactobacillus johnsonii FI9785
NoYes   Lactobacillus sanfranciscensis TMW 1.1304
NoYes   Lactobacillus salivarius CECT 5713
NoYes   Lactobacillus ruminis ATCC 27782
NoYes   Lactobacillus fermentum IFO 3956
NoYes   Lactobacillus amylovorus GRL1118
NoYes   Lactobacillus sakei subsp. sakei 23K
NoYes   Lactobacillus reuteri DSM 20016
NoYes   Lactobacillus gasseri ATCC 33323
NoYes   Lactobacillus plantarum JDM1
NoYes   Lactobacillus helveticus DPC 4571
NoYes   Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365
NoYes   Lactobacillus buchneri NRRL B-30929
NoYes   Lactobacillus buchneri
NoYes   Lactobacillus brevis ATCC 367
NoYes   Lactobacillus acidophilus 30SC
NoYes   Pediococcus claussenii ATCC BAA-344
NoYes   Pediococcus pentosaceus ATCC 25745
NoYes   Lactococcus garvieae ATCC 49156
NoYes   Lactococcus lactis subsp. cremoris MG1363
NoYes   Streptococcus sp. I-P16
NoYes   Streptococcus sp. I-G2
NoYes   Streptococcus intermedius JTH08
NoYes   Streptococcus gallolyticus UCN34
NoYes   Streptococcus pseudopneumoniae IS7493
NoYes   Streptococcus pasteurianus ATCC 43144
NoYes   Streptococcus equi subsp. equi 4047
NoYes   Streptococcus dysgalactiae subsp. equisimilis GGS_124
NoYes   Streptococcus infantarius subsp. infantarius CJ18
NoYes   Streptococcus macedonicus ACA-DC 198
NoYes   Streptococcus mitis B6
NoYes   Streptococcus uberis 0140J
NoYes   Streptococcus parauberis KCTC 11537
NoYes   Streptococcus parasanguinis ATCC 15912
NoYes   Streptococcus pyogenes str. Manfredo
NoYes   Streptococcus pneumoniae P1031
NoYes   Streptococcus agalactiae A909
NoYes   Streptococcus mutans NN2025
NoYes   Streptococcus thermophilus LMD-9
NoYes   Streptococcus suis P1/7
NoYes   Streptococcus sanguinis SK36
NoYes   Streptococcus salivarius 57.I
NoYes   Streptococcus oralis Uo5
NoYes   Streptococcus gordonii str. Challis substr. CH1
NoYes   Exiguobacterium sp. MH3
NoYes   Exiguobacterium sp. AT1b
NoYes   Exiguobacterium sibiricum 255-15
NoYes   Kyrpidia tusciae DSM 2912
NoYes   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
NoYes   Brevibacillus brevis NBRC 100599
NoYes   Paenibacillus sp. JDR-2
NoYes   Paenibacillus terrae HPL-003
NoYes   Paenibacillus mucilaginosus 3016
NoYes   Paenibacillus polymyxa M1
NoYes   Bacillus selenitireducens MLS10
NoYes   Listeria welshimeri serovar 6b str. SLCC5334
NoYes   Listeria innocua Clip11262
NoYes   Listeria seeligeri serovar 1/2b str. SLCC3954
NoYes   Listeria monocytogenes serotype 4b str. CLIP 80459
NoYes   Listeria ivanovii subsp. ivanovii PAM 55
NoYes   Solibacillus silvestris StLB046
NoYes   Geobacillus thermoglucosidasius C56-YS93
NoYes   Lysinibacillus sphaericus C3-41
NoYes   Oceanobacillus iheyensis HTE831
NoYes   Anoxybacillus flavithermus WK1
NoYes   Geobacillus thermoleovorans CCB_US3_UF5
NoYes   Geobacillus kaustophilus HTA426
NoYes   Geobacillus sp. GHH01
NoYes   Geobacillus sp. WCH70
NoYes   Geobacillus thermodenitrificans NG80-2
NoYes   Halobacillus halophilus DSM 2266
NoYes   Bacillus sp. JS
NoYes   butyrate-producing bacterium SSC/2
NoYes   Bacillus sp. 1NLA3E
NoYes   Bacillus amyloliquefaciens FZB42
NoYes   Bacillus atrophaeus 1942
NoYes   Bacillus subtilis subsp. subtilis str. 168
NoYes   Bacillus licheniformis DSM 13 = ATCC 14580
NoYes   Bacillus halodurans C-125
NoYes   Bacillus weihenstephanensis KBAB4
NoYes   Bacillus thuringiensis str. Al Hakam
NoYes   Bacillus cereus 03BB102
NoYes   Bacillus anthracis str. A0248
NoYes   Bacillus pseudofirmus OF4
NoYes   Bacillus clausii KSM-K16
NoYes   Bacillus cellulosilyticus DSM 2522
NoYes   Bacillus pumilus SAFR-032
NoYes   Bacillus megaterium DSM 319
NoYes   Bacillus coagulans 2-6
NoYes   Macrococcus caseolyticus JCSC5402
NoYes   Staphylococcus pseudintermedius HKU10-03
NoYes   Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305
NoYes   Staphylococcus lugdunensis HKU09-01
NoYes   Staphylococcus haemolyticus JCSC1435
NoYes   Staphylococcus epidermidis RP62A
NoYes   Staphylococcus carnosus subsp. carnosus TM300
NoYes   Staphylococcus aureus subsp. aureus JH1
NoYes   Staphylococcus aureus
NoYes   Candidatus Cloacamonas acidaminovorans
NoYes   Gemmatimonas aurantiaca T-27
NoYes   Melioribacter roseus P3M
NoYes   Ignavibacterium album JCM 16511
NoYes   Pelodictyon phaeoclathratiforme BU-1
NoYes   Chlorobium luteolum DSM 273
NoYes   Chlorobium chlorochromatii CaD3
NoYes   Chlorobium phaeobacteroides DSM 266
NoYes   Chlorobium phaeovibrioides DSM 265
NoYes   Chlorobium limicola DSM 245
NoYes   Chlorobaculum parvum NCIB 8327
NoYes   Chlorobium tepidum TLS
NoYes   Chloroherpeton thalassium ATCC 35110
NoYes   Prosthecochloris aestuarii DSM 271
NoYes   Haliscomenobacter hydrossis DSM 1100
NoYes   Saprospira grandis str. Lewin
NoYes   Niastella koreensis GR20-10
NoYes   Chitinophaga pinensis DSM 2588
NoYes   Salinibacter ruber M8
NoYes   Rhodothermus marinus DSM 4252
NoYes   Flexibacter litoralis DSM 6794
NoYes   Candidatus Amoebophilus asiaticus 5a2
NoYes   Candidatus Cardinium hertigii
NoYes   Belliella baltica DSM 15883
NoYes   Cyclobacterium marinum DSM 745
NoYes   Marivirga tractuosa DSM 4126
NoYes   Fibrella aestuarina
NoYes   Leadbetterella byssophila DSM 17132
NoYes   Dyadobacter fermentans DSM 18053
NoYes   Cytophaga hutchinsonii ATCC 33406
NoYes   Spirosoma linguale DSM 74
NoYes   Runella slithyformis DSM 19594
NoYes   Parabacteroides distasonis ATCC 8503
NoYes   Tannerella forsythia ATCC 43037
NoYes   Paludibacter propionicigenes WB4
NoYes   Odoribacter splanchnicus DSM 20712
NoYes   Candidatus Azobacteroides pseudotrichonymphae genomovar. CFP2
NoYes   Bacteroides sp. CF50
NoYes   Prevotella melaninogenica ATCC 25845
NoYes   Prevotella intermedia 17
NoYes   Prevotella denticola F0289
NoYes   Prevotella ruminicola 23
NoYes   Porphyromonas asaccharolytica DSM 20707
NoYes   Porphyromonas gingivalis ATCC 33277
NoYes   Alistipes finegoldii DSM 17242
NoYes   Bacteroides salanitronis DSM 18170