SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

TPR-like alignments in Drosophila melanogaster FlyBase 5.12

These alignments are sequences aligned to the 0051642 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1zu2a1        mdtetefdrillfeq......................................................................
FBpp0112456  aqqvvelrpydieswsvmireaqtrpihevrslyeslvnvfpttarywklyiememrsryyerveklfqrclvkilnidlwklyl
FBpp0112455  aqqvvelrpydieswsvmireaqtrpihevrslyeslvnvfpttarywklyiememrsryyerveklfqrclvkilnidlwklyl
FBpp0070352  daykeyefaegnpmsdvenpfe...............................................................
FBpp0070351  daykeyefaegnpmsdvenpfe...............................................................
FBpp0070402  ednlrknrmvvshwikya...................................................................
FBpp0080138  lyrslytaskqlddakrnvqsvgqlfqheieekrsllvqlckqiifkdyqsvgkkvrevmwrrgyyefiafvkknwhkqcqdaat
FBpp0080139  lyrslytaskqlddakrnvqsvgqlfqheieekrsllvqlckqiifkdyqsvgkkvrevmwrrgyyefiafvkknwhkqcqdaat
FBpp0074609  qkalqlmaeaekkltqqkgf.................................................................
FBpp0084171  nivhlydqlmvlnqrnlilinwknfcyihdqlqdafkqllleqlkfvcehkvdvffwkllfynvrnylkrqqtdqahth......
FBpp0085420  geiwlaihhfekavtldpnfldayinlgnvlkearifdravaaylralnlspnnavvhg..........................
FBpp0085421  geiwlaihhfekavtldpnfldayinlgnvlkearifdravaaylralnlspnnavvhg..........................
FBpp0085422  geiwlaihhfekavtldpnfldayinlgnvlkearifdravaaylralnlspnnavvhg..........................
FBpp0085420  lelahreyqavdyesaekhcmqlwrqdstntgvllllssihfqcrrldksaqfstlaikqnpvlaeays................
FBpp0085421  lelahreyqavdyesaekhcmqlwrqdstntgvllllssihfqcrrldksaqfstlaikqnpvlaeays................
FBpp0085422  lelahreyqavdyesaekhcmqlwrqdstntgvllllssihfqcrrldksaqfstlaikqnpvlaeays................
FBpp0077790  farkeke..............................................................................
FBpp0082545  eqlfksalqvcpdnakvh...................................................................
FBpp0084693  vtarwsfeegikrpyfhvkpleraqlknwkdyldfeiekgdrervlvlfercliacalydefwlkmlrylesledqsgvvdlvrd
FBpp0084691  vtarwsfeegikrpyfhvkpleraqlknwkdyldfeiekgdrervlvlfercliacalydefwlkmlrylesledqsgvvdlvrd
FBpp0084692  vtarwsfeegikrpyfhvkpleraqlknwkdyldfeiekgdrervlvlfercliacalydefwlkmlrylesledqsgvvdlvrd
FBpp0084694  vtarwsfeegikrpyfhvkpleraqlknwkdyldfeiekgdrervlvlfercliacalydefwlkmlrylesledqsgvvdlvrd
FBpp0112211  vtarwsfeegikrpyfhvkpleraqlknwkdyldfeiekgdrervlvlfercliacalydefwlkmlrylesledqsgvvdlvrd
FBpp0072096  aeaedlvkqaekslklsmlkwvpdydsaadeyska..................................................
FBpp0071560  pqakpgvsyhariapnhlnvfinlanliaknqtrleeadhlyrqaismrsdyvqayi............................
FBpp0071561  pqakpgvsyhariapnhlnvfinlanliaknqtrleeadhlyrqaismrsdyvqayi............................
FBpp0077790  ekaeeeke.............................................................................
FBpp0076600  pvtwcvs..............................................................................
FBpp0271716  medllnevvpqedlerfekkyhheleldgevttdtkfeyafclvrsryt....................................
FBpp0077790  kvnelke..............................................................................
FBpp0271718  medllnevvpqedlerfekkyhheleldgevttdtkfeyafclvrsryt....................................
FBpp0290895  dwrdeeqlfrsaisinppkalg...............................................................
FBpp0290896  eeqlfrsaisinppkalg...................................................................
FBpp0081673  eeaealigqtdsa........................................................................
FBpp0111849  pkalg................................................................................
FBpp0077614  eslyrsaiainppkalg....................................................................
FBpp0084692  r....................................................................................
FBpp0084694  r....................................................................................
FBpp0112211  r....................................................................................
FBpp0084691  r....................................................................................
FBpp0084693  r....................................................................................
FBpp0076382  alklhqahlgiarslgdrtgmgkayg...........................................................
FBpp0076382  qs...................................................................................
FBpp0080535  laesik...............................................................................
FBpp0072164  qykkandikd...........................................................................
FBpp0084016  tisfretqelrnmwsallnmelvysnnfddvlkealncndpleiyisvvdilkknkrkdrlssvltt..................
FBpp0076382  draralgh.............................................................................
FBpp0076382  ckdtqaaaaalts........................................................................
FBpp0080894  petccv...............................................................................
FBpp0081606  aeqyk................................................................................
FBpp0081607  aeqyk................................................................................
FBpp0084559  ravefyqenlklmrdlgdrgaqgracg..........................................................
FBpp0075683  enhpavaatl...........................................................................
FBpp0081284  evsdagsykd...........................................................................
FBpp0079468  rlaeakvyke...........................................................................
FBpp0087297  qqqdeartyfelavqsgrklesyvr............................................................
FBpp0074835  klwm.................................................................................
FBpp0079893  gtfhllcgsyvesqqdfdaiiandyadpnlrayayik................................................
FBpp0079894  gtfhllcgsyvesqqdfdaiiandyadpnlrayayik................................................
FBpp0079895  gtfhllcgsyvesqqdfdaiiandyadpnlrayayik................................................
FBpp0082765  ltankekadklkve.......................................................................
FBpp0079617  qlke.................................................................................
FBpp0084440  qfaerhr..............................................................................
FBpp0080423  iaeekkk..............................................................................
FBpp0080424  aeekkk...............................................................................
FBpp0085344  esfekalkfsfgeqhvwrqyglslmaaekhshalrvlqesmkltpsdplpcllasrlcyesletvkqgldyaqqalkrevkglrp
FBpp0081552  aspadienhle..........................................................................
FBpp0087646  dcktfeayll...........................................................................
FBpp0083769  clvengdfnrlfyvahklvdrypdkaisw........................................................
FBpp0070572  kateeeveqaselra......................................................................
FBpp0070573  kateeeveqaselra......................................................................
FBpp0070575  kateeeveqaselra......................................................................
FBpp0074835  rdqwfqeaieaeksgavnccqsivkavigigveeedrkqtwidda........................................
FBpp0080424  mken.................................................................................
FBpp0080423  mken.................................................................................
FBpp0076113  qs...................................................................................
FBpp0076114  qs...................................................................................
FBpp0076115  qs...................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0072561  dqshllgrayfcllegdkmdqadaqfnfvlnqspsnipsllg...........................................
FBpp0072562  dqshllgrayfcllegdkmdqadaqfnfvlnqspsnipsllg...........................................
FBpp0085923  pteievykke...........................................................................
FBpp0079893  eannykte.............................................................................
FBpp0079894  eannykte.............................................................................
FBpp0079895  eannykte.............................................................................
FBpp0075683  lrtlhnlv.............................................................................
FBpp0077614  eilyqr...............................................................................
FBpp0085409  ileelarthpdgrrdy.....................................................................
FBpp0271717  ileelarthpdgrrd......................................................................
FBpp0271719  ileelarthpdgrrd......................................................................
FBpp0086749  rslkvwsmyadlees......................................................................
FBpp0073411  dekmlatstlre.........................................................................
FBpp0070907  mm...................................................................................
FBpp0073412  dekmlatstlre.........................................................................
FBpp0070908  mm...................................................................................
FBpp0085842  trkke................................................................................
FBpp0077718  fqflyyheadvqkahslcqavleverqkpsgstgctlswwwqqqmgrcllalhyprraepflqqsltsfphpdtylllsrvyqri
FBpp0076600  esdeti...............................................................................
FBpp0076382  fralg................................................................................
FBpp0071712  ia...................................................................................
FBpp0086749  ehfvskhgksnhqlwnelcdlisknphkvhslnvdaiirgglrrytdqlghl.................................
FBpp0085479  lalnyked.............................................................................
FBpp0112016  ia...................................................................................
FBpp0292906  kk...................................................................................
FBpp0079665  .....................................................................................
FBpp0079666  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0084076  aelqrs...............................................................................
FBpp0111406  rvaqnfrk.............................................................................
FBpp0074918  a....................................................................................
FBpp0082818  pgslrvmkf............................................................................
FBpp0074480  elkqyknglklakqilsnpkymehgetlamk......................................................
FBpp0111849  ssayl................................................................................
FBpp0082819  ldtarfdiatkctkqlalefpgslrvmkf........................................................
FBpp0292061  svad.................................................................................
FBpp0085279  laealskakeafsldrtlhqfrdqhgenvyhnfdltyaqyersemhiealntysimaknkmfphvnqlkl...............
FBpp0081805  afrsvad..............................................................................
FBpp0100021  wsadecl..............................................................................
FBpp0100023  wsadecl..............................................................................
FBpp0074877  wsadeclm.............................................................................
FBpp0071879  slq..................................................................................
FBpp0084559  gtedlrtlsaiys........................................................................
FBpp0075591  srelel...............................................................................
FBpp0076526  ekarsdgnrdqvavscn....................................................................
FBpp0079851  lhin.................................................................................
FBpp0290395  l....................................................................................
FBpp0072146  lhlh.................................................................................
FBpp0076382  qarals...............................................................................
FBpp0083238  e....................................................................................
FBpp0111383  eqredvaetfrr.........................................................................
FBpp0080424  yd...................................................................................
FBpp0071560  qaalailllthalkthqrnldwrteyslfmsgv....................................................
FBpp0071561  qaalailllthalkthqrnldwrteyslfmsgv....................................................
FBpp0080423  yd...................................................................................
FBpp0071879  pknilalig............................................................................
FBpp0077738  mdaalavyhkaedwfsqvkilcylgkiskad......................................................
FBpp0077934  lrdlvd...............................................................................
FBpp0292775  mdaalavyhkaedwfsqvkilcylgkiskad......................................................
FBpp0087646  n....................................................................................
FBpp0292906  dehyvnalck...........................................................................
FBpp0079664  dehyvnalck...........................................................................
FBpp0086749  .....................................................................................
FBpp0082652  adsfrr...............................................................................
FBpp0077619  n....................................................................................
FBpp0086164  ltadrvelymdite.......................................................................
FBpp0087232  aaeike...............................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0088148  eavrtwrsalkgtcqredcfqllgylyq.........................................................
FBpp0088149  eavrtwrsalkgtcqredcfqllgylyq.........................................................
FBpp0075786  lled.................................................................................
FBpp0075788  lled.................................................................................
FBpp0075787  lled.................................................................................
FBpp0075789  lled.................................................................................
FBpp0075785  lled.................................................................................
FBpp0083319  nkfg.................................................................................
FBpp0076498  se...................................................................................
FBpp0290580  .....................................................................................
FBpp0290395  avf..................................................................................
FBpp0080720  w....................................................................................
FBpp0086164  lmge.................................................................................
FBpp0080741  davamarratvliaeigrdknmeifcdtfle......................................................
FBpp0087297  .....................................................................................
FBpp0070720  hvwlkylkarlvvtqtdeerkafeeqcakalgyyysiplseyvvnylvdqgnvqnhvlwaklladydverpdfgdklrslistit
FBpp0089396  hvwlkylkarlvvtqtdeerkafeeqcakalgyyysiplseyvvnylvdqgnvqnhvlwaklladydverpdfgdklrslistit
FBpp0111789  hvwlkylkarlvvtqtdeerkafeeqcakalgyyysiplseyvvnylvdqgnvqnhvlwaklladydverpdfgdklrslistit
FBpp0086683  kahtlfq..............................................................................
FBpp0289328  nllnqvdqlgekfealrmylssvgyelhrslnekvqyvsnpinafsllrrthedlpkwheyfkeaigegnqsilvdlvkmvpndv
FBpp0070667  dglqhhpaswkfhtlssyy..................................................................
FBpp0082624  qqls.................................................................................
FBpp0081552  re...................................................................................
FBpp0086749  rtr..................................................................................
FBpp0087646  ainwyvqneetdatpaslsf.................................................................
FBpp0071879  v....................................................................................
FBpp0080894  ygvvlkalnlnqaaeqmlvqairlvpmlwsaylelsplimekkkllslqlgghwmrhffmahtylelylnddglkiyedlqasgf
FBpp0112213  r....................................................................................
FBpp0087233  eirv.................................................................................
FBpp0070906  ystgdfscaqdhvdkavnimqhlvpsnhlmlasakrvkallleeialdkmadgideedlllqseelhnfalllslqvfgev....
FBpp0087646  i....................................................................................
FBpp0082112  eyaalkaqqyyimkdfqmaakqlmrinnectqagtitpqlstcian.......................................
FBpp0086359  f....................................................................................
FBpp0076526  ltssvdyaklkglyeklgdgc................................................................
FBpp0085279  el...................................................................................
FBpp0074835  le...................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  tadtlnd..............................................................................
FBpp0085047  qynsslkpidclaigl.....................................................................
FBpp0086380  hpstileythlslysfanghvgmslkllyrarylmvlicged...........................................
FBpp0083435  gingqaveelfiqiq......................................................................
FBpp0078891  whlat................................................................................
FBpp0082419  asglptsassedlsqslseytdadesvsapteflaeflsav............................................
FBpp0082420  asglptsassedlsqslseytdadesvsapteflaeflsav............................................
FBpp0086749  eeeilrnaysvkhwlryidhkakapnngvnm......................................................
FBpp0078027  ieqgiykd.............................................................................
FBpp0088148  hra..................................................................................
FBpp0088149  hra..................................................................................
FBpp0290863  mysd.................................................................................
FBpp0080720  qreqydkaeqmlhlalrmaqdiqskdgityvfdl...................................................
FBpp0083319  v....................................................................................
FBpp0071288  qrmiiddmqekfprepglwdllaqrelrgfhlgdleeedldtsdeepaskksrsvngrslkrriqlcvtvyksaveelqttemwn
FBpp0081398  elfs.................................................................................
FBpp0085015  rwrec................................................................................
FBpp0084188  v....................................................................................
FBpp0290580  lr...................................................................................
FBpp0085012  syvnhdyyhtvlwmneamarmleeptnhtqsftk...................................................
FBpp0086380  tdaynf...............................................................................
FBpp0076382  spfvvssv.............................................................................
FBpp0071879  ns...................................................................................
FBpp0076961  pteqqrw..............................................................................
FBpp0075717  lqqalmaanlavmrapdrnadpvldeglt........................................................
FBpp0080267  agndsyr..............................................................................
FBpp0070907  nyk..................................................................................
FBpp0085033  lsv..................................................................................
FBpp0082507  qclqalftfmppskvear...................................................................
FBpp0077738  i....................................................................................
FBpp0292775  i....................................................................................
FBpp0085676  sdevlh...............................................................................
FBpp0087091  vefrmlgneqfs.........................................................................
FBpp0082624  sm...................................................................................
FBpp0070908  eqrrr................................................................................
FBpp0070431  lnvwyvktldaafea......................................................................
FBpp0075442  qahdmv...............................................................................
FBpp0089265  lrv..................................................................................
FBpp0075443  qahdmv...............................................................................
FBpp0070906  iidvlrqa.............................................................................
FBpp0073018  lrv..................................................................................
FBpp0078634  ainelsivlaskeeynkgleilleaekiyedfkasglkplaiqdvfnppeegqqsheagpkelesly..................
FBpp0087626  sknlreegnlmfkesasgsskdsvlkacrl.......................................................
FBpp0075754  yfslvgllrv...........................................................................
FBpp0087625  sknlreegnlmfkesasgsskdsvlkacrl.......................................................
FBpp0071288  r....................................................................................
FBpp0085046  lamgrhlmnqsrwtiaeqwilagikaqdrkgpqtemi................................................
FBpp0110159  lamgrhlmnqsrwtiaeqwilagikaqdrkgpqtemi................................................
FBpp0072679  qraeisafygefeeaeklyldadrrdlaielrmtlcdwfrvvqlyrmggsgvs................................
FBpp0082624  wi...................................................................................
FBpp0084254  mamsmye..............................................................................
FBpp0085032  t....................................................................................


                                                                                                    
                                                                                                    
d1zu2a1        .....................................................................................
FBpp0112456  tyvketksglsthkekmaqaydfalekigmdlhsfsiwqdyiyflrgveavgnyaenqkitavrrvyqkavvtpivgieqlwkdy
FBpp0112455  tyvketksglsthkekmaqaydfalekigmdlhsfsiwqdyiyflrgveavgnyaenqkitavrrvyqkavvtpivgieqlwkdy
FBpp0070352  .....................................................................................
FBpp0070351  .....................................................................................
FBpp0070402  .....................................................................................
FBpp0080138  aqenmqklerflcagifnykrlsarmeeiydldlkylidfsiisdgyisdmigdtmesshsgthavdksleavsfaldtihssll
FBpp0080139  aqenmqklerflcagifnykrlsarmeeiydldlkylidfsiisdgyisdmigdtmesshsgthavdksleavsfaldtihssll
FBpp0074609  .....................................................................................
FBpp0084171  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084693  vyrracrihhpdkpslhlmwaafe.............................................................
FBpp0084691  vyrracrihhpdkpslhlmwaafe.............................................................
FBpp0084692  vyrracrihhpdkpslhlmwaafe.............................................................
FBpp0084694  vyrracrihhpdkpslhlmwaafe.............................................................
FBpp0112211  vyrracrihhpdkpslhlmwaafe.............................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0271718  .....................................................................................
FBpp0290895  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0111849  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0081607  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0085344  srsqlfvgighqqlaiqsnlkserdachklaldaleravqfdgndhlaeyylslqyallgqlaealvhirfalalrmehapclhl
FBpp0081552  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070573  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0076114  .....................................................................................
FBpp0076115  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0085409  .....................................................................................
FBpp0271717  .....................................................................................
FBpp0271719  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0073412  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0077718  kqperallvigevvdsrpfdvtyrle...........................................................
FBpp0076600  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0071712  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0079666  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  .....................................................................................
FBpp0111849  .....................................................................................
FBpp0082819  .....................................................................................
FBpp0292061  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0081805  .....................................................................................
FBpp0100021  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0074877  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0087232  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0075786  .....................................................................................
FBpp0075788  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0075789  .....................................................................................
FBpp0075785  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076498  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  deneaaafvemlqkhcvtwtcnveqrqmiksvvdkfkqhldettrgwdwseqhkahvydvetlsldddlknavirfifersvakf
FBpp0089396  deneaaafvemlqkhcvtwtcnveqrqmiksvvdkfkqhldettrgwdwseqhkahvydvetlsldddlknavirfifersvakf
FBpp0111789  deneaaafvemlqkhcvtwtcnveqrqmiksvvdkfkqhldettrgwdwseqhkahvydvetlsldddlknavirfifersvakf
FBpp0086683  .....................................................................................
FBpp0289328  dmlsamhgiqriekiydlkiddlaqgvlqgvqynvqltyrdlia.........................................
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  sksiylia.............................................................................
FBpp0112213  .....................................................................................
FBpp0087233  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0082112  .....................................................................................
FBpp0086359  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085047  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0082420  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0071288  myldamlalnsdgkterilkqqcladalqaghrsqlmgvkhyatlrkmlctapsgreaavtiltealkndssvemhelllathiq
FBpp0081398  .....................................................................................
FBpp0085015  .....................................................................................
FBpp0084188  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  .....................................................................................
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075442  .....................................................................................
FBpp0089265  .....................................................................................
FBpp0075443  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0073018  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0087626  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0085046  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................


                                                                                                    
                                                                                                    
d1zu2a1        .....................................................................................
FBpp0112456  iafeqninpiisekmslerskdymnarrvakeleyhtkglnrnlpavpptltkeevkqvelwkrfityeksnplrtedtalvtrr
FBpp0112455  iafeqninpiisekmslerskdymnarrvakeleyhtkglnrnlpavpptltkeevkqvelwkrfityeksnplrtedtalvtrr
FBpp0070352  .....................................................................................
FBpp0070351  .....................................................................................
FBpp0070402  .....................................................................................
FBpp0080138  slgdlhryfldfridsklsisk...............................................................
FBpp0080139  slgdlhryfldfridsklsisk...............................................................
FBpp0074609  .....................................................................................
FBpp0084171  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0271718  .....................................................................................
FBpp0290895  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0111849  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0081607  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0085344  fallltssrrprealgvvedalhefpdnlqllhvkahlqlhledaetalgtvqhmlavwrdvyeaqlageeekhsdtksgvhlah
FBpp0081552  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070573  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0076114  .....................................................................................
FBpp0076115  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0085409  .....................................................................................
FBpp0271717  .....................................................................................
FBpp0271719  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0073412  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0071712  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0079666  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  .....................................................................................
FBpp0111849  .....................................................................................
FBpp0082819  .....................................................................................
FBpp0292061  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0081805  .....................................................................................
FBpp0100021  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0074877  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0087232  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0075786  .....................................................................................
FBpp0075788  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0075789  .....................................................................................
FBpp0075785  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076498  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  pivdvlwlsyiefiqfegvtvpenedenevtaemvakrakrlgkgflrnteldl...............................
FBpp0089396  pivdvlwlsyiefiqfegvtvpenedenevtaemvakrakrlgkgflrnteldl...............................
FBpp0111789  pivdvlwlsyiefiqfegvtvpenedenevtaemvakrakrlgkgflrnteldl...............................
FBpp0086683  .....................................................................................
FBpp0289328  .....................................................................................
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0112213  .....................................................................................
FBpp0087233  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0082112  .....................................................................................
FBpp0086359  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085047  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0082420  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0071288  sdsepliyelfnkiqksmgsealplwrsvilyyrtrqdslgarrldeiyglackaawp...........................
FBpp0081398  .....................................................................................
FBpp0085015  .....................................................................................
FBpp0084188  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  .....................................................................................
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075442  .....................................................................................
FBpp0089265  .....................................................................................
FBpp0075443  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0073018  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0087626  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0085046  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................


                                                                                   10        20     
                                                                                    |         |     
d1zu2a1        ............................................................---------------IRQDAENTYK
FBpp0112456  ...............................vmfateqcllvlthhpavwhqasqfldts---ARVLTEKGDVQAAKIFADECAN
FBpp0112455  vmfateqcllvlthhpavwhqasqfldtsarvltekgvrtsvenispilcvpvvnqiewv--MAFAWWWAKDVQAAKIFADECAN
FBpp0070352  ............................................................--KGKEYLSKGDIPSAVLCFEVAAK
FBpp0070351  ............................................................--KGKEYLSKGDIPSAVLCFEVAAK
FBpp0070402  ............................................................----QWEEQQQEIQRARSIWERALD
FBpp0080138  ............................................................-------------------------
FBpp0080139  ............................................................-------------------------
FBpp0074609  ............................................................--LGSLFGGSNKVEDAIECYQRA--
FBpp0084171  ............................................................-------------------------
FBpp0085420  ............................................................-NLACVYYEQGLIDLAIDTYRRAIE
FBpp0085421  ............................................................-NLACVYYEQGLIDLAIDTYRRAIE
FBpp0085422  ............................................................-NLACVYYEQGLIDLAIDTYRRAIE
FBpp0085420  ............................................................-NLGNVFKERGQLQEALDNYRRAVR
FBpp0085421  ............................................................-NLGNVFKERGQLQEALDNYRRAVR
FBpp0085422  ............................................................-NLGNVFKERGQLQEALDNYRRAVR
FBpp0077790  ............................................................--LGNAAYKKKDFETALKHYHAAIE
FBpp0082545  ............................................................YNIARLATDMGNNTKAFQHYHRAIE
FBpp0084693  ............................................................-------ECQMNFDDAAEILQRIDQ
FBpp0084691  ............................................................-------ECQMNFDDAAEILQRIDQ
FBpp0084692  ............................................................-------ECQMNFDDAAEILQRIDQ
FBpp0084694  ............................................................-------ECQMNFDDAAEILQRIDQ
FBpp0112211  ............................................................-------ECQMNFDDAAEILQRIDQ
FBpp0072096  ............................................................---ATAYRIAKSYDKSKECFLKAID
FBpp0071560  ............................................................-NRGDILMKLNRTAQAQEVYEQALL
FBpp0071561  ............................................................-NRGDILMKLNRTAQAQEVYEQALL
FBpp0077790  ............................................................--QGNLFFKKGDYSTAVKHYTEAIK
FBpp0076600  ............................................................---GNCFSLQKEHETAIKFFKRAVQ
FBpp0271716  ............................................................-------------------------
FBpp0077790  ............................................................--KGNQALSAEKFDEAVAAYTEAIA
FBpp0271718  ............................................................-------------------------
FBpp0290895  ............................................................-NLGSVLSAQGRYEEAELTLRMTLG
FBpp0290896  ............................................................-NLGSVLSAQGRYEEAELTLRMTLG
FBpp0081673  ............................................................---ANEYAKAGMYFKAATAYRIAKS
FBpp0111849  ............................................................-NLGSVLSSQGRYEEAKQVLQEAIR
FBpp0077614  ............................................................-NLGSVLSSQGRYEEAKQVLQEAIR
FBpp0084692  ............................................................----------------------AVK
FBpp0084694  ............................................................----------------------AVK
FBpp0112211  ............................................................----------------------AVK
FBpp0084691  ............................................................----------------------AVK
FBpp0084693  ............................................................----------------------AVK
FBpp0076382  ............................................................-NMARMAHMAGSYEAAVKYHKQELA
FBpp0076382  ............................................................----NAACQSGDFATAVLLYTDALQ
FBpp0080535  ............................................................-NEGNRLMKENKYNEALLQYNRAIA
FBpp0072164  ............................................................--RGNTYVKQGEYEKAIVAYSTAIA
FBpp0084016  ............................................................----------------------VLN
FBpp0076382  ............................................................--LGDCYAALGDYEEALKCHDRQLQ
FBpp0076382  ............................................................--LGHVYTASGDYPNALASHKQCVQ
FBpp0080894  ............................................................--IGNYYSIRCDHQVAISYFQRALK
FBpp0081606  ............................................................-NQGNEMLKTKEFSKAIDMYTKAIE
FBpp0081607  ............................................................-NQGNEMLKTKEFSKAIDMYTKAIE
FBpp0084559  ............................................................-NLGNTYYLLGDFQAAIEHHQERLR
FBpp0075683  ............................................................NNLAVLYGKRGKYKDAEPLCKRALE
FBpp0081284  ............................................................--KGNEAFKASRWEEAVEHYGKAIK
FBpp0079468  ............................................................--KGTNYFKKENWALAIKMYTKCKN
FBpp0087297  ............................................................--LAELYRKDKQYQKAIEILENCLH
FBpp0074835  ............................................................-MKGQIEEQQRRTDDAAATYTLGLK
FBpp0079893  ............................................................--RAALYIQLDQREKGIADFAEAER
FBpp0079894  ............................................................--RAALYIQLDQREKGIADFAEAER
FBpp0079895  ............................................................--RAALYIQLDQREKGIADFAEAER
FBpp0082765  ............................................................---GNELFKNDDAEGAAKTYTEALD
FBpp0079617  ............................................................--QGNCLFAARKYDDAINCYSKAII
FBpp0084440  ............................................................-LRGNESFKAKEYENAIEEYNCSII
FBpp0080423  ............................................................--LGNDQYKAQNYQNALKLYTDAIS
FBpp0080424  ............................................................--LGNDQYKAQNYQNALKLYTDAIS
FBpp0085344  .....ssqmsdkdsnsvyaaslaavsrveqalseaasslssftqrpgprrpwmlqieiwl-LLADVYLRIDQPNEALNCIHEASQ
FBpp0081552  ............................................................--LGKEFLARGQLSDALTHYHAAVE
FBpp0087646  ............................................................--CGKLHMALKNYSDALNYVLKATR
FBpp0083769  ............................................................YAVGCYYDMIGKSDPARRYLSKATA
FBpp0070572  ............................................................--QAASAYGQQKFDEAIALYTKAIE
FBpp0070573  ............................................................--QAASAYGQQKFDEAIALYTKAIE
FBpp0070575  ............................................................--QAASAYGQQKFDEAIALYTKAIE
FBpp0074835  ............................................................----EFCAKENAFECARAVYAHALQ
FBpp0080424  ............................................................---GNMLFKSGRYREAHVIYTDALK
FBpp0080423  ............................................................---GNMLFKSGRYREAHVIYTDALK
FBpp0076113  ............................................................---GNHFYQLGRYHEARAKYRKANR
FBpp0076114  ............................................................---GNHFYQLGRYHEARAKYRKANR
FBpp0076115  ............................................................---GNHFYQLGRYHEARAKYRKANR
FBpp0072561  ............................................................YNLARLNEAMSSYDVADKLYKEILK
FBpp0072562  ............................................................YNLARLNEAMSSYDVADKLYKEILK
FBpp0072561  ............................................................--KACIAFNRKDYRGAMAFYKKALR
FBpp0072562  ............................................................--KACIAFNRKDYRGAMAFYKKALR
FBpp0085923  ............................................................---GNDFLENGKLVDAIDAYSAALA
FBpp0079893  ............................................................---GNNCYRNGKYDEAIKFYDKAID
FBpp0079894  ............................................................---GNNCYRNGKYDEAIKFYDKAID
FBpp0079895  ............................................................---GNNCYRNGKYDEAIKFYDKAID
FBpp0075683  ............................................................----IQYASQGRYEVAVPLCKQALE
FBpp0077614  ............................................................--IGDVLGRLQQWDEAERHHRAALE
FBpp0085409  ............................................................-------------------------
FBpp0271717  ............................................................-------------------------
FBpp0271719  ............................................................-------------------------
FBpp0086749  ............................................................---------FGTFKTCKAVYERIID
FBpp0073411  ............................................................--RGNNFYKASRFTEAETCYREAVG
FBpp0070907  ............................................................-ALGKCLYYNGDYFQAEDIFSSTLC
FBpp0073412  ............................................................--RGNNFYKASRFTEAETCYREAVG
FBpp0070908  ............................................................-ALGKCLYYNGDYFQAEDIFSSTLC
FBpp0085842  ............................................................--RANFFYKRSEFTTAIHLYRRALD
FBpp0077718  ............................................................--QARIHQAMEQQEDALQLYRLAAK
FBpp0076600  ............................................................FLLATSYFRSNQVHQAYWLLKEKAR
FBpp0076382  ............................................................-NIGDILIRTGSHEEAIKLYQRQLA
FBpp0071712  ............................................................--LGLKEIKNANPENAIHFFCKALE
FBpp0086749  ............................................................-------------------------
FBpp0085479  ............................................................---GNFYMKHKKFRMAIYSFTEGIK
FBpp0112016  ............................................................--LGLKEIKNANPENAIHFFCKALE
FBpp0292906  ............................................................----------EREANALNFLQKSIE
FBpp0079665  ............................................................---------------ALNFLQKSIE
FBpp0079666  ............................................................---------------ALNFLQKSIE
FBpp0079664  ............................................................---------------ALNFLQKSIE
FBpp0084076  ............................................................--QGNEAFRSQKYEKAILHYDKAII
FBpp0111406  ............................................................--LGNAEYRKGNYEAAMKVYTEAIE
FBpp0074918  ............................................................-YWGNHFYRSADYAQAMDHFEISLE
FBpp0082818  ............................................................--KAMRYEALEQYDEADEVLDAIIA
FBpp0074480  ............................................................---GLTLNGLGRREEAYKYVRLGLR
FBpp0111849  ............................................................-QLGALYVEQGKLQRALAIYREALS
FBpp0082819  ............................................................--KAMRYEALEQYDEADEVLDAIIA
FBpp0292061  ............................................................---GIEHFKNGQQVEAFQCLNKALN
FBpp0085279  ............................................................-NMGNIYYSMGIYQKAVKMYRMALD
FBpp0081805  ............................................................---GIEHFKNGQQVEAFQCLNKALN
FBpp0100021  ............................................................-------------------------
FBpp0100023  ............................................................-------------------------
FBpp0074877  ............................................................--LGLMYLFLKDYNQSENWLELALY
FBpp0071879  ............................................................YNRGLVLEELHMFTLAAENYKSITK
FBpp0084559  ............................................................-QLGNAYFYLGDYNKAMQYHKHDLT
FBpp0075591  ............................................................--KAIALSESGELDGALELFQQSLN
FBpp0076526  ............................................................-QLGDFYNQQGKYTDAVREYVQEAQ
FBpp0079851  ............................................................---GSVEYSRGRCDEALKYFQELLS
FBpp0290395  ............................................................-NKALVYLRQNDVHQAIETLQMYDR
FBpp0072146  ............................................................---GKDSVKLGRYQSAATAFERAVS
FBpp0076382  ............................................................-NLGSVHESLGQQAEALKCYERQLE
FBpp0083238  ............................................................---------VGNNRKALQESEKLLR
FBpp0111383  ............................................................--MGNYEYRKLNFSLAKDYYSKGIQ
FBpp0080424  ............................................................---------TKSYRNVVFYLDSALK
FBpp0071560  ............................................................------------------------H
FBpp0071561  ............................................................------------------------H
FBpp0080423  ............................................................---------TKSYRNVVFYLDSALK
FBpp0071879  ............................................................--RACLAYNRQDYIGALGYFKSVLL
FBpp0077738  ............................................................----------------------AIA
FBpp0077934  ............................................................--KGLIAVAKNDFPEAYVIFQKALH
FBpp0292775  ............................................................----------------------AIA
FBpp0087646  ............................................................----------GHLETATKACKMAIK
FBpp0292906  ............................................................--LGHLHLLLGEYSEALSAYQKYLR
FBpp0079664  ............................................................--LGHLHLLLGEYSEALSAYQKYLR
FBpp0086749  ............................................................------------YEEVNSAFERALV
FBpp0082652  ............................................................--LGNEEYRRTNYEKAVYFYSKAIQ
FBpp0077619  ............................................................---GNVEFQRGNLEEAALYYESALT
FBpp0086164  ............................................................-----ALMQEHKYAEAIALMSPITD
FBpp0087232  ............................................................--RATSAFKAKKWLEAMMLYTRSYV
FBpp0072561  ............................................................YGLGQMYIYRGDTENAAQCFEKVLK
FBpp0072562  ............................................................YGLGQMYIYRGDTENAAQCFEKVLK
FBpp0088148  ............................................................-----AHMDWGKFREAIEFSHQQLG
FBpp0088149  ............................................................-----AHMDWGKFREAIEFSHQQLG
FBpp0075786  ............................................................---GNVLYRKNRFQEAAHRYQYALR
FBpp0075788  ............................................................---GNVLYRKNRFQEAAHRYQYALR
FBpp0075787  ............................................................---GNVLYRKNRFQEAAHRYQYALR
FBpp0075789  ............................................................---GNVLYRKNRFQEAAHRYQYALR
FBpp0075785  ............................................................---GNVLYRKNRFQEAAHRYQYALR
FBpp0083319  ............................................................--------NNQEFDKAVKAVNRILG
FBpp0076498  ............................................................--KASSCMHLNLLDDALKFCNASLE
FBpp0290580  ............................................................--LGHCYYHAQKYEEAATCYEQLCQ
FBpp0290395  ............................................................FNLAEQYERSEMHIEALNTYSIMAK
FBpp0080720  ............................................................--FGQLLMKQGKYLEAKNLFKEAFD
FBpp0086164  ............................................................---ANLSFVYGRYETAERICMEIIR
FBpp0080741  ............................................................--RAYFLMEIGNFNSAQQCLEQIKT
FBpp0087297  ............................................................FVQGLIDREEGNHIEALRHLQKSAE
FBpp0070720  ............................................................-------------------------
FBpp0089396  ............................................................-------------------------
FBpp0111789  ............................................................-------------------------
FBpp0086683  ............................................................--AGKLWMRRMRYHDAQRAFEKAIT
FBpp0289328  ............................................................--MGNSMYQQSDYQTAAKWYRIACK
FBpp0070667  ............................................................------WRMRGNAREALPCARLAAL
FBpp0082624  ............................................................--LASMHYMRAHYQEAIDVYKRVLV
FBpp0081552  ............................................................---------EKHFAECIAAGEAVLR
FBpp0086749  ............................................................-------------------------
FBpp0087646  ............................................................--QGFLYARKNLYRQAIEAFTRACK
FBpp0071879  ............................................................---AQMYLHEGELNRSKAFLESFLT
FBpp0080894  ............................................................-QMALVYHNKRDVDKAIELYQALLE
FBpp0112213  ............................................................----------------------AVK
FBpp0087233  ............................................................-------------------------
FBpp0070906  ............................................................-------------------------
FBpp0087646  ............................................................--------KLGKHAEAIPKCQRLLK
FBpp0082112  ............................................................-NMGVIHLRVRHYAIAAKFFQNALN
FBpp0086359  ............................................................---------LGHHRQATTIHELLIN
FBpp0076526  ............................................................-------CHLMNYEKALTYYQKMLE
FBpp0085279  ............................................................-NKALVYLRQNDVHQAIETLQMYDR
FBpp0074835  ............................................................-----------NPDDARILLSRAVE
FBpp0078887  ............................................................-------------------YTEAEQ
FBpp0290580  ............................................................--EGCLLFQADQHEAAVQRFQAALQ
FBpp0085047  ............................................................-----HLMNNSRWYAAEQWISASIE
FBpp0086380  ............................................................-------------------------
FBpp0083435  ............................................................-------------------------
FBpp0078891  ............................................................-------------------------
FBpp0082419  ............................................................-------------------------
FBpp0082420  ............................................................-------------------------
FBpp0086749  ............................................................-------------------------
FBpp0078027  ............................................................--WGTYYSRRRRENLGMYYFDKALK
FBpp0088148  ............................................................-------------------------
FBpp0088149  ............................................................-------------------------
FBpp0290863  ............................................................--WAMFFFTQQRYANGLRYFNSALD
FBpp0080720  ............................................................--MANLAMEREQFKKAEKIFTDVMK
FBpp0083319  ............................................................-QLAYVLQLQGKTKEASSIYADCLR
FBpp0071288  ............................................................-------------------------
FBpp0081398  ............................................................--QGSRNFLVKSYDEAADELSQVCQ
FBpp0085015  ............................................................YEIGVQLFDLGEYQRSLEWLQVAFI
FBpp0084188  ............................................................---ARLYMKVQEYPKAIEYLNGYLR
FBpp0290580  ............................................................--------------DALKDYEQALE
FBpp0085012  ............................................................-------------------------
FBpp0086380  ............................................................YTTGQAKIQQGLFKEGYELISGALN
FBpp0076382  ............................................................--VGQELLQATQYSAAVTVLEAALR
FBpp0071879  ............................................................---AHIALVSGQYRLAIQTYERCLK
FBpp0076961  ............................................................-------------------------
FBpp0075717  ............................................................-------------------------
FBpp0080267  ............................................................--------KERHPLKASDLFTEAIF
FBpp0070907  ............................................................---------ERNYRAALRHFDEIIH
FBpp0085033  ............................................................---GAYLFMKNRPSDAIQWLQEVPQ
FBpp0082507  ............................................................-------------------------
FBpp0077738  ............................................................-------------------------
FBpp0292775  ............................................................-------------------------
FBpp0085676  ............................................................-------------------------
FBpp0087091  ............................................................-------LKNRNYFQALELYNKSIC
FBpp0082624  ............................................................---ASAFFLYEQFEEVLVYMNSIRS
FBpp0070908  ............................................................-------------------------
FBpp0070431  ............................................................------AIEVGKWSDALDYGQRLLP
FBpp0075442  ............................................................--------RRRSWARAVALYDQLIA
FBpp0089265  ............................................................----------RDYYNALSALHRALD
FBpp0075443  ............................................................--------RRRSWARAVALYDQLIA
FBpp0070906  ............................................................---AKACVVKRDFARANLLICQAVR
FBpp0073018  ............................................................----------RDYYNALSALHRALD
FBpp0078634  ............................................................-------------------------
FBpp0087626  ............................................................------------YSEAVFEAENAVE
FBpp0075754  ............................................................-------------------------
FBpp0087625  ............................................................------------YSEAVFEAENAVE
FBpp0071288  ............................................................------------------LYREALA
FBpp0085046  ............................................................-------------------------
FBpp0110159  ............................................................-------------------------
FBpp0072679  ............................................................-------------------------
FBpp0082624  ............................................................---AFCNFHLGDYQQALAQYKAIQQ
FBpp0084254  ............................................................--VARVAMHKENFDEALLILLEADE
FBpp0085032  ............................................................YAMGQILFDQKNYLAAASWIYQSVV


                                      30                                                   40       
                                       |                                                    |       
d1zu2a1        S....................NPLD..........A.................D................NLTRWGGVLLEL.SQ
FBpp0112456  I....................LERS..........I.................Ng...............VLNRNALLYFAY.AD
FBpp0112455  I....................LERS..........I.................Ng...............VLNRNALLYFAY.AD
FBpp0070352  K....................QPER..........A.................E................VWQLLGTSQTEN.EM
FBpp0070351  K....................QPER..........A.................E................VWQLLGTSQTEN.EM
FBpp0070402  N....................EHRN..........V.................T................LWLKYAEMEMKN.KQ
FBpp0080138  -....................----..........-.................-................------------.--
FBpp0080139  -....................----..........-.................-................------------.--
FBpp0074609  -....................----..........-.................-................-----GNMFKMS.KN
FBpp0084171  -....................----..........-.................-................------------.--
FBpp0085420  L....................QPNF..........P.................D................AYCNLANALKEK.GQ
FBpp0085421  L....................QPNF..........P.................D................AYCNLANALKEK.GQ
FBpp0085422  L....................QPNF..........P.................D................AYCNLANALKEK.GQ
FBpp0085420  L....................KPDF..........I.................D................GYINLAAALVAA.RD
FBpp0085421  L....................KPDF..........I.................D................GYINLAAALVAA.RD
FBpp0085422  L....................KPDF..........I.................D................GYINLAAALVAA.RD
FBpp0077790  H....................DPTD..........I.................T................FYNNIAAVHFER.KE
FBpp0082545  L....................YPNY..........E.................S................ALMNLGNLYREH.GQ
FBpp0084693  R....................CPNL..........L.................Q................LSYRRINVERRR.GA
FBpp0084691  R....................CPNL..........L.................Q................LSYRRINVERRR.GA
FBpp0084692  R....................CPNL..........L.................Q................LSYRRINVERRR.GA
FBpp0084694  R....................CPNL..........L.................Q................LSYRRINVERRR.GA
FBpp0112211  R....................CPNL..........L.................Q................LSYRRINVERRR.GA
FBpp0072096  A....................YKNNkswfha....A.................K................AYEQIILLSKDA.DK
FBpp0071560  Y....................DNEN..........A.................D................IYYNLGVVFLEQ.GK
FBpp0071561  Y....................DNEN..........A.................D................IYYNLGVVFLEQ.GK
FBpp0077790  R....................NPDD..........P.................K................LYSNRAACYTKL.AA
FBpp0076600  V....................DPDF..........V.................Y................SYTLLGHELVLT.EE
FBpp0271716  -....................----..........-.................-................------------.--
FBpp0077790  L....................DDQN..........H.................V................LYSNRSAAFAKA.GK
FBpp0271718  -....................----..........-.................-................------------.--
FBpp0290895  H....................RPTM..........A.................D................AHFNLGVVHQKQ.LN
FBpp0290896  H....................RPTM..........A.................D................AHFNLGVVHQKQ.LN
FBpp0081673  F....................D-KR..........K.................D................CLLKAIDCYENN.KS
FBpp0111849  F....................RPNM..........A.................D................VHFNLGILHQNQ.QV
FBpp0077614  F....................RPNM..........A.................D................VHFNLGILHQNQ.QV
FBpp0084692  E....................DSTD..........F.................T................GWTYLLQYVDNE.SD
FBpp0084694  E....................DSTD..........F.................T................GWTYLLQYVDNE.SD
FBpp0112211  E....................DSTD..........F.................T................GWTYLLQYVDNE.SD
FBpp0084691  E....................DSTD..........F.................T................GWTYLLQYVDNE.SD
FBpp0084693  E....................DSTD..........F.................T................GWTYLLQYVDNE.SD
FBpp0076382  I....................NQAMndrsae....A.................A................THGNLAVAYQAL.GA
FBpp0076382  L....................DPGN..........H.................I................LYSNRSAALLKQ.GQ
FBpp0080535  F....................DPKN..........P.................I................FYCNRAAAHIRL.GE
FBpp0072164  V....................YPHD..........P.................I................YHINRALCYLKQ.ES
FBpp0084016  K....................FKTE..........L.................R................VWPVAAEAYFWL.GK
FBpp0076382  Lalglts..............HRDQ..........E.................R................AYRGLGQARRAL.GQ
FBpp0076382  L....................FKQLgdrlqe....A.................R................EIGNVGAVYLAL.GE
FBpp0080894  L....................NPKY..........L.................A................AWTLMGHEFMEL.KN
FBpp0081606  L....................HPNS..........A.................I................YYANRSLAHLRQ.ES
FBpp0081607  L....................HPNS..........A.................I................YYANRSLAHLRQ.ES
FBpp0084559  I....................AREF..........G.................Draaerr..........ANSNLGNSHIFL.GQ
FBpp0075683  Irekvlgkd............HPDV..........A.................K................QLNNLALLCQNQ.GK
FBpp0081284  A....................GSKHkel.......A.................V................FYKNRAAAYLKL.GK
FBpp0079468  I....................LPTT..........V.................Htneevkkikva.....THSNIALCHQKS.ND
FBpp0087297  L....................TPEN..........S.................E................VLIEISVLYLKI.NE
FBpp0074835  K....................CPTS..........I.................P................LWILSANLEERK.GV
FBpp0079893  L....................NPEN..........P.................D................VYHQRAQILLLL.EQ
FBpp0079894  L....................NPEN..........P.................D................VYHQRAQILLLL.EQ
FBpp0079895  L....................NPEN..........P.................D................VYHQRAQILLLL.EQ
FBpp0082765  I....................CPSAssker.....A.................V................LYGNRAAAKIKL.EA
FBpp0079617  K....................NPTN..........A.................T................YFTNRALCNLKL.KR
FBpp0084440  Y....................DPEN..........A.................Vh...............AYNNRAVAHLKL.KK
FBpp0080423  L....................CPDS..........A.................A................YYGNRAACYMML.LN
FBpp0080424  L....................CPDS..........A.................A................YYGNRAACYMML.LN
FBpp0085344  I....................YPLS..........H.................Q................IMFMRGQVHVYL.EQ
FBpp0081552  G....................DANN..........Y.................L................TLFKRGTVYLAL.GK
FBpp0087646  L....................RPHF..........A.................E................CFDYLGKLYPLAtGD
FBpp0083769  L....................DRLY..........G.................P................AWLAYGHSFANE.NE
FBpp0070572  L....................SPGN..........A.................L................FHAKRGQAFLKL.KK
FBpp0070573  L....................SPGN..........A.................L................FHAKRGQAFLKL.KK
FBpp0070575  L....................SPGN..........A.................L................FHAKRGQAFLKL.KK
FBpp0074835  I....................FPSK..........K.................S................IWLRAAYFEKNH.GT
FBpp0080424  I....................DEHNkdin......S.................K................LLYNRALVNTRI.GN
FBpp0080423  I....................DEHNkdin......S.................K................LLYNRALVNTRI.GN
FBpp0076113  Y....................YHYL..........S.................-................------------.--
FBpp0076114  Y....................YHYL..........S.................-................------------.--
FBpp0076115  Y....................YHYL..........S.................-................------------.--
FBpp0072561  E....................HPNY..........I.................D................CYLRLGCMARDK.GL
FBpp0072562  E....................HPNY..........I.................D................CYLRLGCMARDK.GL
FBpp0072561  T....................NPNCp.........A.................N................VRIGMAHCFLKM.GN
FBpp0072562  T....................NPNCp.........A.................N................VRIGMAHCFLKM.GN
FBpp0085923  K....................YPQG..........E.................V................LYLNRATALMRR.GW
FBpp0079893  K....................CPKEhrtdm.....A.................I................FYQNRAASYEML.KK
FBpp0079894  K....................CPKEhrtdm.....A.................I................FYQNRAASYEML.KK
FBpp0079895  K....................CPKEhrtdm.....A.................I................FYQNRAASYEML.KK
FBpp0075683  Dlertsghd............HPDV..........A.................T................MLNILALVYRDQ.NK
FBpp0077614  L....................QPNQ..........V.................A................AHLSYGITLARNsSR
FBpp0085409  -....................----..........-.................-................------------.--
FBpp0271717  -....................----..........-.................-................------------.--
FBpp0271719  -....................----..........-.................-................------------.--
FBpp0086749  L....................KICT..........P.................Q................IIINYGMFLEEH.NY
FBpp0073411  Iveqlmlke............KPHD..........E.................Ewqelaaiktp......LLLNYAQCRLIA.GD
FBpp0070907  A....................NPDN..........V.................E................AIGLMAVLCGQE.GG
FBpp0073412  Iveqlmlke............KPHD..........E.................Ewqelaaiktp......LLLNYAQCRLIA.GD
FBpp0070908  A....................NPDN..........V.................E................AIGLMAVLCGQE.GG
FBpp0085842  Fldnrdg..............DPDS..........Efdkedl...........Elsnsdtqtlledrli.VYNNLAMTQIKI.AA
FBpp0077718  L....................HPIN..........V.................E................SLASIAVGYFYD.NN
FBpp0076600  R....................S---..........P.................Q................CRFLQAKCAYEL.KK
FBpp0076382  Laraagd..............RSME..........A.................A................ACGALGLAHRLM.RR
FBpp0071712  L....................NSTD..........I.................N................ALISRSKCYLLL.GE
FBpp0086749  -....................----..........-.................-................-WNSLADYYVRS.GL
FBpp0085479  T....................KTDN..........P.................Dvlav............LYNNRSAAHFFI.KN
FBpp0112016  L....................NSTD..........I.................N................ALISRSKCYLLL.GE
FBpp0292906  A....................DPKS..........G.................Q................SLYLLGRCYAGI.NK
FBpp0079665  A....................DPKS..........G.................Q................SLYLLGRCYAGI.NK
FBpp0079666  A....................DPKS..........G.................Q................SLYLLGRCYAGI.NK
FBpp0079664  A....................DPKS..........G.................Q................SLYLLGRCYAGI.NK
FBpp0084076  K....................VKDS..........A.................I................TYCNRALCYIKL.QN
FBpp0111406  N....................IRDS..........H.................I................LYINRALCFIKS.GK
FBpp0074918  I....................NNLQ..........E.................A................ILLRCGYCAIQL.ER
FBpp0082818  K....................DETN..........A.................A................PRKRKIAILKAR.GR
FBpp0074480  N....................DLRS..........H.................V................CWHVYGLLQRSD.KK
FBpp0111849  S....................LPGL..........P.................Qqrei............LYQRIGDVLGRL.QQ
FBpp0082819  K....................DETN..........A.................A................PRKRKIAILKAR.GR
FBpp0292061  I....................DPRN..........V.................E................ALVARGALYANR.GS
FBpp0085279  S....................VPKSlsqlr.....L.................K................IRENIGILFIRM.GS
FBpp0081805  I....................DPRN..........V.................E................ALVARGALYANR.GS
FBpp0100021  -....................----..........-.................-................---MLGLMYLFL.KD
FBpp0100023  -....................----..........-.................-................---MLGLMYLFL.KD
FBpp0074877  H....................YDD-..........-.................-................------------.--
FBpp0071879  E....................YSSY..........H.................D................CYLRLGVMAIQK.NN
FBpp0084559  L....................AKSMndrlge....A.................K................SSGNLGNTLKVM.GR
FBpp0075591  L....................A-QR..........A.................S................VLNNRAQTLRLA.KR
FBpp0076526  I....................YASMgkelet....A.................K................AKRMVGEMYTLL.CD
FBpp0079851  Vv...................DPMDnllf......K.................L................SFLRLGQLALQR.KQ
FBpp0290395  K....................SEGSmt........A.................S................ALTNLSFIYISL.GN
FBpp0072146  Slnycrmandee.........E--Rkqtell....T.................T................LNQNLMIVYNKM.NK
FBpp0076382  L....................STDRlak.......A.................M................ACLALGRVHHQL.EQ
FBpp0083238  K....................HPNL..........L.................C................ARALKGLSLLRL.GR
FBpp0111383  Y....................IKDS..........P.................V................LYVNRALCFIKL.RE
FBpp0080424  L....................APAC..........L.................K................YRLLKAECLAFL.GR
FBpp0071560  V....................NQRN..........A.................K................LYNNVGHALENE.GK
FBpp0071561  V....................NQRN..........A.................K................LYNNVGHALENE.GK
FBpp0080423  L....................APAC..........L.................K................YRLLKAECLAFL.GR
FBpp0071879  I....................QPQGm.........A.................D................VWVGIGHCFWKM.GE
FBpp0077738  R....................QSGD..........R.................A................ACYHLARHYENV.GK
FBpp0077934  L....................DTGN..........T.................M................ILNNMGVCLLYA.GK
FBpp0292775  R....................QSGD..........R.................A................ACYHLARHYENV.GK
FBpp0087646  E....................CSNR..........W.................Q................NWNLLGVINMNS.EN
FBpp0292906  F....................RENN..........Y.................Wtnha............FIYGIGVAYFKL.RC
FBpp0079664  F....................RENN..........Y.................Wtnha............FIYGIGVAYFKL.RC
FBpp0086749  F....................MHKM..........P.................R................IWMDYGAFMTSQ.CK
FBpp0082652  Y....................VADS..........P.................V................LYCNRALAKIKK.RD
FBpp0077619  L....................PPPE..........V.................Nerdffev.........SRLRLGYISYEL.GN
FBpp0086164  G....................DTVEcp........A.................F................VWLRQAECLRQL.NR
FBpp0087232  A....................LPSE..........N.................Vaeirv...........VLANRSATLYHM.QK
FBpp0072561  I....................QPGN..........Y.................E................TMKILGSLYAHS.NS
FBpp0072562  I....................QPGN..........Y.................E................TMKILGSLYAHS.NS
FBpp0088148  I....................SEELdspnmr....A.................E................TYLNLSRAHASL.GG
FBpp0088149  I....................SEELdspnmr....A.................E................TYLNLSRAHASL.GG
FBpp0075786  K....................ISGL..........E.................Qllernaifaqlrtn..LLLNLSRCKRKL.NE
FBpp0075788  K....................ISGL..........E.................Qllernaifaqlrtn..LLLNLSRCKRKL.NE
FBpp0075787  K....................ISGL..........E.................Qllernaifaqlrtn..LLLNLSRCKRKL.NE
FBpp0075789  K....................ISGL..........E.................Qllernaifaqlrtn..LLLNLSRCKRKL.NE
FBpp0075785  K....................ISGL..........E.................Qllernaifaqlrtn..LLLNLSRCKRKL.NE
FBpp0083319  V....................APDD..........P.................T................ALHCKVVCLVQL.SK
FBpp0076498  K....................SPAN..........F.................K................SLCLRAEVLLKL.SH
FBpp0290580  L....................APKE..........A.................K................YRFYYAQSLYQA.GI
FBpp0290395  Nkm..................FPHV..........N.................Q................LKLNMGNIYYSM.GI
FBpp0080720  Tlinvygav............NDAS..........V.................T................ILNNISVAYVNL.EK
FBpp0086164  Q....................NPLA..........S.................E................PFYTLAEIYENR.DE
FBpp0080741  Qilacteyrf...........VKLN..........I.................K................YYLIQGQCSEIF.EH
FBpp0087297  L....................NPRN..........I.................E................TYKEIGRTLYIM.GR
FBpp0070720  -....................----..........-.................-................------------.--
FBpp0089396  -....................----..........-.................-................------------.--
FBpp0111789  -....................----..........-.................-................------------.--
FBpp0086683  Rlktcktssfeqqcr......KKDM..........L.................I................ALFESLMICFNK.MR
FBpp0289328  R....................ELEN..........P.................E................QL----------.--
FBpp0070667  L....................APPI..........F.................Kdi..............PLLSLGTILFRM.GR
FBpp0082624  D....................NKEY..........Q.................A................INVYLALCFYKL.DY
FBpp0081552  N....................EPEEtmir......Y.................E................GHKVLCTCYTGD.EQ
FBpp0086749  -....................----..........-.................-................------------.--
FBpp0087646  Lcep.................GADR..........D.................K................LYTNLGYLYLKI.DQ
FBpp0071879  S....................EPDE..........P.................V................VMDLLAKIYLEY.KC
FBpp0080894  S....................DPYR..........L.................D................NVDTYSNLLFVK.EM
FBpp0112213  E....................DSTD..........F.................T................GWTYLLQYVDNE.SD
FBpp0087233  -....................----..........-.................-................VLANRSATLYHM.QK
FBpp0070906  -....................NVQT..........A.................K................HYGNLGRLYQTM.NR
FBpp0087646  S....................EPEN..........A.................M................GYLLLGAAYQNI.DK
FBpp0082112  F....................DQQL..........ArnlrqstlqtmssarscE................ILYNLGVAMLHL.RR
FBpp0086359  R....................LPED..........P.................R................LRNQLSLTYLMV.NN
FBpp0076526  N....................AELN..........Q.................Esgkslvp.........IYVSLYQTYRDN.GQ
FBpp0085279  K....................SEGSmt........A.................S................ALTNLSFIYIKM.AS
FBpp0074835  C....................CNTS..........V.................E................LWLALAR----L.ET
FBpp0078887  T....................NIKE..........A.................L................GALRMAQDLYLA.GK
FBpp0290580  V....................GGFN..........P.................L................VAYNVALAHFQK.KQ
FBpp0085047  Aydqkssqtdmellr......GPKL..........A.................D................LCRILGQVQMKQ.R-
FBpp0086380  -....................HPEV..........A.................L................IDSNISLILHAL.GE
FBpp0083435  -....................----..........-.................-................--TNLAACLLQE.KR
FBpp0078891  -....................----..........-.................-................-----AIVYCHD.GQ
FBpp0082419  -....................----..........-.................-................------------.--
FBpp0082420  -....................----..........-.................-................------------.--
FBpp0086749  -....................----..........-.................-................------------.--
FBpp0078027  L....................GPAD..........F.................T................TLYRRSQSKRKN.AQ
FBpp0088148  -....................----..........-.................-................ALLRMAVSLRKQ.GE
FBpp0088149  -....................----..........-.................-................ALLRMAVSLRKQ.GE
FBpp0290863  L....................NPFN..........E.................R................ALMRRSQLKRSM.GL
FBpp0080720  Rlfaeghtee...........SPKI..........L.................H................ISSKIAHMSQLQ.GD
FBpp0083319  H....................KPKDaalv......A.................V................ASNNLVVVNKDQ.NV
FBpp0071288  -....................----..........-.................-................------------.--
FBpp0081398  L....................YEEVygeladelgqP.................L................LLYAKALIAMAL.DE
FBpp0085015  Llrnspreekda.........DHYL..........S.................D................IREYASMANFEL.GN
FBpp0084188  V....................R-DD..........A.................V................GHNMIATCYSRL.NP
FBpp0290580  L....................Y---..........L.................P................VVMARAWISWRD.DD
FBpp0085012  -....................----..........-.................-................------------.--
FBpp0086380  Llnnvfgal............HQEN..........G.................S................CLRMLARLSYLL.GD
FBpp0076382  I....................G---..........S.................C................SLKLRGSVFSAL.SS
FBpp0071879  Dhl..................PKNR..........V.................D................VMHCLAKALYDN.GD
FBpp0076961  -....................----..........-.................-................IYRSWGQYFARM.RK
FBpp0075717  -....................---L..........A.................L................AYRSRASILIRL.GE
FBpp0080267  L....................APARntlaa.....A.................L................AHANRSLVLFDC.GL
FBpp0070907  KrrlmmrhknavlvaiessypEFGD..........A.................E................QRRRAAECYRQI.GN
FBpp0085033  Rlqeelli.............QPRHlpike.....V.................D................ALRLLAEAQIKD.QN
FBpp0082507  -....................----..........-.................-................THLQMGQILMAY.--
FBpp0077738  -....................----..........-.................-................-WTNLAKMCVHT.NR
FBpp0292775  -....................----..........-.................-................-WTNLAKMCVHT.NR
FBpp0085676  -....................----..........-.................D................IYRDWGTYYSRR.RR
FBpp0087091  Y....................AEPN..........S.................Ehlsi............GYANRSAVLFEW.KR
FBpp0082624  Y....................FVND..........D.................V................FNYNFAQAKCAT.GY
FBpp0070908  -....................----..........-.................-................----AAECYRQI.GN
FBpp0070431  Gfrkyhgpw............NPLL..........G.................L................LHMKLGKIQLYE.GH
FBpp0075442  P....................SPGQ..........G.................SggqsagsraqkdqqiaCLLGRCECLLEL.GK
FBpp0089265  Rspvrlmsq............EKGY..........Q.................Y................FCVNLAVLHATF.GH
FBpp0075443  P....................SPGQ..........G.................SggqsagsraqkdqqiaCLLGRCECLLEL.GK
FBpp0070906  Rareyfgpt............HQKY..........G.................D................ALLDYGFFLLNV.DS
FBpp0073018  Rspvrlmsq............EKGY..........Q.................Y................FCVNLAVLHATF.GH
FBpp0078634  -....................----..........T.................L................VSFYMAQMYGHL.GE
FBpp0087626  -....................--EL..........S.................L................AFANRGIALQEY.GY
FBpp0075754  -....................----..........-.................-................--------HSLL.GD
FBpp0087625  -....................--EL..........S.................L................AFANRGIALQEY.GY
FBpp0071288  K....................FNHD..........R.................R................LWSNWIKFSRKS.NP
FBpp0085046  -....................----..........-.................-................------------.--
FBpp0110159  -....................----..........-.................-................------------.--
FBpp0072679  -....................DQQM..........E.................I................AWREIGHHFANL.RS
FBpp0082624  G....................----..........-.................-................------------.--
FBpp0084254  L....................FSQC..........-.................-................------------.--
FBpp0085032  L....................MEAF..........S.................Maapleiskne......VRMVYAETLLKL.NQ


                 50                                                                                 
                  |                                                                                 
d1zu2a1        FHSISDAK.............................................................................
FBpp0112456  FEEGRLKYekvhtmynkllqlpdidptlvyvqymkfarra.............................................
FBpp0112455  FEEGRLKYekvhtmynkllqlpdidptlvyvqymkfarra.............................................
FBpp0070352  DPQAIAALkraydlqpdnqqvlmalaacytneglqnnavrmlcnwltvhpkyqhlvaahpelqaegtslassligpsklrdlqqi
FBpp0070351  DPQAIAALkraydlqpdnqqvlmalaacytneglqnnavrmlcnwltvhpkyqhlvaahpelqaegtslassligpsklrdlqqi
FBpp0070402  V-------.............................................................................
FBpp0080138  --------.............................................................................
FBpp0080139  --------.............................................................................
FBpp0074609  WTKAGECFceaatlharagsrhdagtcyvdasncykkvdvesavnclmksidiytdmgrftmaakhhqsiaemyesdp.......
FBpp0084171  -------Tlllieqaikfyrmlydklmakcvassrcdsalkvvaqrlliclgdltryrvnhvka.....................
FBpp0085420  VKEAEDCYntalrlcsnhadslnnlanikreq.....................................................
FBpp0085421  VKEAEDCYntalrlcsnhadslnnlanikreq.....................................................
FBpp0085422  VKEAEDCYntalrlcsnhadslnnlanikreq.....................................................
FBpp0085420  MESAVQAYitalqynpdlycvrsdlgnllkal.....................................................
FBpp0085421  MESAVQAYitalqynpdlycvrsdlgnllkal.....................................................
FBpp0085422  MESAVQAYitalqynpdlycvrsdlgnllkal.....................................................
FBpp0077790  Y-------.............................................................................
FBpp0082545  LSTAEEYIrlalqaypafpaawmnlgivqsaq.....................................................
FBpp0084693  L-------.............................................................................
FBpp0084691  L-------.............................................................................
FBpp0084692  L-------.............................................................................
FBpp0084694  L-------.............................................................................
FBpp0112211  L-------.............................................................................
FBpp0072096  L-------.............................................................................
FBpp0071560  S-------.............................................................................
FBpp0071561  S-------.............................................................................
FBpp0077790  F-------.............................................................................
FBpp0076600  F-------.............................................................................
FBpp0271716  --------.............................................................................
FBpp0077790  F-------.............................................................................
FBpp0271718  --------.............................................................................
FBpp0290895  F-------.............................................................................
FBpp0290896  F-------.............................................................................
FBpp0081673  WFHAAKSYeqiillaketdklsevedyanracclyqqh...............................................
FBpp0111849  Y-------.............................................................................
FBpp0077614  Y-------.............................................................................
FBpp0084692  A-------.............................................................................
FBpp0084694  A-------.............................................................................
FBpp0112211  A-------.............................................................................
FBpp0084691  A-------.............................................................................
FBpp0084693  A-------.............................................................................
FBpp0076382  HDAALTHYrahlatarslkdtageacallnlgnclsgr...............................................
FBpp0076382  F-------.............................................................................
FBpp0080535  N-------.............................................................................
FBpp0072164  F-------.............................................................................
FBpp0084016  S-------.............................................................................
FBpp0076382  L-------.............................................................................
FBpp0076382  C-------.............................................................................
FBpp0080894  T-------.............................................................................
FBpp0081606  F-------.............................................................................
FBpp0081607  F-------.............................................................................
FBpp0084559  F-------.............................................................................
FBpp0075683  Y-------.............................................................................
FBpp0081284  Y-------.............................................................................
FBpp0079468  H-------.............................................................................
FBpp0087297  TQKAHDRLaevvsierkcspkgllafgailqsr....................................................
FBpp0074835  L-------.............................................................................
FBpp0079893  IEPALAEFekavsiapnhaiafvqkcyaeyrlsllagdqrrlesvmhtfqnaierfpscvecysltaqvladq............
FBpp0079894  IEPALAEFekavsiapnhaiafvqkcyaeyrlsllagdqrrlesvmhtfqnaierfpscvecysltaqvladq............
FBpp0079895  IEPALAEFekavsiapnhaiafvqkcyaeyrlsllagdqrrlesvmhtfqnaierfpscvecysltaqvladq............
FBpp0082765  N-------.............................................................................
FBpp0079617  W-------.............................................................................
FBpp0084440  Y-------.............................................................................
FBpp0080423  Y-------.............................................................................
FBpp0080424  Y-------.............................................................................
FBpp0085344  W-------.............................................................................
FBpp0081552  T-------.............................................................................
FBpp0087646  F-------.............................................................................
FBpp0083769  HEQAMAAYfkatqlmrgchlpllyigvecglt.....................................................
FBpp0070572  P-------.............................................................................
FBpp0070573  P-------.............................................................................
FBpp0070575  P-------.............................................................................
FBpp0074835  R-------.............................................................................
FBpp0080424  L-------.............................................................................
FBpp0080423  L-------.............................................................................
FBpp0076113  -------Rqfgwqqlnplkkhlvdedllkvdgfsvvnninaaavdlkv.....................................
FBpp0076114  -------Rqfgwqqlnplkkhlvdedllkvdgfsvvnninaaavdlkv.....................................
FBpp0076115  -------Rqfgwqqlnplkkhlvdedllkvdgfsvvnninaaavdlkv.....................................
FBpp0072561  IFVASDFFkdalninndnpdarsllgnlhlakmqfalgqknfetilknpststdayslialgnfslqtlhqpsrdkeker.....
FBpp0072562  IFVASDFFkdalninndnpdarsllgnlhlakmqfalgqknfetilknpststdayslialgnfslqtlhqpsrdkeker.....
FBpp0072561  P-------.............................................................................
FBpp0072562  P-------.............................................................................
FBpp0085923  F-------.............................................................................
FBpp0079893  W-------.............................................................................
FBpp0079894  W-------.............................................................................
FBpp0079895  W-------.............................................................................
FBpp0075683  Y-------.............................................................................
FBpp0077614  A-------.............................................................................
FBpp0085409  --------.............................................................................
FBpp0271717  --------.............................................................................
FBpp0271719  --------.............................................................................
FBpp0086749  FEEAYRAYekgislfkwpnvydiwnsyltkflerygg................................................
FBpp0073411  F-------.............................................................................
FBpp0070907  CEQDSADMdylfakvssevkytashwfahaqllyde.................................................
FBpp0073412  F-------.............................................................................
FBpp0070908  CEQDSADMdylfakvssevkytashwfahaqllyde.................................................
FBpp0085842  Y-------.............................................................................
FBpp0077718  P-------.............................................................................
FBpp0076600  YAEAESALis...........................................................................
FBpp0076382  W-------.............................................................................
FBpp0071712  A-------.............................................................................
FBpp0086749  FDRARDIYeeaiqtvttvrdftqvfdeyaqfeelslnrrmeqvaaneaateeddidvelrlsrfeylmerrllllnsvllrqnph
FBpp0085479  Y-------.............................................................................
FBpp0112016  A-------.............................................................................
FBpp0292906  V-------.............................................................................
FBpp0079665  V-------.............................................................................
FBpp0079666  V-------.............................................................................
FBpp0079664  V-------.............................................................................
FBpp0084076  Y-------.............................................................................
FBpp0111406  F-------.............................................................................
FBpp0074918  W-------.............................................................................
FBpp0082818  R-------.............................................................................
FBpp0074480  Y-------.............................................................................
FBpp0111849  W-------.............................................................................
FBpp0082819  R-------.............................................................................
FBpp0292061  F-------.............................................................................
FBpp0085279  YSDAASSFefimteranirssihlllcyfalgdvekvklafrrlcdvqteaiesdmesetniiklqqqaepiqqigetdgyqsln
FBpp0081805  F-------.............................................................................
FBpp0100021  Y-------.............................................................................
FBpp0100023  Y-------.............................................................................
FBpp0074877  --------.............................................................................
FBpp0071879  HTQAIEHLkdilvednlnmtartymgdcfkglsldkfatfnynmilarqskftntyvsmamgnfcleklqnwiaegnfraar...
FBpp0084559  F-------.............................................................................
FBpp0075591  D-------.............................................................................
FBpp0076526  Y-------.............................................................................
FBpp0079851  Y-------.............................................................................
FBpp0290395  LEMASHCVnqlheigslknnapglinagivelgs...................................................
FBpp0072146  P-------.............................................................................
FBpp0076382  H-------.............................................................................
FBpp0083238  Y-------.............................................................................
FBpp0111383  F-------.............................................................................
FBpp0080424  C-------.............................................................................
FBpp0071560  F-------.............................................................................
FBpp0071561  F-------.............................................................................
FBpp0080423  C-------.............................................................................
FBpp0071879  L-------.............................................................................
FBpp0077738  FQEAIMFFtraqtfsnairickendfqeelwtvasssrqrdkaiaaayfeec.................................
FBpp0077934  L-------.............................................................................
FBpp0292775  FQEAIMFFtraqtfsnairickendfqeelwtvasssrqrdkaiaaayfeec.................................
FBpp0087646  E-------.............................................................................
FBpp0292906  F-------.............................................................................
FBpp0079664  F-------.............................................................................
FBpp0086749  I-------.............................................................................
FBpp0082652  F-------.............................................................................
FBpp0077619  Y-------.............................................................................
FBpp0086164  T-------.............................................................................
FBpp0087232  Y-------.............................................................................
FBpp0072561  Q-------.............................................................................
FBpp0072562  Q-------.............................................................................
FBpp0088148  L-------.............................................................................
FBpp0088149  L-------.............................................................................
FBpp0075786  L-------.............................................................................
FBpp0075788  L-------.............................................................................
FBpp0075787  L-------.............................................................................
FBpp0075789  L-------.............................................................................
FBpp0075785  L-------.............................................................................
FBpp0083319  F-------.............................................................................
FBpp0076498  Y-------.............................................................................
FBpp0290580  F-------.............................................................................
FBpp0290395  Y-------.............................................................................
FBpp0080720  Y-------.............................................................................
FBpp0086164  V-------.............................................................................
FBpp0080741  V-------.............................................................................
FBpp0087297  F-------.............................................................................
FBpp0070720  --------.............................................................................
FBpp0089396  --------.............................................................................
FBpp0111789  --------.............................................................................
FBpp0086683  Q-------.............................................................................
FBpp0289328  --------.............................................................................
FBpp0070667  L-------.............................................................................
FBpp0082624  Y-------.............................................................................
FBpp0081552  F-------.............................................................................
FBpp0086749  --------.............................................................................
FBpp0087646  P-------.............................................................................
FBpp0071879  P-------.............................................................................
FBpp0080894  K-------.............................................................................
FBpp0112213  A-------.............................................................................
FBpp0087233  Y-------.............................................................................
FBpp0070906  F-------.............................................................................
FBpp0087646  AEAAKNLRqcikctdgpapaallglancapsnelpeiydqladlqpeqslnyweklfnlasdsnvapfcftvlkkrvqdtengnf
FBpp0082112  P-------.............................................................................
FBpp0086359  L-------.............................................................................
FBpp0076526  F-------.............................................................................
FBpp0085279  H-------.............................................................................
FBpp0074835  Y-------.............................................................................
FBpp0078887  D-------.............................................................................
FBpp0290580  RAQALDYTseivergmrnhpelgigaqmdipdggarsvgnpitmaisgitqalnlkaaiefqdgneeaardalldlppraeseld
FBpp0085047  --------.............................................................................
FBpp0086380  Y-------.............................................................................
FBpp0083435  Y-------.............................................................................
FBpp0078891  FENALKILhgstnlesmalsvqcllrlqrvdlakqlvakmqeisddatltqlaqawvalaqgt......................
FBpp0082419  --------.............................................................................
FBpp0082420  --------.............................................................................
FBpp0086749  --------.............................................................................
FBpp0078027  ADGAL---.............................................................................
FBpp0088148  L-------.............................................................................
FBpp0088149  L-------.............................................................................
FBpp0290863  A-------.............................................................................
FBpp0080720  LEKSFQGF.............................................................................
FBpp0083319  FDSKKKIRaaladacesrltsrqkqvialnncllalytnagdqvqqlsqklaqtypqvefeallirctqlakdrkhkeaieqlqk
FBpp0071288  --------.............................................................................
FBpp0081398  N------Kvidvpdeaaddddedvdddeeesaedgaakkeekkdtkeaangasssngkeldtikegsdeadstgeaeqaqsdekp
FBpp0085015  P-------.............................................................................
FBpp0084188  P-------.............................................................................
FBpp0290580  F-------.............................................................................
FBpp0085012  --------.............................................................................
FBpp0086380  A-------.............................................................................
FBpp0076382  AHWALNHQ.............................................................................
FBpp0071879  A-------.............................................................................
FBpp0076961  N-------.............................................................................
FBpp0075717  G-------.............................................................................
FBpp0080267  Y-------.............................................................................
FBpp0070907  TDMAIETLlqvpptlrsprinlmlarlqhhgsrhgt.................................................
FBpp0085033  Y-------.............................................................................
FBpp0082507  -------T.............................................................................
FBpp0077738  LDVAKVCM.............................................................................
FBpp0292775  LDVAKVCM.............................................................................
FBpp0085676  E-------.............................................................................
FBpp0087091  Y-------.............................................................................
FBpp0082624  Y-------.............................................................................
FBpp0070908  TDMAIETLlqvpptlrsprinlmlarlqhhgsrhgt.................................................
FBpp0070431  S-------.............................................................................
FBpp0075442  F-------.............................................................................
FBpp0089265  R-------.............................................................................
FBpp0075443  F-------.............................................................................
FBpp0070906  V-------.............................................................................
FBpp0073018  R-------.............................................................................
FBpp0078634  P-------.............................................................................
FBpp0087626  Y-------.............................................................................
FBpp0075754  Y-------.............................................................................
FBpp0087625  Y-------.............................................................................
FBpp0071288  V-------.............................................................................
FBpp0085046  --------.............................................................................
FBpp0110159  --------.............................................................................
FBpp0072679  W-------.............................................................................
FBpp0082624  --------.............................................................................
FBpp0084254  --------.............................................................................
FBpp0085032  H-------.............................................................................


                                                                                                    
                                                                                                    
d1zu2a1        .....................................................................................
FBpp0112456  .....................................................................................
FBpp0112455  .....................................................................................
FBpp0070352  yleavrqhpsevdaevqdalgvlynls..........................................................
FBpp0070351  yleavrqhpsevdaevqdalgvlynls..........................................................
FBpp0070402  .....................................................................................
FBpp0080138  .....................................................................................
FBpp0080139  .....................................................................................
FBpp0074609  .....................................................................................
FBpp0084171  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0271718  .....................................................................................
FBpp0290895  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0111849  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0081607  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0085344  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070573  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0076114  .....................................................................................
FBpp0076115  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0085409  .....................................................................................
FBpp0271717  .....................................................................................
FBpp0271719  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0073412  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0071712  .....................................................................................
FBpp0086749  nvhewhkrvtlyedkpaeiistyteavqtvqpkqavgklhtlwvefakfyean................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0079666  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  .....................................................................................
FBpp0111849  .....................................................................................
FBpp0082819  .....................................................................................
FBpp0292061  .....................................................................................
FBpp0085279  nepvtgsvikaegggklnetvkfaatvkhryvvqalkkdelavyrnerrnavkrsitmivdlispfiednyndgynwcieiikts
FBpp0081805  .....................................................................................
FBpp0100021  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0074877  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0087232  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0075786  .....................................................................................
FBpp0075788  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0075789  .....................................................................................
FBpp0075785  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076498  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  .....................................................................................
FBpp0089396  .....................................................................................
FBpp0111789  .....................................................................................
FBpp0086683  .....................................................................................
FBpp0289328  .....................................................................................
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0112213  .....................................................................................
FBpp0087233  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0087646  tkiqeylgriwvsndfeiapedtqlykttmeallqnsepsarsvvykrylkwlykkqdyetcvrhacnmteshpkdvygfewick
FBpp0082112  .....................................................................................
FBpp0086359  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  pvtlhnmaltdvegpvaglrklafllelgapscpketfanilliccknelyetaadilaehtdltykylsqylyelldslitaqt
FBpp0085047  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0082420  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  faaahkshefvskfaiiqlqllqgnrkdaietllslgeakykpgvvsalvslylgtdnktaas......................
FBpp0071288  .....................................................................................
FBpp0081398  skkvptgvdevsssnggggaavndderpstsngevtascsngaapaveeepeeeegvs...........................
FBpp0085015  .....................................................................................
FBpp0084188  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  .....................................................................................
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075442  .....................................................................................
FBpp0089265  .....................................................................................
FBpp0075443  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0073018  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0087626  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0085046  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................


                                                                                                    
                                                                                                    
d1zu2a1        .....................................................................................
FBpp0112456  .....................................................................................
FBpp0112455  .....................................................................................
FBpp0070352  .....................................................................................
FBpp0070351  .....................................................................................
FBpp0070402  .....................................................................................
FBpp0080138  .....................................................................................
FBpp0080139  .....................................................................................
FBpp0074609  .....................................................................................
FBpp0084171  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0271718  .....................................................................................
FBpp0290895  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0111849  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0081607  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0085344  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070573  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0076114  .....................................................................................
FBpp0076115  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0085409  .....................................................................................
FBpp0271717  .....................................................................................
FBpp0271719  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0073412  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0071712  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0079666  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  .....................................................................................
FBpp0111849  .....................................................................................
FBpp0082819  .....................................................................................
FBpp0292061  .....................................................................................
FBpp0085279  nlawlanelelnkalvylrqndvhqaietlqmydrksegsmtasaltnlsfiyikmashcvnqlheigslknnapglinagivel
FBpp0081805  .....................................................................................
FBpp0100021  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0074877  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0087232  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0075786  .....................................................................................
FBpp0075788  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0075789  .....................................................................................
FBpp0075785  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076498  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  .....................................................................................
FBpp0089396  .....................................................................................
FBpp0111789  .....................................................................................
FBpp0086683  .....................................................................................
FBpp0289328  .....................................................................................
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0112213  .....................................................................................
FBpp0087233  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0087646  tycehheqseivswqq.....................................................................
FBpp0082112  .....................................................................................
FBpp0086359  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  saelaekklgtlasslagklrslaakvqevratneq.................................................
FBpp0085047  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0082420  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0081398  .....................................................................................
FBpp0085015  .....................................................................................
FBpp0084188  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  .....................................................................................
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075442  .....................................................................................
FBpp0089265  .....................................................................................
FBpp0075443  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0073018  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0087626  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0085046  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................


                     60            70                            80        90                       
                      |             |                             |         |                       
d1zu2a1        ..QMIQEAITKFE...EAL.LI........DP....KK........DEAVWCIGNAYTSFAFL......................
FBpp0112456  ..EGIKSARSIFK...KAR.ED........VR....SR........YHIFVAAALMEYYCS--......................
FBpp0112455  ..EGIKSARSIFK...KAR.ED........VR....SR........YHIFVAAALMEYYCS--......................
FBpp0070352  ..GEFDKAVDCYQ...SAL.QV........DP....QN........AKTWNRLGASLANGS--......................
FBpp0070351  ..GEFDKAVDCYQ...SAL.QV........DP....QN........AKTWNRLGASLANGS--......................
FBpp0070402  ..---NHARNLWD...RAV.TI........MP....RV........NQFWYKYTYMEEMLE--......................
FBpp0080138  ..---EQVAKYYL...EAF.KL........NP....AI........GMAQNQLGTLHYGQNHD......................
FBpp0080139  ..---EQVAKYYL...EAF.KL........NP....AI........GMAQNQLGTLHYGQNHD......................
FBpp0074609  ..NNLAKSIQHYE...QAA.DY........FK....GEesvssa..NKCMLKVAQYAAQLE--......................
FBpp0084171  ..T----------...---.--........--....--........-----------------......................
FBpp0085420  ..GYIEEATRLYL...KAL.EV........FP....DF........AAAHSNLASVLQQQGKLkealmhykeairiqptfadays
FBpp0085421  ..GYIEEATRLYL...KAL.EV........FP....DF........AAAHSNLASVLQQQGKLkealmhykeairiqptfadays
FBpp0085422  ..GYIEEATRLYL...KAL.EV........FP....DF........AAAHSNLASVLQQQGKLkealmhykeairiqptfadays
FBpp0085420  ..GRLEEAKACYL...KAI.ET........CP....GF........AVAWSNLGCVFNAQGEIwlaihhfekavtldpnfldayi
FBpp0085421  ..GRLEEAKACYL...KAI.ET........CP....GF........AVAWSNLGCVFNAQGEIwlaihhfekavtldpnfldayi
FBpp0085422  ..GRLEEAKACYL...KAI.ET........CP....GF........AVAWSNLGCVFNAQGEIwlaihhfekavtldpnfldayi
FBpp0077790  ..---EECIKQCE...KGI.EV........GR....ES........RADFKLIAKSFARIG--......................
FBpp0082545  ..GKYDKALASYE...KAL.KY........RA....NF........AVCYYNMGNLYLEQKRYaealhhwqhavalnprqpkawa
FBpp0084693  ..---DKCRELYK...HYI.ES........TK....NKgia.....GSLAIKYARFLNKIC--......................
FBpp0084691  ..---DKCRELYK...HYI.ES........TK....NKgia.....GSLAIKYARFLNKIC--......................
FBpp0084692  ..---DKCRELYK...HYI.ES........TK....NKgia.....GSLAIKYARFLNKIC--......................
FBpp0084694  ..---DKCRELYK...HYI.ES........TK....NKgia.....GSLAIKYARFLNKIC--......................
FBpp0112211  ..---DKCRELYK...HYI.ES........TK....NKgia.....GSLAIKYARFLNKIC--......................
FBpp0072096  ..---HEVEEYAN...KSA.SL........--....--........----------------Yqqhgspeaaasald........
FBpp0071560  ..---QQAQVYFN...KAI.EL........YP....EH........EQALLNSAILLQELGGEearrvsrsrlykvlenddqnek
FBpp0071561  ..---QQAQVYFN...KAI.EL........YP....EH........EQALLNSAILLQELGGEearrvsrsrlykvlenddqnek
FBpp0077790  ..---DLGLKDCD...TCI.KL........DE....KF........IKGYIRKGKILQGMQ--......................
FBpp0076600  ..---DKAMDYFR...AAV.VR........DP....RH........YNAWYGIGTIYSKQEKYelaeihyvkalkinpqnsvilv
FBpp0271716  ..NDVRKGIMILE...ELA.RT........HP....DGr.......RDYIYYLAFGNARIK--......................
FBpp0077790  ..---QEALEDAE...KTI.QL........NP....TW........PKGYSRKGAAAAGLN--......................
FBpp0271718  ..NDVRKGIMILE...ELA.RT........HP....DGr.......RDYIYYLAFGNARIK--......................
FBpp0290895  ..---SSAIPCFR...RAI.EL........RP....QL........AVAYLNLGTSLISLGDHrqeaisvlrtgarlegsgvrdr
FBpp0290896  ..---SSAIPCFR...RAI.EL........RP....QL........AVAYLNLGTSLISLGDHrqeaisvlrtgarlegsgvrdr
FBpp0081673  ..GSPEAAAAALD...KAA.KMtesk....HP....DL........ALGFYKRALAVVLIGDSthqasefask............
FBpp0111849  ..---PAAVECFQ...RAI.KF........RP....NL........AVAYLNLGISFIALGKRqqaieilqagsnldgaavrdrt
FBpp0077614  ..---PAAVECFQ...RAI.KF........RP....NL........AVAYLNLGISFIALGKRqqaieilqagsnldgaavrdrt
FBpp0084692  ..---EAAREAYD...TFL.SH........YP....YC........YGYWRKYADYEKRKG--......................
FBpp0084694  ..---EAAREAYD...TFL.SH........YP....YC........YGYWRKYADYEKRKG--......................
FBpp0112211  ..---EAAREAYD...TFL.SH........YP....YC........YGYWRKYADYEKRKG--......................
FBpp0084691  ..---EAAREAYD...TFL.SH........YP....YC........YGYWRKYADYEKRKG--......................
FBpp0084693  ..---EAAREAYD...TFL.SH........YP....YC........YGYWRKYADYEKRKG--......................
FBpp0076382  ..QEYEEAVPHYE...SYL.ML........AQ....ELgdvaae..GKACHLLGYAHFSLG--......................
FBpp0076382  ..---TAALQDAT...QAR.DL........CP....QW........PKAYFRQGVALQCLG--......................
FBpp0080535  ..---ERAVTDCK...SAL.VY........NN....NY........SKAYCRLGVAYSNMG--......................
FBpp0072164  ..---DQCVEDCE...AAI.AL........DK....LC........VKAYYRRMQANESLG--......................
FBpp0084016  ..---DQVHNLLQ...RAL.RA........LPnq..EH........IPCIVSFAKLYAKHD--......................
FBpp0076382  ..---PAALVCLE...KRL.VV........AH....ELhspeik..ALAYGDLGHVHAALGNHaqalnclehqrelaqglqdral
FBpp0076382  ..---EAALDCHS...QHL.RL........AR....KLhdqvee..ARAYSNLGSAHHQRR--......................
FBpp0080894  ..---NAAIQSYR...KAV.EV........NK....RD........YRAWYGLGQAYEIIKMHyyslyyfkiahqlrpydsrmlv
FBpp0081606  ..---GFALQDGV...SAV.KA........DP....AY........LKGYYRRAAAHMSLG--......................
FBpp0081607  ..---GFALQDGV...SAV.KA........DP....AY........LKGYYRRAAAHMSLG--......................
FBpp0084559  ..---EDAAEHYK...RTL.AL........AV....ELgereve..AQSCYSLGNTYTLLH--......................
FBpp0075683  ..---DEVEKYYQ...RAL.DIyesklgpdDP....NV........AKTKNNLAGCYLKQG--......................
FBpp0081284  ..---ENAVEDCT...ESL.KA........AP....GD........PKALFRRAQAYEALE--......................
FBpp0079468  ..---FEAKQECN...EVL.AL........DK....NN........VKALYRRGQCNLTIN--......................
FBpp0087297  ..NDIDGALSKYS...QIA.NA........EP....EI........AELWNNIGLCFFKKQKFivaisslrksvwlsplnynaly
FBpp0074835  ..---TKARSILE...RGR.LR........NP....KV........AVLWLEAIRVELRAGLKeiastmmaralqecpnagelwa
FBpp0079893  ..QQFTQAEEYYK...KAM.VL........AP....TN........PALIVHQAI--------......................
FBpp0079894  ..QQFTQAEEYYK...KAM.VL........AP....TN........PALIVHQAI--------......................
FBpp0079895  ..QQFTQAEEYYK...KAM.VL........AP....TN........PALIVHQAI--------......................
FBpp0082765  ..---KAAIDDCT...KAI.EL........WP....EY........VRVLLRRAKLYEQED--......................
FBpp0079617  ..---ELCCQDSR...RAL.DI........DG....NL........LKGHFFLGQGLMEID--......................
FBpp0084440  ..---FSAISDCQ...ACL.QI........DP....MN........IKAHLRMAEAHNAEG--......................
FBpp0080423  ..---NSALTDAR...HAI.RI........DP....GF........EKAYVRVAKCCLALGD-......................
FBpp0080424  ..---NSALTDAR...HAI.RI........DP....GF........EKAYVRVAKCCLALGD-......................
FBpp0085344  ..---FDAKQCFL...NAV.AA........NP....NH........TEALRALGEAHLVLG--......................
FBpp0081552  ..---RFAVQDFS...RVL.EL........KP....DF........MAARIQRGVVHMKSG--......................
FBpp0087646  ..---SRARKCYE...KCI.SL........NP....LA........EEAVDALSFIYQEQGEEelnetlllntlshlgsnesirl
FBpp0083769  ..KNLELAEKFFL...QAM.NI........AP....LD........VYVLHELGVIKYEYEFFdgaatifqctvdivkqraksnn
FBpp0070572  ..---NACIRDCD...VAL.EL........NS....DL........AAGYKFRGRARRLLG--......................
FBpp0070573  ..---NACIRDCD...VAL.EL........NS....DL........AAGYKFRGRARRLLG--......................
FBpp0070575  ..---NACIRDCD...VAL.EL........NS....DL........AAGYKFRGRARRLLG--......................
FBpp0074835  ..---ESLEALLQ...RAV.AH........CP....KS........EILWLMGAKSKWMAGDVpaargilslafqanpnsediwl
FBpp0080424  ..---REAVADCN...RVL.EL........NS....QY........LKALLLRARCYNDLE--......................
FBpp0080423  ..---REAVADCN...RVL.EL........NS....QY........LKALLLRARCYNDLE--......................
FBpp0076113  ..GNYTSAREVCN...EAI.RL........DP....KC........SKAFYRRAQAQRGLR--......................
FBpp0076114  ..GNYTSAREVCN...EAI.RL........DP....KC........SKAFYRRAQAQRGLR--......................
FBpp0076115  ..GNYTSAREVCN...EAI.RL........DP....KC........SKAFYRRAQAQRGLR--......................
FBpp0072561  ..KHQEKALAIFK...QVL.RN........DP....RN........IWATNGIGAVLAHKG--......................
FBpp0072562  ..KHQEKALAIFK...QVL.RN........DP....RN........IWATNGIGAVLAHKG--......................
FBpp0072561  ..---EKAKLAFE...RAL.QL........DQ....QC........VGALIGLAVLKLNQLEPesnklgvqmlskaytidnanpm
FBpp0072562  ..---EKAKLAFE...RAL.QL........DQ....QC........VGALIGLAVLKLNQLEPesnklgvqmlskaytidnanpm
FBpp0085923  ..GDIYAALRDCH...EAL.RL........DP....SY........VKAHFRLARALLELH--......................
FBpp0079893  ..---SNVKEDCT...ASL.EF........NP....RY........AKAYYRRARAHEATK--......................
FBpp0079894  ..---SNVKEDCT...ASL.EF........NP....RY........AKAYYRRARAHEATK--......................
FBpp0079895  ..---SNVKEDCT...ASL.EF........NP....RY........AKAYYRRARAHEATK--......................
FBpp0075683  ..---KEAANLLN...DAL.SIrgktlgenHP....AV........AATLNNLAVLYGKRG--......................
FBpp0077614  ..---SEAEMWFK...RAL.KL........AP....EQ........ASVYHHYAEFLSLQSRHhesaiyhrraaelapndytlvv
FBpp0085409  ..-----------...---.--........--....--........---IYYLAFGNARIK--......................
FBpp0271717  ..-----------...---.--........--....--........--YIYYLAFGNARIK--......................
FBpp0271719  ..-----------...---.--........--....--........--YIYYLAFGNARIK--......................
FBpp0086749  ..TKLERARDLFE...QCL.DQ........CP....PE........HAKYFYL----------......................
FBpp0073411  ..---YAVIEHCN...EVL.TL........DP....RN........VKALFRRAKAHAGAW--......................
FBpp0070907  ..GKFERGLNFVE...KCL.DS........EP....RN........HEALILRGRLLIALE--......................
FBpp0073412  ..---YAVIEHCN...EVL.TL........DP....RN........VKALFRRAKAHAGAW--......................
FBpp0070908  ..GKFERGLNFVE...KCL.DS........EP....RN........HEALILRGRLLIALE--......................
FBpp0085842  ..---DAALQSVE...HVL.RC........QP....NN........SKALYRKGRILEGKA--......................
FBpp0077718  ..---EMALMYYR...RIL.SL........GA....QS........PELYCNIALCCLYGGQIdlvlpcfqralatatqpgqksd
FBpp0076600  ..TGFADAKNCDE...LQR.DF........GD....LA........CFAYQLMAQICMRTE--......................
FBpp0076382  ..---DKALGHHT...QEL.TL........RQ....ELgdlsge..CRAHGHLGAVHMALC--......................
FBpp0071712  ..---SKALQDAE...TAL.GE........DK....NN........IRAIYQKAESLYYLG--......................
FBpp0086749  ..GQVEDARVVFE...RGT.EV........EYvkveDL........AAVWCEWAEMELRQQ--......................
FBpp0085479  ..---RSSLSDAQ...RAL.FY........KP....DY........TKARWRSAQCAYELE--......................
FBpp0112016  ..---SKALQDAE...TAL.GE........DK....NN........IRAIYQKAESLYYLG--......................
FBpp0292906  ..---HDAFLAYR...NSV.EK........SE....GN........ADTWCSIGVLYQQQN--......................
FBpp0079665  ..---HDAFLAYR...NSV.EK........SE....GN........ADTWCSIGVLYQQQN--......................
FBpp0079666  ..---HDAFLAYR...NSV.EK........SE....GN........ADTWCSIGVLYQQQN--......................
FBpp0079664  ..---HDAFLAYR...NSV.EK........SE....GN........ADTWCSIGVLYQQQN--......................
FBpp0084076  ..---KRALKDCQ...YVL.EKl.......QE....SN........LRAWLYQAHAYKGLK--......................
FBpp0111406  ..---KRGIVDCD...FVL.NKl.......DE....KN........LRAWMYRAMAYKGLN--......................
FBpp0074918  ..---EPAVKYYL...AYT.HL........EP....NG........FESWNNLAKALIKLG--......................
FBpp0082818  ..---LEAIKELN...EYL.KK........FM....SD........QEAWHELCNMYLAEGEFgkaafcmeevllhnphshlihq
FBpp0074480  ..---DEAIKCYR...NAL.KW........EK....DN........LQILKDLSLLQIQMRDLegyketrhhlftlrpsqhaswi
FBpp0111849  ..---DEAERHHR...AAL.EL........QP....NQ........VAAHLSYGITLARNSS-......................
FBpp0082819  ..---LEAIKELN...EYL.KK........FM....SD........QEAWHELCNMYLAEG--......................
FBpp0292061  ..---LKGLQDFE...KAL.HL........NK....YH........VNARKYMGETLVALG--......................
FBpp0085279  gsHNLILASERFE...GAL.QL........QP....MN........FEARYNLGLVALAQNDYelaeerfellkeqlmlpssvqh
FBpp0081805  ..---LKGLQDFE...KAL.HL........NK....YH........VNARKYMGETLVALG--......................
FBpp0100021  ..---NQSENWLE...LAL.YH........YD....DNvs......PEVLKIKLWNYPNLLES......................
FBpp0100023  ..---NQSENWLE...LAL.YH........YD....DNvs......PEVLKIKLWNYPNLLES......................
FBpp0074877  ..-----------...---.--........--....-Nvs......PEVLKIKLWNYPNLLES......................
FBpp0071879  ..KQQEKALQCFG...KIL.DC........NP....KN........LWAANGIGAVLSSCN--......................
FBpp0084559  ..---DEAAICCE...RHL.TL........AR....QLgdrlse..GRALYNLGNVYHAKG--......................
FBpp0075591  ..---EEALDDLN...KAL.EL........AN....DQqtrtk...CHAHCQRGVLYRKLD--......................
FBpp0076526  ..---DAAKDHIN...DYL.KI........AK....RLknqvee..QRAYATLGRVHLLHGQSladssasgsmeqlklaeknflr
FBpp0079851  ..---ELAEKAFN...ICL.PA........RR....KN........FIANYGMGLTLYHLN--......................
FBpp0290395  ..HNLILASERFE...GAL.QL........QP....MN........FEARYNLGLVALAQNDYelaeerfellkeqlmlpssvqh
FBpp0072146  ..---KRACIMMK...ALR.HL........TM....GNps......CKALFQEGRALAALG--......................
FBpp0076382  ..---NQAVDYLR...QGL.AS........AQ....TTgkseee..AKIRHQLGLALRSSG--......................
FBpp0083238  ..---DESHGCLQ...TVA.EE........KP....TD........DSTLQVLSFCYREME--......................
FBpp0111383  ..---KLGIIDCD...YVL.AKi.......DE....HY........LRAWLYRAAAYKRLN--......................
FBpp0080424  ..---DEALDIAV...SVM.KL........DT....TS........ADAIYVRGLCLYYTD--......................
FBpp0071560  ..---EEALLYFQ...QAV.RI........QT....DD........IGAHINVGRTFNNLK--......................
FBpp0071561  ..---EEALLYFQ...QAV.RI........QT....DD........IGAHINVGRTFNNLK--......................
FBpp0080423  ..---DEALDIAV...SVM.KL........DT....TS........ADAIYVRGLCLYYTD--......................
FBpp0071879  ..---EKAQLSFQ...IAL.EH........NG....QC........LNAALALALVKFEHN--......................
FBpp0077738  ..GNFKHAVELYH...RA-.--........--....--........-------GMLHKALEMAfesqqpeileiiasdlapdsda
FBpp0077934  ..---KDAINLYE...RAI.NL........NP....QKsln.....ESLLVNLSTLYELES--......................
FBpp0292775  ..GNFKHAVELYH...RA-.--........--....--........-------GMLHKALEMAfesqqpeileiiasdlapdsda
FBpp0087646  ..-NLPLAQHCFI...QAV.VL........EK....KC........YTAWTNLGVLYIKLN--......................
FBpp0292906  ..---KWAIKSFQ...ELL.YL........SP....NFtca.....NEVHLRLGLMLKHCG--......................
FBpp0079664  ..---KWAIKSFQ...ELL.YL........SP....NFtca.....NEVHLRLGLMLKHCG--......................
FBpp0086749  ..---TRTRHVFD...RAL.RA........LPit..QH........GRIWPLYLQFVRRFE--......................
FBpp0082652  ..---KLALFDLD...YVIfNL........DP....IH........LRAWLYRAGALARLN--......................
FBpp0077619  ..---NKCIEALS...FPF.AG........QL....LS........IVANYMIGKSYYKLD--......................
FBpp0086164  ..---NEAIQSYE...KVV.QL........AP....FC........YDARFTLSALLKQQG--......................
FBpp0087232  ..---QECLIDIK...RAL.DL........SY....SKdli.....YKLYERQARCYMALK--......................
FBpp0072561  ..TKRDMAKTHLK...KVT.EQ........FP....ED........IEAWIELAQILEQNDLQaslsaygtassilrdkakyeip
FBpp0072562  ..TKRDMAKTHLK...KVT.EQ........FP....ED........IEAWIELAQILEQNDLQaslsaygtassilrdkakyeip
FBpp0088148  ..---ERSLSYAR...HSL.YN........EC....GTkcrs....GLVHLTVARVYLEMG--......................
FBpp0088149  ..---ERSLSYAR...HSL.YN........EC....GTkcrs....GLVHLTVARVYLEMG--......................
FBpp0075786  ..---DASIDLAT...QAI.AQ........KP....HS........YEGYYARAKARMELG--......................
FBpp0075788  ..---DASIDLAT...QAI.AQ........KP....HS........YEGYYARAKARMELG--......................
FBpp0075787  ..---DASIDLAT...QAI.AQ........KP....HS........YEGYYARAKARMELG--......................
FBpp0075789  ..---DASIDLAT...QAI.AQ........KP....HS........YEGYYARAKARMELG--......................
FBpp0075785  ..---DASIDLAT...QAI.AQ........KP....HS........YEGYYARAKARMELG--......................
FBpp0083319  ..---EEAYKFIE...K--.--........-N....RL........SSLFFEKAYCEYQLNKQqqalktiddaglqplppnlkel
FBpp0076498  ..---QSSLADIE...NAL.RT........RC....TS........PKAHYLRALALSGLG--......................
FBpp0290580  ..---ADALRVLK...QMG.DQ........ED....ELr.......EQCLQLQSAILYSSEDFagaqsllnqraggtadtlnd..
FBpp0290395  ..---QKAVKMYR...MAL.DS........VP....KSlsqlr...LKIRENIGILFIRMG--......................
FBpp0080720  ..---AEARETLL...EAM.EL........TK....ELkdatqe..GILQANLGLVYLREG--......................
FBpp0086164  ..----KFLNFST...LAA.HL........NP....QD........RDMWIRVSDLLVQQG--......................
FBpp0080741  ..---EKATSCYK...RAL.RL........SR....LYthrdle..AEILLHLGKIFAKDTQ-......................
FBpp0087297  ..---SQALGVFR...EAE.QR........SSr...QD........HEIYHYLGELLYRAATT......................
FBpp0070720  ..-----------...---.--........--....--........-----------------......................
FBpp0089396  ..-----------...---.--........--....--........-----------------......................
FBpp0111789  ..-----------...---.--........--....--........-----------------......................
FBpp0086683  ..---SRCVCYVMkelRLL.TI........NN....PS........ALALCQHGRALSDLG--......................
FBpp0289328  ..-----------...---.--........--....--........-----------------......................
FBpp0070667  ..---ADADLILT...AAV.EH........AP....NV........AENHVVLASALAMKH--......................
FBpp0082624  ..---DMSQEVLD...VYL.SQ........HG....DS........TIAINLKACNRFRLFNGrvaeqeikniadngtfgadllr
FBpp0081552  ..---GKALQQCK...EAL.DI........M-....KD........AQVYCDRADALLGTE--......................
FBpp0086749  ..-------EIYE...KAI.ES........LP....EQnm......RHMCVKFAELETKLG--......................
FBpp0087646  ..---EQAAHALN...TVA.HA........T-....--........FKPIIGLAQAYYLAG--......................
FBpp0071879  ..EKIDKAIEMLV...KVV.ES........ASyh..QN........TNSWLNLAFAYEQKR--......................
FBpp0080894  ..---TEMAQLAH...KAV.SI........NK....YR........PETCCVIGNYYSIRC--......................
FBpp0112213  ..---EAAREAYD...TFL.SH........YP....YC........YGYWRKYADYEKRKG--......................
FBpp0087233  ..---QECLIDIK...RAL.DL........SY....SKdli.....YKLYERQARCYMALK--......................
FBpp0070906  ..---EEAERMHK...KAI.KI........KS....ELlghfd...YEVGLSIGHLASLYN--......................
FBpp0087646  ..ELRHPIQVYAE...QLL.EL........NP....NS........NLALLVKALDLFAEG--......................
FBpp0082112  ..---KEAFQCFL...VPV.KQ........FH....SN........PRLWLRMAEACIM----......................
FBpp0086359  ..---QQVEKVAV...ETL.KL........WP....NN........AVAQLHYGLALRQFHA-......................
FBpp0076526  ..---DKALEYLW...KEF.EL........NQ....DAp.......SEAFTTLCTIAEICEQQ......................
FBpp0085279  ..--------CVN...QLH.EI........GSlk..NN........APGLINAGIVELGSH--......................
FBpp0074835  ..---ENARKVLN...KAR.EN........IP....TD........RQIWTTAAKLEEANG--......................
FBpp0078887  ..---DKAARLFE...HAL.AL........AP....RH........PEVLLRYGEFLEHNQR-......................
FBpp0290580  ..QALRDALKDYE...QAL.EL........--....--........-----------------......................
FBpp0085047  ..-----------...---.--........--....--........-----------------......................
FBpp0086380  ..---ELSLRFIE...HAL.KL........NL....KYfgdkdmhvALSYHLMARTQSCMG--......................
FBpp0083435  ..---EHVIYHTQ...FVE.TE........ES....PS........EKSIYRRALAYYHLK--......................
FBpp0078891  ..EQMQDAFHIYQ...EFC.EK........FK....PT........PALLNGQAVVHLGLE--......................
FBpp0082419  ..-----------...---.--........--....--........-----------------......................
FBpp0082420  ..-----------...---.--........--....--........-----------------......................
FBpp0086749  ..-----------...---.--........--....--........-----------------......................
FBpp0078027  ..---KDSLEAKR...LLK.NL........QR....YD........APINLEVCDALYELN--......................
FBpp0088148  ..---GDAQDYCK...EAT.KLslisgd..QA....TY........TRSIRVMGDIYRNKM--......................
FBpp0088149  ..---GDAQDYCK...EAT.KLslisgd..QA....TY........TRSIRVMGDIYRNKM--......................
FBpp0290863  ..---SEALKDCS...RA-.--........--....--........-----------------......................
FBpp0080720  ..---TWTLQQLA...KLL.EK........MP....DD........KDILELYGLTKNWFG--......................
FBpp0083319  ..ALLKSAVDWYK...KNE.VS........SG....DL........SDMWRQAAEFHLRGG--......................
FBpp0071288  ..-----------...---.--........--....--........-----------------......................
FBpp0081398  ..GSLQLAWEILE...AAA.QIfsrqglsgLP....YL........AEVQTELANIEFENG--......................
FBpp0085015  ..---KKAARLLS...QIL.ES........QP....TH........S----------------......................
FBpp0084188  ..-DVTEALQHYQ...RSI.QI........DP....RQ........SEVVIDACELLVKE---......................
FBpp0290580  ..---VGAEREFH...ASA.EF........CS....EN........SIWRLNAGHVLFMQGD-......................
FBpp0085012  ..-----------...---.--........--....--........ADILEYLAFSTYKEG--......................
FBpp0086380  ..---QDALAIQQ...RAV.--........--....--........-----------------......................
FBpp0076382  ..GAHKEALTAHR...YQL.VL........AM....KCkdtqaa..AAALTSLGHVYTASG--......................
FBpp0071879  ..---RKAKMWLL...KVR.HL........VP....HD........PFVIFNLGLAIKK----......................
FBpp0076961  ..---TFAQKYFD...KCI.TE........NEs...TD........HKALYLRSKFKRSVA--......................
FBpp0075717  ..---EAALNDLK...LAI.NF........GL....ELkss.....VDYYLKMAKAYAVMG--......................
FBpp0080267  ..---AESYDDCL...CAL.DLg.......YP....EEyl......PLIKLRQAACALKLR--......................
FBpp0070907  ..TKKSEAVLAYK...EVI.RE........CPmal.QV........IEALLELGVNGNEINSLvmhaatvpdhfdwlskwikala
FBpp0085033  ..---SEALPLLH...NCL.KL........QP....HD........ARVL-------------......................
FBpp0082507  ..KNIDLARQHLE...KAW.SI........SE....PLpnfdvk..FDTASLLAQLHLQTDR-......................
FBpp0077738  ..GHLEQARSVRA...LRQ.AI........ED....DD........LETEAKVAVLAIELG--......................
FBpp0292775  ..GHLEQARSVRA...LRQ.AI........ED....DD........LETEAKVAVLAIELG--......................
FBpp0085676  ..---NFALHYLN...KAL.AL........EP....TD........HMTLYKRCQSKRKAAQM......................
FBpp0087091  ..---RQCLDNIK...LAR.Q-........--....--........-----------------......................
FBpp0082624  ..---KEAEELLM...QIS.DM........DI....KNq.......HTYCMILAKCHIHCG--......................
FBpp0070908  ..TKKSEAVLAYK...EVI.RE........CPmal.QV........IEALLELGVNGNEINSLvmhaatvpdhfdwlskwikala
FBpp0070431  ..---KEALHHLE...EAQ.RI........--....--........-----------------......................
FBpp0075442  ..---EGCLADAY...KVL.TL........LS....EQ........TECLASVSRARRWLV--......................
FBpp0089265  ..---DEALAALR...ESI.ML........AQ....EH........-----------------......................
FBpp0075443  ..---EGCLADAY...KVL.TL........LS....EQ........TECLASVSRARRWLV--......................
FBpp0070906  ..---FQSVNIYK...EAL.AV........RR....GIfgnmnfhvAIAHEDLSYAYYVHEYS......................
FBpp0073018  ..---DEALAALR...ESI.ML........AQ....EH........-----------------......................
FBpp0078634  ..---EKSAKCCH...RTL.HR........Q-....--........----------------Lesktydpidfalntat......
FBpp0087626  ..---REAYDDCS...NAL.E-........--....--........-----------------......................
FBpp0075754  ..---YQAIKVLE...P-I.EI........HK....KS........--AYSHIPACQISTSYY......................
FBpp0087625  ..---REAYDDCS...NAL.E-........--....--........-----------------......................
FBpp0071288  ..----EVAGIYE...KML.LY........HG....DS........PDLWVDAALWLYEFNRLnidrvkdillrglqrhpdsea.
FBpp0085046  ..-----------...--L.LR........GP....TK........AELFRTLGKVRFERR--......................
FBpp0110159  ..-----------...--L.LR........GP....TK........AELFRTLGKVRFERR--......................
FBpp0072679  ..---ESAREYYE...KSH.YL........E-....--........-----GYMEALYHLE--......................
FBpp0082624  ..-----------...---.--........SSt...PD........GKLDLNLAVCMFYLG--......................
FBpp0084254  ..---------DS...KLL.EG........VD....NY........ALINLDIVWCYLRLKNItqlpdaqrrldicergfvksyg
FBpp0085032  ..---ADALKVVN...IAL.TD........NP....HD........IKLLL------------......................


                                                                                                    
                                                                                                    
d1zu2a1        .....................................................................................
FBpp0112456  .....................................................................................
FBpp0112455  .....................................................................................
FBpp0070352  .....................................................................................
FBpp0070351  .....................................................................................
FBpp0070402  .....................................................................................
FBpp0080138  .....................................................................................
FBpp0080139  .....................................................................................
FBpp0074609  .....................................................................................
FBpp0084171  .....................................................................................
FBpp0085420  n....................................................................................
FBpp0085421  n....................................................................................
FBpp0085422  n....................................................................................
FBpp0085420  n....................................................................................
FBpp0085421  n....................................................................................
FBpp0085422  n....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  niltmldnkglqddalrisnqalqhlpndvsilfi..................................................
FBpp0084693  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  vyfnlgmlamdessfdeaeqffkraihlkadfrsalfnlallladtkrpldavpflnqlirhhpshvkglil.............
FBpp0071561  vyfnlgmlamdessfdeaeqffkraihlkadfrsalfnlallladtkrpldavpflnqlirhhpshvkglil.............
FBpp0077790  .....................................................................................
FBpp0076600  h....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0271718  .....................................................................................
FBpp0290895  gahvearytcylqlsvlyrsdgrlqdaaaalreslkalpllpqkqravlhlrlgeilaelqdwneaehqqrlamqlqpeqgaayv
FBpp0290896  gahvearytcylqlsvlyrsdgrlqdaaaalreslkalpllpqkqravlhlrlgeilaelqdwneaehqqrlamqlqpeqgaayv
FBpp0081673  .....................................................................................
FBpp0111849  ahdqarssaylqlgalyveqgklqralaiyrealsslpglpqqreilyqrigdvlgrlqqwdeaerhhraalelqpnqvaahlsy
FBpp0077614  ahdqarssaylqlgalyveqgklqralaiyrealsslpglpqqreilyqr...................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0076382  esdamca..............................................................................
FBpp0076382  .....................................................................................
FBpp0080894  a....................................................................................
FBpp0081606  .....................................................................................
FBpp0081607  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  n....................................................................................
FBpp0074835  eaifmetkpqrktksvdalkkcehdphvlla......................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0085344  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0087646  qyk..................................................................................
FBpp0083769  eeissrweplfin........................................................................
FBpp0070572  .....................................................................................
FBpp0070573  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0074835  aavklesenseyerarrllakargsaptprvmmk...................................................
FBpp0080424  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0076114  .....................................................................................
FBpp0076115  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0072561  vlnhlanhfffkkdyqkvhhlalhafhnteneamraescyq............................................
FBpp0072562  vlnhlanhfffkkdyqkvhhlalhafhnteneamraescyq............................................
FBpp0085923  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0077614  a....................................................................................
FBpp0085409  .....................................................................................
FBpp0271717  .....................................................................................
FBpp0271719  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0073412  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0077718  iwyn.................................................................................
FBpp0076600  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0071712  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0079666  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  rlae.................................................................................
FBpp0074480  gfamsyhllgdydmansiletfsqsqtsieahdyrhselllyqnqiliesnrlqqavdhltkyqgqivdklavretmgdlyiklq
FBpp0111849  .....................................................................................
FBpp0082819  .....................................................................................
FBpp0292061  .....................................................................................
FBpp0085279  shvfyqlaklqerrlesglisnftpgaalqaylqvvgisasdidsrlfek...................................
FBpp0081805  .....................................................................................
FBpp0100021  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0074877  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  slllikdlsgqiskleqldmqarcyln..........................................................
FBpp0079851  .....................................................................................
FBpp0290395  shvfyqlaklqerrlesglisnftpgaalqaylqvvgisasdidsrlfek...................................
FBpp0072146  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0077738  elinrcadffcsieqfqkavhllaktrhleral....................................................
FBpp0077934  .....................................................................................
FBpp0292775  elinrcadffcsieqfqkavhllaktrhleral....................................................
FBpp0087646  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0087232  .....................................................................................
FBpp0072561  aeiqnn...............................................................................
FBpp0072562  aeiqnn...............................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0075786  .....................................................................................
FBpp0075788  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0075789  .....................................................................................
FBpp0075785  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076498  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  .....................................................................................
FBpp0089396  .....................................................................................
FBpp0111789  .....................................................................................
FBpp0086683  .....................................................................................
FBpp0289328  .....................................................................................
FBpp0070667  .....................................................................................
FBpp0082624  hnlvvfrngegalrvlpgllniipearln........................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0112213  .....................................................................................
FBpp0087233  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0082112  .....................................................................................
FBpp0086359  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085047  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0082420  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0081398  .....................................................................................
FBpp0085015  .....................................................................................
FBpp0084188  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  .....................................................................................
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070907  qmfnfkhsdasqtflmlhdnttlrcnehlmma.....................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070908  qmfnfkhsdasqtflmlhdnttlrcnehlmma.....................................................
FBpp0070431  .....................................................................................
FBpp0075442  .....................................................................................
FBpp0089265  .....................................................................................
FBpp0075443  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0073018  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0087626  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0085046  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  eqfirlfsikgpssperalimrlhll...........................................................
FBpp0085032  .....................................................................................


                                                                                                    
                                                                                                    
d1zu2a1        .....................................................................................
FBpp0112456  .....................................................................................
FBpp0112455  .....................................................................................
FBpp0070352  .....................................................................................
FBpp0070351  .....................................................................................
FBpp0070402  .....................................................................................
FBpp0080138  .....................................................................................
FBpp0080139  .....................................................................................
FBpp0074609  .....................................................................................
FBpp0084171  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0271718  .....................................................................................
FBpp0290895  tygqtlarngsrlaeaeswfkralqlaplepsshhhyadfleqqerhhealglrlraaalapqdytlqsc...............
FBpp0290896  tygqtlarngsrlaeaeswfkralqlaplepsshhhyadfleqqerhhealglrlraaalapqdytlqsc...............
FBpp0081673  .....................................................................................
FBpp0111849  gitlarnssraseaemwfkralklapeqasvyhhyaeflslqsrhhesaiyhrraaelapndytlvva.................
FBpp0077614  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0081607  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0085344  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070573  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0076114  .....................................................................................
FBpp0076115  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0085409  .....................................................................................
FBpp0271717  .....................................................................................
FBpp0271719  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0073412  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0071712  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0079666  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  qqekavpifeslirrnpenvlyyeqyiaarqvtdssavvsiyrvfqeqypralcprrlplniangdefrvvtdeylrrglrkgip
FBpp0111849  .....................................................................................
FBpp0082819  .....................................................................................
FBpp0292061  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0081805  .....................................................................................
FBpp0100021  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0074877  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0087232  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0075786  .....................................................................................
FBpp0075788  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0075789  .....................................................................................
FBpp0075785  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076498  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  .....................................................................................
FBpp0089396  .....................................................................................
FBpp0111789  .....................................................................................
FBpp0086683  .....................................................................................
FBpp0289328  .....................................................................................
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0112213  .....................................................................................
FBpp0087233  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0082112  .....................................................................................
FBpp0086359  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085047  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0082420  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0081398  .....................................................................................
FBpp0085015  .....................................................................................
FBpp0084188  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  .....................................................................................
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075442  .....................................................................................
FBpp0089265  .....................................................................................
FBpp0075443  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0073018  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0087626  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0085046  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................


                                                                                 100       110      
                                                                                   |         |      
d1zu2a1        ...........................................................TPDETE.AKHNFDLATQFFQQAVDE.
FBpp0112456  ...........................................................------.--KDKEIAFRIFELGLKR.
FBpp0112455  ...........................................................------.--KDKEIAFRIFELGLKR.
FBpp0070352  ...........................................................------.---RSVEAVEAYQQALQL.
FBpp0070351  ...........................................................------.---RSVEAVEAYQQALQL.
FBpp0070402  ...........................................................------.---NVAGARQVFERWMEW.
FBpp0080138  ...........................................................------.------------------.
FBpp0080139  ...........................................................------.------------------.
FBpp0074609  ...........................................................------.---DYEKAISIYEQV---.
FBpp0084171  ...........................................................------.---DYMEAARYYQRAQEL.
FBpp0085420  ...........................................................MGNTLK.ELQDVSGALQCYTRAIQI.
FBpp0085421  ...........................................................MGNTLK.ELQDVSGALQCYTRAIQI.
FBpp0085422  ...........................................................MGNTLK.ELQDVSGALQCYTRAIQI.
FBpp0085420  ...........................................................LGNVLK.EARIFDRAVAAYLRALNL.
FBpp0085421  ...........................................................LGNVLK.EARIFDRAVAAYLRALNL.
FBpp0085422  ...........................................................LGNVLK.EARIFDRAVAAYLRALNL.
FBpp0077790  ...........................................................--NTYR.KLENYKQAKVYYEKAMSE.
FBpp0082545  ...........................................................RANVLG.KLKHYTEAEAIYKRVIEL.
FBpp0084693  ...........................................................------.--HDLDAGLAALQQALER.
FBpp0084691  ...........................................................------.--HDLDAGLAALQQALER.
FBpp0084692  ...........................................................------.--HDLDAGLAALQQALER.
FBpp0084694  ...........................................................------.--HDLDAGLAALQQALER.
FBpp0112211  ...........................................................------.--HDLDAGLAALQQALER.
FBpp0072096  ...........................................................KAAKLT.ESKHPDMALRFYQHALEVi
FBpp0071560  ...........................................................LGDIYInHMKDLDEAEKCYRSILHY.
FBpp0071561  ...........................................................LGDIYInHMKDLDEAEKCYRSILHY.
FBpp0077790  ...........................................................------.---QQSKAQAAYQKALEL.
FBpp0076600  ...........................................................IGAMQF.YMKKKDLSLQTLNTAATL.
FBpp0271716  ...........................................................------.---EYTSGLKYCRAFLDI.
FBpp0077790  ...........................................................------.---DFMKAFEAYNEGLKY.
FBpp0271718  ...........................................................------.---EYTSGLKYCRAFLDI.
FBpp0290895  ...........................................................VADALR.LLNRLAEAELWYRKAVTL.
FBpp0290896  ...........................................................VADALR.LLNRLAEAELWYRKAVTL.
FBpp0081673  ...........................................................VSRILV.RLKKYEEATKALKKEISLn
FBpp0111849  ...........................................................AATAMR.LLDRKVDAEMWYRKAVAL.
FBpp0077614  ...........................................................IGDVLG.RLQQWDEAERHHRAALEL.
FBpp0084692  ...........................................................------.---IKANCYKVFERGLEA.
FBpp0084694  ...........................................................------.---IKANCYKVFERGLEA.
FBpp0112211  ...........................................................------.---IKANCYKVFERGLEA.
FBpp0084691  ...........................................................------.---IKANCYKVFERGLEA.
FBpp0084693  ...........................................................------.---IKANCYKVFERGLEA.
FBpp0076382  ...........................................................------.---NYRAAVRYYDQDLALa
FBpp0076382  ...........................................................------.---RYGEALAAFASGLAQ.
FBpp0080535  ...........................................................------.---NFEKAEQAYAKAIEL.
FBpp0072164  ...........................................................------.---NNMEALKDCTTVLAI.
FBpp0084016  ...........................................................------.---NNDMAQTLLDDVVTS.
FBpp0076382  ...........................................................LGQVQQ.RMGQHAQALELHRQDLEI.
FBpp0076382  ...........................................................------.---QFTQAAACHEQVLRI.
FBpp0080894  ...........................................................LGETYE.KLDKCENAVKCYWKAIDV.
FBpp0081606  ...........................................................------.---KFKQALCDFEFVAKC.
FBpp0081607  ...........................................................------.---KFKQALCDFEFVAKC.
FBpp0084559  ...........................................................------.---EFNTAIEYHNRHLAI.
FBpp0075683  ...........................................................------.---RYTEAEILYKQVLTR.
FBpp0081284  ...........................................................------.---KFEEAYKDATALFKA.
FBpp0079468  ...........................................................------.---ELEDALEDFQKVIQL.
FBpp0087297  ...........................................................LSLIYI.ASEQYASAFHTLAAAINL.
FBpp0074835  ...........................................................VSKLFW.SEHKFSKCRDWFNRTVKI.
FBpp0079893  ...........................................................--MVLQ.WRGDINLAVQLLNKAIEV.
FBpp0079894  ...........................................................--MVLQ.WRGDINLAVQLLNKAIEV.
FBpp0079895  ...........................................................--MVLQ.WRGDINLAVQLLNKAIEV.
FBpp0082765  ...........................................................------.---KPDEALEDYKKVTEI.
FBpp0079617  ...........................................................------.---NFDEAIKHLQRAYDL.
FBpp0084440  ...........................................................------.---KHLESLNVYKKLLDF.
FBpp0080423  ...........................................................------.------------------.
FBpp0080424  ...........................................................------.------------------.
FBpp0085344  ...........................................................------.---EPRLAEKMLKDAAKL.
FBpp0081552  ...........................................................------.---EYEQAIQDFDQVLQE.
FBpp0087646  ...........................................................LGLHFS.HVKKWDSAIQCFRIAIKN.
FBpp0083769  ...........................................................LGHSLR.KVHKYEEALYNFQYALLL.
FBpp0070572  ...........................................................------.---DFELAAHDLRQACKL.
FBpp0070573  ...........................................................------.---DFELAAHDLRQACKL.
FBpp0070575  ...........................................................------.---DFELAAHDLRQACKL.
FBpp0074835  ...........................................................SARLEW.ALEKFDEALRLLEEAVEV.
FBpp0080424  ...........................................................------.---KFEESVADYETALQL.
FBpp0080423  ...........................................................------.---KFEESVADYETALQL.
FBpp0076113  ...........................................................------.---NYEEAINDLKTAHNL.
FBpp0076114  ...........................................................------.---NYEEAINDLKTAHNL.
FBpp0076115  ...........................................................------.---NYEEAINDLKTAHNL.
FBpp0072561  ...........................................................------.---CVIEARDIFAQVREA.
FBpp0072562  ...........................................................------.---CVIEARDIFAQVREA.
FBpp0072561  ...........................................................LARSFH.AQSDYDQAFQYYYQSTQI.
FBpp0072562  ...........................................................LARSFH.AQSDYDQAFQYYYQSTQI.
FBpp0085923  ...........................................................------.---RPQDADQCLQALIQR.
FBpp0079893  ...........................................................------.---DMNECL---------.
FBpp0079894  ...........................................................------.---DMNECL---------.
FBpp0079895  ...........................................................------.---DMNECL---------.
FBpp0075683  ...........................................................------.---KYKDAEPLCKRALEI.
FBpp0077614  ...........................................................AATAMR.LLDRKVDAEMWYRKAVAL.
FBpp0085409  ...........................................................------.---EYTSGLKYCRAFLDI.
FBpp0271717  ...........................................................------.---EYTSGLKYCRAFLDI.
FBpp0271719  ...........................................................------.---EYTSGLKYCRAFLDI.
FBpp0086749  ...........................................................------.------------------.
FBpp0073411  ...........................................................------.---NPAQARRDFLDALAL.
FBpp0070907  ...........................................................------.---RHTQAVCAFRTAQMV.
FBpp0073412  ...........................................................------.---NPAQARRDFLDALAL.
FBpp0070908  ...........................................................------.---RHTQAVCAFRTAQMV.
FBpp0085842  ...........................................................------.---DTQGAIKLLQKVATL.
FBpp0077718  ...........................................................LSFVAV.TSGDFNLAKRCLQLCLTS.
FBpp0076600  ...........................................................------.---RNKLAVSALRRALKL.
FBpp0076382  ...........................................................------.---SWTNAVKCYQEQLER.
FBpp0071712  ...........................................................------.---QFEQSLMFFHRGLRA.
FBpp0086749  ...........................................................------.---QFEAALKLMQRATA-.
FBpp0085479  ...........................................................------.---RFDLCTQMCEELLEV.
FBpp0112016  ...........................................................------.---QFEQSLMFFHRGLRA.
FBpp0292906  ...........................................................------.---QPTDALQAYICAVQL.
FBpp0079665  ...........................................................------.---QPTDALQAYICAVQL.
FBpp0079666  ...........................................................------.---QPTDALQAYICAVQL.
FBpp0079664  ...........................................................------.---QPTDALQAYICAVQL.
FBpp0084076  ...........................................................------.---QDDKFEESVVKAREH.
FBpp0111406  ...........................................................------.DESNFENCVKY-------.
FBpp0074918  ...........................................................------.---DKQRAHRVLGEALKC.
FBpp0082818  ...........................................................IRYTMG.GVENMESARTYYSQALKL.
FBpp0074480  plfvnvrtlhqiperaavieelalqyfenltrsghfsredadagipvepasalvwtalfLAQHYD.YMRDTDRALEYINVAIDH.
FBpp0111849  ...........................................................------.---RASEAEMWFKRALKL.
FBpp0082819  ...........................................................------.---EFGKAAFCMEEVLLH.
FBpp0292061  ...........................................................--RSYE.EENRIAEAVKAYSDCLNL.
FBpp0085279  ...........................................................VGSLYE.QIQDHQEANQYYNEAYRI.
FBpp0081805  ...........................................................--RSYE.EENRIAEAVKAYSDCLNL.
FBpp0100021  ...........................................................LVEANK.GLGHYFEAKKYANELLSI.
FBpp0100023  ...........................................................LVEANK.GLGHYFEAKKYANELLSI.
FBpp0074877  ...........................................................LVEANK.GLGHYFEAKKYANELLSI.
FBpp0071879  ...........................................................------.---NLSAGGAIFKQIIEC.
FBpp0084559  ...........................................................------.------------------.
FBpp0075591  ...........................................................------.---NLEAARADFEAAAQL.
FBpp0076526  ...........................................................IGVVKE.HMEAFQESIEYIDKAIKI.
FBpp0079851  ...........................................................------.---RLEEAIPYLSRCTEV.
FBpp0290395  ...........................................................VGSLYE.QIQDHQEANQYYNEAYRI.
FBpp0072146  ...........................................................------.---EYNLARNAYLQAQAK.
FBpp0076382  ...........................................................------.---DAEGAHIQLETAAQL.
FBpp0083238  ...........................................................------.---QLDKIVELYQHAVKQ.
FBpp0111383  ...........................................................------.------------------.
FBpp0080424  ...........................................................------.---NLDKGILHFERALTL.
FBpp0071560  ...........................................................------.---RYAEAEQAYVQAKAL.
FBpp0071561  ...........................................................------.---RYAEAEQAYVQAKAL.
FBpp0080423  ...........................................................------.---NLDKGILHFERALTL.
FBpp0071879  ...........................................................------.DEQSYQDGKMLLTAAYKE.
FBpp0077738  ...........................................................G-----.------------------.
FBpp0077934  ...........................................................------.---NNSKAKK--------.
FBpp0292775  ...........................................................G-----.------------------.
FBpp0087646  ...........................................................------.---EVRLANEAFTRAQQS.
FBpp0292906  ...........................................................------.---EFHIALKHLQLALLYt
FBpp0079664  ...........................................................------.---EFHIALKHLQLALLYt
FBpp0086749  ...........................................................------.---MPETALRVYRRYLKL.
FBpp0082652  ...........................................................------.NESEFE------------.
FBpp0077619  ...........................................................------.---LLDLALESFANATHM.
FBpp0086164  ...........................................................------.---RHEEAVQALEQPGEAe
FBpp0087232  ...........................................................------.---DYPHTIDSFKKCITA.
FBpp0072561  ...........................................................VASLHY.RLGNLKMAKLTLESALK-.
FBpp0072562  ...........................................................VASLHY.RLGNLKMAKLTLESALK-.
FBpp0088148  ...........................................................------.---GFSRALEGLQGAYKIa
FBpp0088149  ...........................................................------.---GFSRALEGLQGAYKIa
FBpp0075786  ...........................................................------.---ALNEALVDANEAMQ-.
FBpp0075788  ...........................................................------.---ALNEALVDANEAMQ-.
FBpp0075787  ...........................................................------.---ALNEALVDANEAMQ-.
FBpp0075789  ...........................................................------.---ALNEALVDANEAMQ-.
FBpp0075785  ...........................................................------.---ALNEALVDANEAMQ-.
FBpp0083319  ...........................................................RTQVLY.RLERYDECLDSYRDIIKN.
FBpp0076498  ...........................................................------.---RLEEALYNGFLAICL.
FBpp0290580  ...........................................................EGCLLF.QADQHEAAVQRFQAALQV.
FBpp0290395  ...........................................................------.---SYSDAASSFEFIMTE.
FBpp0080720  ...........................................................------.---LMSQAENACRLAWKLg
FBpp0086164  ...........................................................------.---NLARARLIYTKAIKM.
FBpp0080741  ...........................................................------.---MTSIAKKCYEHAKRI.
FBpp0087297  ...........................................................QSQKDV.ASQQQDEARTYFELAVQ-.
FBpp0070720  ...........................................................------.-------A----------.
FBpp0089396  ...........................................................------.-------A----------.
FBpp0111789  ...........................................................------.-------A----------.
FBpp0086683  ...........................................................------.---KYHPSRLCYIKALKK.
FBpp0289328  ...........................................................------.------------------.
FBpp0070667  ...........................................................------.---DFNRSLQHFDEAERL.
FBpp0082624  ...........................................................LAIYYL.KQGDVQEAHALMK---EL.
FBpp0081552  ...........................................................------.---MYDDAIHSFQAALDL.
FBpp0086749  ...........................................................------.---EVDRARAIYAH----.
FBpp0087646  ...........................................................------.---QLQESYSIYNS----.
FBpp0071879  ...........................................................------.---LWAHGVNAYQKAIDIy
FBpp0080894  ...........................................................------.---DHQVAISYFQRALKL.
FBpp0112213  ...........................................................------.------------------.
FBpp0087233  ...........................................................------.---DYPHTIDSFKKCITA.
FBpp0070906  ...........................................................-----Y.QMKKYRDAEQLYMRSIDIs
FBpp0087646  ...........................................................------.---QVVASRQLALQAQKS.
FBpp0082112  ...........................................................------.------------------.
FBpp0086359  ...........................................................------.---DYAKALPYLKYAVESg
FBpp0076526  ...........................................................SHPFWT.VHDVYQKALRQA------.
FBpp0085279  ...........................................................------.---NLILASERFEGALQL.
FBpp0074835  ...........................................................------.------------------.
FBpp0078887  ...........................................................------.---NIVLADQYYFQALTI.
FBpp0290580  ...........................................................------.------------------.
FBpp0085047  ...........................................................------.---NHEGALQAYQVALKL.
FBpp0086380  ...........................................................------.---DFRSALNN-------.
FBpp0083435  ...........................................................------.---EFAKAQATI------.
FBpp0078891  ...........................................................------.---RYEEADSVLRESLLK.
FBpp0082419  ...........................................................------.MLKDYKKALKYCKLILQY.
FBpp0082420  ...........................................................------.MLKDYKKALKYCKLILQY.
FBpp0086749  ...........................................................------.----------VYERALKE.
FBpp0078027  ...........................................................------.---QLENAKAE-------.
FBpp0088148  ...........................................................------.---DMDRAFRQYEQAMGT.
FBpp0088149  ...........................................................------.---DMDRAFRQYEQAMGT.
FBpp0290863  ...........................................................------.------------------.
FBpp0080720  ...........................................................--QLLM.KQGKYLEAKNLFKEA---.
FBpp0083319  ...........................................................------.---ASETAASSLEELLKL.
FBpp0071288  ...........................................................------.------------------.
FBpp0081398  ...........................................................------.---ILEAAREDYEKALKI.
FBpp0085015  ...........................................................------.------------------.
FBpp0084188  ...........................................................------.------------------.
FBpp0290580  ...........................................................------.---KYNEAAAFYEPIVRQ.
FBpp0085012  ...........................................................------.---NIESALTMTNELLQL.
FBpp0086380  ...........................................................------.------------------.
FBpp0076382  ...........................................................------.---DYPNALASHKQCVQL.
FBpp0071879  ...........................................................------.------------------.
FBpp0076961  ...........................................................------.---LTQDALEDSLRAMEVr
FBpp0075717  ...........................................................------.---EPARAEISLKIA---.
FBpp0080267  ...........................................................------.---NFALCEEHLHELL--.
FBpp0070907  ...........................................................LGKCLY.YNGDYFQAEDIFSSTLCA.
FBpp0085033  ...........................................................------.------------------.
FBpp0082507  ...........................................................------.---NSHQAKAMLRRAVEL.
FBpp0077738  ...........................................................------.---MIEEAKDLYRRCKRF.
FBpp0292775  ...........................................................------.---MIEEAKDLYRRCKRF.
FBpp0085676  ...........................................................------.-----LGALDDSRAAAKL.
FBpp0087091  ...........................................................------.------------------.
FBpp0082624  ...........................................................------.------------------.
FBpp0070908  ...........................................................LGKCLY.YNGDYFQAEDIFSSTLCA.
FBpp0070431  ...........................................................------.------------------.
FBpp0075442  ...........................................................--HALF.KMHKYGDAEIFLSKWI--.
FBpp0089265  ...........................................................------.------------------.
FBpp0075443  ...........................................................--HALF.KMHKYGDAEIFLSKWI--.
FBpp0070906  ...........................................................TGDFSC.AQDHVDKAVNIM------.
FBpp0073018  ...........................................................------.------------------.
FBpp0078634  ...........................................................LSQFYI.GEKRFEEARHHL------.
FBpp0087626  ...........................................................------.------------------.
FBpp0075754  ...........................................................VGFAYM.MMRRYADAIRTFSDIL--.
FBpp0087625  ...........................................................------.------------------.
FBpp0071288  ...........................................................L-----.------------------.
FBpp0085046  ...........................................................------.---NEEGALKAYQAALKH.
FBpp0110159  ...........................................................------.---NEEGALKAYQAALKH.
FBpp0072679  ...........................................................------.---QFD----DLEKCVER.
FBpp0082624  ...........................................................------.---LYEEAQQLMANA---.
FBpp0084254  ...........................................................QGVLLF.HQNRRDEAYEKLE-----.
FBpp0085032  ...........................................................------.------------------.


                        120                                                              130       1
                          |                                                                |        
d1zu2a1        .......QPDNT......H.................................................YLKSLEMTAKAPQLHAE
FBpp0112456  .......FGGSP......E.................................................YVMCYIDYLSHLNEDN-
FBpp0112455  .......FGGSP......E.................................................YVMCYIDYLSHLNEDN-
FBpp0070352  .......QPGFI......R.................................................VRYNVGVCCMNLKAYKE
FBpp0070351  .......QPGFI......R.................................................VRYNVGVCCMNLKAYKE
FBpp0070402  .......QPE-E......Q.................................................AWQTYVNFELRYKEIDR
FBpp0080138  .......-----......-.................................................-----------------
FBpp0080139  .......-----......-.................................................-----------------
FBpp0074609  .......-----......-.................................................-----------------
FBpp0084171  .......VPGNG......A.................................................PFNQLAVISIYHHKRFD
FBpp0085420  .......NPAFA......D.................................................AHSNLASIHKDSGNIPE
FBpp0085421  .......NPAFA......D.................................................AHSNLASIHKDSGNIPE
FBpp0085422  .......NPAFA......D.................................................AHSNLASIHKDSGNIPE
FBpp0085420  .......SPNNA......V.................................................VHGNLACVYYEQGLIDL
FBpp0085421  .......SPNNA......V.................................................VHGNLACVYYEQGLIDL
FBpp0085422  .......SPNNA......V.................................................VHGNLACVYYEQGLIDL
FBpp0077790  .......-----......-.................................................-----------------
FBpp0082545  .......EPHNT......L.................................................YHTNLGVLYHRWDKTQE
FBpp0084693  .......DPANT......R.................................................VALQMIDLCLQRPKVDE
FBpp0084691  .......DPANT......R.................................................VALQMIDLCLQRPKVDE
FBpp0084692  .......DPANT......R.................................................VALQMIDLCLQRPKVDE
FBpp0084694  .......DPANT......R.................................................VALQMIDLCLQRPKVDE
FBpp0112211  .......DPANT......R.................................................VALQMIDLCLQRPKVDE
FBpp0072096  ..miedsVRQAA......E.................................................YASKVSRILVKLRRYDE
FBpp0071560  .......DPHNT......Q.................................................GLHNLCVVFVERKRLAK
FBpp0071561  .......DPHNT......Q.................................................GLHNLCVVFVERKRLAK
FBpp0077790  .......DPNNA......E.................................................AIEGY------------
FBpp0076600  .......DPKNP......L.................................................TRFHRGSIYFSLGKYQE
FBpp0271716  .......ESND-......-.................................................-----------------
FBpp0077790  .......DPTNA......I.................................................LLQ--------------
FBpp0271718  .......ESND-......-.................................................-----------------
FBpp0290895  .......QPMAA......H.................................................AHANLGAILQMRGLRKE
FBpp0290896  .......QPMAA......H.................................................AHANLGAILQMRGLRKE
FBpp0081673  ..lqtksYGQVG......R.................................................LVVALILVQLTLEDYVD
FBpp0111849  .......RPGDA......H.................................................AHTNLGAILHLLGRTNH
FBpp0077614  .......QPNQV......A.................................................AHLSYGIT---------
FBpp0084692  .......IPLSV......D.................................................LWIHYLMH---------
FBpp0084694  .......IPLSV......D.................................................LWIHYLMH---------
FBpp0112211  .......IPLSV......D.................................................LWIHYLMH---------
FBpp0084691  .......IPLSV......D.................................................LWIHYLMH---------
FBpp0084693  .......IPLSV......D.................................................LWIHYLMH---------
FBpp0076382  ..kdaqhRPNMG......R.................................................AYCNLGLAHLALGHTAA
FBpp0076382  .......EPSNK......Q.................................................LMAG-------------
FBpp0080535  .......EPDNE......V.................................................YKSNLEAARN-------
FBpp0072164  .......EPKNI......E.................................................AKRSLARINDR------
FBpp0084016  .......YPKRI......D.................................................IWSVYVDMLIKAGLIDS
FBpp0076382  .......CTELSapalqaR.................................................ALSNLGSVHESLGQQAE
FBpp0076382  .......AQALG......Drsmeaaayaglghaarcagdasaskrfherqlamalaardklgegr...ACSNLGIVYQMLGSHDA
FBpp0080894  .......GDIEG......I.................................................AMYKLANLHEKLGDHET
FBpp0081606  .......RPNDK......D.................................................AKL--------------
FBpp0081607  .......RPNDK......D.................................................AKL--------------
FBpp0084559  .......AQELG......Drigear...........................................ACWSLGNAHSAIGGHER
FBpp0075683  .......AHERE......FgaidsknkpiwqvaeereehkfdnrentpygeyggwhkaakvdsptvttTLKNLGALYRRQGMFEA
FBpp0081284  .......DPGNK......T.................................................VQP--------------
FBpp0079468  .......EPGNK......A.................................................AANQVIICKQKLKE---
FBpp0087297  .......RKDNA......E.................................................CYMLLGLCLRKLDDMEN
FBpp0074835  .......DPDLG......D.................................................AWAYF------------
FBpp0079893  .......DPKCE......L.................................................AYETLGTVEVQRAQLTR
FBpp0079894  .......DPKCE......L.................................................AYETLGTVEVQRAQLTR
FBpp0079895  .......DPKCE......L.................................................AYETLGTVEVQRAQLTR
FBpp0082765  .......DPGQQ......E.................................................ARE--------------
FBpp0079617  .......SKE--......-.................................................-----------------
FBpp0084440  .......EPDNA......I.................................................AKKAVEK----------
FBpp0080423  .......-----......-.................................................-----------------
FBpp0080424  .......-----......-.................................................-----------------
FBpp0085344  .......DPSCP......K.................................................IWFALGKVMEILGDFHA
FBpp0081552  .......EPNNG......L.................................................VLEHYSRLAPAQEQ---
FBpp0087646  .......DSRCI......S.................................................YWESLGDAYAGRGSYNS
FBpp0083769  .......KPQSP......T.................................................TYTSIGFIHALLGNLDP
FBpp0070572  .......D----......-.................................................-----------------
FBpp0070573  .......D----......-.................................................-----------------
FBpp0070575  .......D----......-.................................................-----------------
FBpp0074835  .......FPDFP......K.................................................LW---------------
FBpp0080424  .......EKT--......-.................................................-----------------
FBpp0080423  .......EKT--......-.................................................-----------------
FBpp0076113  .......LPENK......Q.................................................ILNELNSTKQLLAQY--
FBpp0076114  .......LPENK......Q.................................................ILNELNSTKQLLAQY--
FBpp0076115  .......LPENK......Q.................................................ILNELNSTKQLLAQY--
FBpp0072561  .......TADFC......D.................................................VWLNIAHVYVEQKQYIS
FBpp0072562  .......TADFC......D.................................................VWLNIAHVYVEQKQYIS
FBpp0072561  .......APANFv.....L.................................................PHYGLGQMYIYRGDTEN
FBpp0072562  .......APANFv.....L.................................................PHYGLGQMYIYRGDTEN
FBpp0085923  .......FPDFA......N.................................................N----------------
FBpp0079893  .......-----......-.................................................-----------------
FBpp0079894  .......-----......-.................................................-----------------
FBpp0079895  .......-----......-.................................................-----------------
FBpp0075683  .......-----......-.................................................-----------------
FBpp0077614  .......RPGDA......H.................................................AHTNLGAILHLLGRTNH
FBpp0085409  .......ESND-......-.................................................-----------------
FBpp0271717  .......ESND-......-.................................................-----------------
FBpp0271719  .......ESND-......-.................................................-----------------
FBpp0086749  .......-----......-.................................................-----------------
FBpp0073411  .......D----......-.................................................-----------------
FBpp0070907  .......APYRF......E.................................................IYRGLFHSYLAQKRFKE
FBpp0073412  .......D----......-.................................................-----------------
FBpp0070908  .......APYRF......E.................................................IYRGLFHSYLAQKRFKE
FBpp0085842  .......EPENR......A.................................................VQSDLARLFIKARR---
FBpp0077718  .......DAQNG......A.................................................ALNNLAVLAAQSGDILG
FBpp0076600  .......NPFMW......H.................................................AFADL------------
FBpp0076382  .......AQEQR......Daaveaq...........................................AHGNLGIARLNMAHYEA
FBpp0071712  .......RPELA......L.................................................FR---------------
FBpp0086749  .......-----......-.................................................-----------------
FBpp0085479  .......DVDNE......V.................................................A----------------
FBpp0112016  .......RPELA......L.................................................FR---------------
FBpp0292906  .......DKDHK......A.................................................AWTNLGILYESCGQLRD
FBpp0079665  .......DKDHK......A.................................................AWTNLGILYESCGQLRD
FBpp0079666  .......DKDHK......A.................................................AWTNLGILYESCGQLRD
FBpp0079664  .......DKDHK......A.................................................AWTNLGILYESCGQLRD
FBpp0084076  .......NPKQL......A.................................................-----------------
FBpp0111406  .......-----......-.................................................-----------------
FBpp0074918  .......NYSNW......K.................................................VWENYMLVSVDTSHWDD
FBpp0082818  .......NPHNL......R.................................................ALYGIYLCCNHL-----
FBpp0074480  .......TPTLI......E.................................................LLITKGRIFKHAGDPVE
FBpp0111849  .......APEQA......S.................................................VYHHYAEFLSLQSRHH-
FBpp0082819  .......NPHSH......L.................................................IHQRLAEIRYTMGGVE-
FBpp0292061  .......LPLHE......E.................................................ARQSL------------
FBpp0085279  .......NMSDI......G.................................................IASSIGSYYIKLQATER
FBpp0081805  .......LPLHE......E.................................................ARQSL------------
FBpp0100021  .......NPNHT......Y.................................................ML---------------
FBpp0100023  .......NPNHT......Y.................................................ML---------------
FBpp0074877  .......NPNHT......Y.................................................ML---------------
FBpp0071879  .......GNKCI......P.................................................AIINSAHIALVSGQYRL
FBpp0084559  .......-----......-.................................................-----------------
FBpp0075591  .......GSKF-......-.................................................-----------------
FBpp0076526  .......SKTHE......Lwdlthl...........................................CYISMSLLYI-------
FBpp0079851  .......DIFIP......D.................................................VWGYLATINLRLSRNKT
FBpp0290395  .......NMSDI......G.................................................IASSIGSYYIKLQATER
FBpp0072146  .......QPANK......E.................................................ISDEIISMNKRISKYEE
FBpp0076382  .......-----......-.................................................-----------------
FBpp0083238  .......NPGNE......E.................................................LLAHLFISHVRVEDYK-
FBpp0111383  .......-----......-.................................................-----------------
FBpp0080424  .......DPDHY......K.................................................SK---------------
FBpp0071560  .......FPQ--......-.................................................-----------------
FBpp0071561  .......FPQ--......-.................................................-----------------
FBpp0080423  .......DPDHY......K.................................................SK---------------
FBpp0071879  .......NNKNP......Dllsilagmyyadgnhklvwsfagnaikftankhiesr............NYFQIAKSYHATGQFES
FBpp0077738  .......-----......Icsekgvpvteelsemltpekgefeeatrvh...................ILVQLGEFLQQQGDYHS
FBpp0077934  .......-----......-.................................................-----------------
FBpp0292775  .......-----......Icsekgvpvteelsemltpekgefeeatrvh...................ILVQLGEFLQQQGDYHS
FBpp0087646  .......SPVYA......N.................................................AWIGQAMVAELIGDREE
FBpp0292906  .......YPSTFsel...Q.................................................VKFQIAHLYEVQNKHKA
FBpp0079664  .......YPSTFsel...Q.................................................VKFQIAHLYEVQNKHKA
FBpp0086749  .......FPEDT......E.................................................EYV---DYLQEADRLDE
FBpp0082652  .......-----......-.................................................-----------------
FBpp0077619  .......DTHVP......N.................................................VWGFLALINLRLGENYK
FBpp0086164  ......gQPLIA......R.................................................LLYERCVMLQQIGRIEE
FBpp0087232  .......MDDST......L.................................................ASDK-------------
FBpp0072561  .......-----......-.................................................-----------------
FBpp0072562  .......-----......-.................................................-----------------
FBpp0088148  ...taigDPSLEl.....Q.................................................VYVALSELFGRLQDND-
FBpp0088149  ...taigDPSLEl.....Q.................................................VYVALSELFGRLQDND-
FBpp0075786  .......-----......-.................................................-----------------
FBpp0075788  .......-----......-.................................................-----------------
FBpp0075787  .......-----......-.................................................-----------------
FBpp0075789  .......-----......-.................................................-----------------
FBpp0075785  .......-----......-.................................................-----------------
FBpp0083319  .......TSDEY......Eeerrtnlsavaanlavdqtkevpevpedtye..................QYFNSACIQANRQKYAE
FBpp0076498  .......DK---......-.................................................-----------------
FBpp0290580  .......GGFNP......L.................................................VAYNVALAHFQKKQ---
FBpp0290395  .......RAN-I......R.................................................SSIHLLLCYFALGDVEK
FBpp0080720  ......kQHQ--......-.................................................-----------------
FBpp0086164  .......LPKVY......Q.................................................LRLRKAQLLQKMGETNA
FBpp0080741  .......YVDFN......D.................................................LHSRKMANY--------
FBpp0087297  .......-----......-.................................................-----------------
FBpp0070720  .......-----......-.................................................-----------------
FBpp0089396  .......-----......-.................................................-----------------
FBpp0111789  .......-----......-.................................................-----------------
FBpp0086683  .......RPRDQ......-.................................................-----------------
FBpp0289328  .......-----......-.................................................-----------------
FBpp0070667  .......DPS--......-.................................................-----------------
FBpp0082624  .......QPTSP......H.................................................EYILKGVVHAALGQ---
FBpp0081552  .......EESNT......R.................................................AKEGIQRAKKLQ-----
FBpp0086749  .......-----......-.................................................-----------------
FBpp0087646  .......-----......-.................................................-----------------
FBpp0071879  ...lsqgHQIPI......E.................................................WLNNLASSQLMAKMPEK
FBpp0080894  .......NPKYL......A.................................................AWTLMGHEFM-------
FBpp0112213  .......-----......-.................................................-----------------
FBpp0087233  .......MDDST......L.................................................ASD--------------
FBpp0070906  lrlfgnsYSGLE......Y.................................................DYLGLCHVYETLHNFE-
FBpp0087646  .......QPAYK......V.................................................TLELLARIHMELGAYKL
FBpp0082112  .......-----......-.................................................-----------------
FBpp0086359  .....eeGTQEA......F.................................................FYLSLGETMQRLSMKSE
FBpp0076526  .......-----......-.................................................-----------------
FBpp0085279  .......QPMNF......E.................................................ARYNLGLVALAQNDYEL
FBpp0074835  .......-----......-.................................................-------------NI--
FBpp0078887  .......SPSNS......E.................................................ALANR------------
FBpp0290580  .......-----......-.................................................-----------------
FBpp0085047  .......SPHDP......E.................................................IYE--------------
FBpp0086380  .......-----......-.................................................-----------------
FBpp0083435  .......-----......-.................................................-----------------
FBpp0078891  .......KHNDY......D.................................................TLINLMVHAHLTGKPTE
FBpp0082419  .......EPDNA......T.................................................AKEFY------------
FBpp0082420  .......EPDNA......T.................................................AKEFY------------
FBpp0086749  .......LPGSY......K.................................................IWHNY------------
FBpp0078027  .......-----......-.................................................-----------------
FBpp0088148  .......S----......-.................................................-----------------
FBpp0088149  .......S----......-.................................................-----------------
FBpp0290863  .......-----......-.................................................-----------------
FBpp0080720  .......-----......-.................................................-----------------
FBpp0083319  .......NPND-......-.................................................-----------------
FBpp0071288  .......--E--......-.................................................-----------------
FBpp0081398  .......HGELP......Trnrralae.........................................LHYKIGLTYLMQQLNKE
FBpp0085015  .......-----......-.................................................-----------------
FBpp0084188  .......-----......-.................................................-----------------
FBpp0290580  .......HSDDI......Msvsaa............................................VLANLCVSYIMTFQNEE
FBpp0085012  .......LPHHE......R.................................................ANGN-------------
FBpp0086380  .......-----......-.................................................-----------------
FBpp0076382  .......F----......-.................................................-----------------
FBpp0071879  .......-----......-.................................................-----------------
FBpp0076961  .......QAWDA......N.................................................VSMELGDALYDLNRFEE
FBpp0075717  .......-----......-.................................................-----------------
FBpp0080267  .......-----......-.................................................-----------------
FBpp0070907  .......NPDNV......E.................................................AIGLMAVLC--------
FBpp0085033  .......-----......-.................................................-----------------
FBpp0082507  .......SQNNV......Y.................................................WHCKLLLQLA-------
FBpp0077738  .......DLLNK......Llqsighldeavelaeaedrihlkh.........................TYYQKAQELRERGDIKG
FBpp0292775  .......DLLNK......Llqsighldeavelaeaedrihlkh.........................TYYQKAQELRERGDIKG
FBpp0085676  .......-----......-.................................................-----------------
FBpp0087091  .......-----......-.................................................-----------------
FBpp0082624  .......-----......-.................................................-------------HPEL
FBpp0070908  .......NPDNV......E.................................................AIGLMAVLC--------
FBpp0070431  .......-----......-.................................................-----------------
FBpp0075442  .......-----......-.................................................-----------------
FBpp0089265  .......-----......-.................................................-----------------
FBpp0075443  .......-----......-.................................................-----------------
FBpp0070906  .......-----......-.................................................-----------------
FBpp0073018  .......-----......-.................................................-----------------
FBpp0078634  .......-----......-.................................................-----------------
FBpp0087626  .......-----......-.................................................-----------------
FBpp0075754  .......-----......-.................................................-----------------
FBpp0087625  .......-----......-.................................................-----------------
FBpp0071288  .......-----......-.................................................-----------------
FBpp0085046  .......SPHDL......E.................................................IF---------------
FBpp0110159  .......SPHDL......E.................................................IF---------------
FBpp0072679  .......LPEKS......P.................................................LLPKLAEMLASVGMCSE
FBpp0082624  .......-----......-.................................................-----------------
FBpp0084254  .......-----......-.................................................-----------------
FBpp0085032  .......-----......-.................................................-----------------


               40                                                                                   
                |                                                                                   
d1zu2a1        AYK----qglg..........................................................................
FBpp0112456  -------ntrvlfervlssgglsphksvevwnrflefesnigdlssivkverrrsavfenlkeyegketaqlvdrykfldlypct
FBpp0112455  -------ntrvlfervlssgglsphksvevwnrflefesnigdlssivkverrrsavfenlkeyegketaqlvdrykfldlypct
FBpp0070352  AVEH---lltaltmqahtnaarelpnaamaatfrgqnqmsesiwstlkmvislmgrsdlqsyvsdrnlaalneafk.........
FBpp0070351  AVEH---lltaltmqahtnaarelpnaamaatfrgqnqmsesiwstlkmvislmgrsdlqsyvsdrnlaalneafk.........
FBpp0070402  AREIYERfvyvhpdvknwikfarfeeshgfihgsrrvferaveffgddyieerlfiafarfeegqkehdrariiykyaldhlpkd
FBpp0080138  -------ldstyhylyslvciipfelsennlnklfakhteylermdpekldfniedffarfylivdifffdkevpdfnalchcvl
FBpp0080139  -------ldstyhylyslvciipfelsennlnklfakhteylermdpekldfniedffarfylivdifffdkevpdfnalchcvl
FBpp0074609  -------aasslessllkysakeyffraalchlsvdllnaqhaiekyaqqypafqdsrefklikvlcenleeqniegfteavkdy
FBpp0084171  AVYYY--vrslltsnsiqsakeslldlfdeirrkyeetemkqspmhyaagsknqkskqmrkevwiypdgirrlhrtddkgnkakg
FBpp0085420  AIQSY--rtalklkpdfpdaycnlahclqivcdwtdydirmkklvsi......................................
FBpp0085421  AIQSY--rtalklkpdfpdaycnlahclqivcdwtdydirmkklvsi......................................
FBpp0085422  AIQSY--rtalklkpdfpdaycnlahclqivcdwtdydirmkklvsi......................................
FBpp0085420  AIDTYRRaielqpn.......................................................................
FBpp0085421  AIDTYRRaielqpn.......................................................................
FBpp0085422  AIDTYRRaielqpn.......................................................................
FBpp0077790  -------hrtpeiktslseveakike...........................................................
FBpp0082545  AIEAYR-taisisaarattarenlskllkrlereaqvm...............................................
FBpp0084693  -------qevveimdkfmaradiepdqkvlfaqrkvefledfgstarglqdaqralqqaltkakeaqkks...............
FBpp0084691  -------qevveimdkfmaradiepdqkvlfaqrkvefledfgstarglqdaqralqqaltkakeaqkks...............
FBpp0084692  -------qevveimdkfmaradiepdqkvlfaqrkvefledfgstarglqdaqralqqaltkakeaqkks...............
FBpp0084694  -------qevveimdkfmaradiepdqkvlfaqrkvefledfgstarglqdaqralqqaltkakeaqkks...............
FBpp0112211  -------qevveimdkfmaradiepdqkvlfaqrkvefledfgstarglqdaqralqqaltkakeaqkks...............
FBpp0072096  ATNALKKeislnqqtesygqigrlvvalvmvqlargdsveaektfrewgnccepeevstlqtllqafddedpela..........
FBpp0071560  AAACL--qyaqrlapaedyigrhlqivlarlqki...................................................
FBpp0071561  AAACL--qyaqrlapaedyigrhlqivlarlqki...................................................
FBpp0077790  -------rqcs..........................................................................
FBpp0076600  ALREL--eelkevvpkesvvfyligkihktlgnmdlalmhfswatdldpkg..................................
FBpp0271716  -------qvrsleeyikkeidkevakgmvvaggaalvlggilglgiamarnkq................................
FBpp0077790  -------grmet.........................................................................
FBpp0271718  -------qvrsleeyikkeidkevakgmvvaggaalvlggilglgiamar...................................
FBpp0290895  AVACYHKalelqpghaisranlarm............................................................
FBpp0290896  AVACYHKalelqpghaisranlarm............................................................
FBpp0081673  AKKTFKKwgnrcdpqevntlqnllkafddedpelatkm...............................................
FBpp0111849  AAASY--kaalrlqpgda...................................................................
FBpp0077614  -------la............................................................................
FBpp0084692  -------vksnhgddetfvrsqyeravkacglefrsdklwdayirweneskryhrvvqiydrllaiptqgynghfdnfqdlinqh
FBpp0084694  -------vksnhgddetfvrsqyeravkacglefrsdklwdayirweneskryhrvvqiydrllaiptqgynghfdnfqdlinqh
FBpp0112211  -------vksnhgddetfvrsqyeravkacglefrsdklwdayirweneskryhrvvqiydrllaiptqgynghfdnfqdlinqh
FBpp0084691  -------vksnhgddetfvrsqyeravkacglefrsdklwdayirweneskryhrvvqiydrllaiptqgynghfdnfqdlinqh
FBpp0084693  -------vksnhgddetfvrsqyeravkacglefrsdklwdayirweneskryhrvvqiydrllaiptqgynghfdnfqdlinqh
FBpp0076382  ALECQ--qlfla.........................................................................
FBpp0076382  -------lvea..........................................................................
FBpp0080535  -------arnqpp........................................................................
FBpp0072164  -------lrki..........................................................................
FBpp0084016  ARNVLERavvqklkpnkmqviykkylqleenhgtdatvakvkqqaeqwvknyak...............................
FBpp0076382  ALKCYERqlelst........................................................................
FBpp0076382  ALKL---hqahlgiarsl...................................................................
FBpp0080894  AVHCY--imy...........................................................................
FBpp0081606  -------kftecn........................................................................
FBpp0081607  -------kftecn........................................................................
FBpp0084559  ALKYAE-qhlqlakelhdpvgestar...........................................................
FBpp0075683  A------..............................................................................
FBpp0081284  -------mlqrlhv.......................................................................
FBpp0079468  -------sknkekklyanmftk...............................................................
FBpp0087297  AFVALERa.............................................................................
FBpp0074835  -------ykfellhgteaqqqevldrcisaepthgeswcrv............................................
FBpp0079893  AVELFEKal............................................................................
FBpp0079894  AVELFEKal............................................................................
FBpp0079895  AVELFEKal............................................................................
FBpp0082765  -------aqirlppiinerneklk.............................................................
FBpp0079617  -------qk............................................................................
FBpp0084440  -------ltsmlgeva.....................................................................
FBpp0080423  -------iigteqavkmvn..................................................................
FBpp0080424  -------iigteqavkmvn..................................................................
FBpp0085344  SADCF--atslqlepscpvl.................................................................
FBpp0081552  -------wvlvqqliqysdhqnaipmitqlleispwavpfrqarsdayiaindpllaiadlrqvnrltqdsteghykiaqllyti
FBpp0087646  AIRVFQKilelspennyallqiasvkttirmytesiedydtllqrnptylp..................................
FBpp0083769  AIEAFHKslalnrdci.....................................................................
FBpp0070572  -------fd............................................................................
FBpp0070573  -------fd............................................................................
FBpp0070575  -------fd............................................................................
FBpp0074835  -------m.............................................................................
FBpp0080424  -------peikrmlreakfalkks.............................................................
FBpp0080423  -------peikrmlreakfalkks.............................................................
FBpp0076113  -------nrqq..........................................................................
FBpp0076114  -------nrqq..........................................................................
FBpp0076115  -------nrqq..........................................................................
FBpp0072561  AIQMYE-ncmkkfykhnnvevmqylaraylranklvdakavllkarrvapqdtvllfniavvlsr....................
FBpp0072562  AIQMYE-ncmkkfykhnnvevmqylaraylranklvdakavllkarrvapqdtvllfniavvlsr....................
FBpp0072561  AAQCFEKvlkiqpgnyetmkilgsly...........................................................
FBpp0072562  AAQCFEKvlkiqpgnyetmkilgsly...........................................................
FBpp0085923  -------hg............................................................................
FBpp0079893  -------ddv...........................................................................
FBpp0079894  -------ddv...........................................................................
FBpp0079895  -------ddv...........................................................................
FBpp0075683  -------re............................................................................
FBpp0077614  AAASYK-aalrlqpgdaitlgnlak............................................................
FBpp0085409  -------qvrsleeyikkeidkevakgmvvaggaalvlggilglgiamarnkq................................
FBpp0271717  -------qvrsleeyikkeidkevakgmvvaggaalvlggilglgiamar...................................
FBpp0271719  -------qvrsleeyikkeidkevakgmvvaggaalvlggilglgiamar...................................
FBpp0086749  -------lyakleeehglarhamsvydratsavkedemfdmynifikk.....................................
FBpp0073411  -------as............................................................................
FBpp0070907  ANAL---cnwtirlfqnsprsftmfgrtlflfpdprmrrtarkfaekslkinhiytpavnliadicqvegptkaiikllekhvii
FBpp0073412  -------as............................................................................
FBpp0070908  ANAL---cnwtirlfqnsprsftmfgrtlflfpdprmrrtarkfaekslkinhiytpavnliadicqvegptkaiikllekhvii
FBpp0085842  -------eehnekemyqkm..................................................................
FBpp0077718  AKSYL--naakdvmpdaaevttnl.............................................................
FBpp0076600  -------cllgqdtdaaaifqihstdvfntcqgssvnanamvlfgaeqqgqqhqerqslitnlsnvsnyilttpvdqqqqqinqn
FBpp0076382  AIGCLE-aqlgtlervsl...................................................................
FBpp0071712  -------lgvqktqea.....................................................................
FBpp0086749  -------mpkrkiayyddtetvqarlhrslkvw....................................................
FBpp0085479  -------ia............................................................................
FBpp0112016  -------lgvqktqea.....................................................................
FBpp0292906  AYACY--lna...........................................................................
FBpp0079665  AYACY--lna...........................................................................
FBpp0079666  AYACY--lna...........................................................................
FBpp0079664  AYACY--lna...........................................................................
FBpp0084076  -------yidky.........................................................................
FBpp0111406  -------arkfnskq......................................................................
FBpp0074918  AMRAYQRmaelkqhyldq...................................................................
FBpp0082818  -------dn............................................................................
FBpp0074480  AYVW---leeaqsmdtadryi................................................................
FBpp0111849  -------e.............................................................................
FBpp0082819  -------nmesartyysqalklnphnlraly......................................................
FBpp0292061  -------dal...........................................................................
FBpp0085279  ALFYYERavladpndpnlmlriascfrn.........................................................
FBpp0081805  -------dal...........................................................................
FBpp0100021  -------tqlpk.........................................................................
FBpp0100023  -------tqlpk.........................................................................
FBpp0074877  -------tqlp..........................................................................
FBpp0071879  AIQTYERclk...........................................................................
FBpp0084559  -------k.............................................................................
FBpp0075591  -------ar............................................................................
FBpp0076526  -------ckkndataalrfcnmalevakrfpnkvkk.................................................
FBpp0079851  ALECWK-va............................................................................
FBpp0290395  ALFYYERavladpndpnlmlriascfrn.........................................................
FBpp0072146  AS-----rdi...........................................................................
FBpp0076382  -------lesvrheqrspetrqalydlqttcyqllqvllvalnrnedal....................................
FBpp0083238  -------aqqavalqlykaqpknayyf..........................................................
FBpp0111383  -------depnfeysvdrarrfnrsdadf........................................................
FBpp0080424  -------qmrskckql.....................................................................
FBpp0071560  -------a.............................................................................
FBpp0071561  -------a.............................................................................
FBpp0080423  -------qmrskckql.....................................................................
FBpp0071879  AKKYY--llsaksap......................................................................
FBpp0077738  ATKK---ftqa..........................................................................
FBpp0077934  -------y.............................................................................
FBpp0292775  ATKK---ftqa..........................................................................
FBpp0087646  AFDLFR-hcqqfdyh......................................................................
FBpp0292906  AK-----dg............................................................................
FBpp0079664  AK-----dg............................................................................
FBpp0086749  AAQQ---lahiv.........................................................................
FBpp0082652  -------iaianarllnr...................................................................
FBpp0077619  AIECW--..............................................................................
FBpp0086164  -------..............................................................................
FBpp0087232  -------raklnldamtmikmlqndprtakqeakqqkqkialdqakpvklenefvsplvridsnrqegrfarasadvkpgeellv
FBpp0072561  -------hatsemd.......................................................................
FBpp0072562  -------hatsemd.......................................................................
FBpp0088148  -------ksatyaskaydlsrslql............................................................
FBpp0088149  -------ksatyaskaydlsrslql............................................................
FBpp0075786  -------q.............................................................................
FBpp0075788  -------q.............................................................................
FBpp0075787  -------q.............................................................................
FBpp0075789  -------q.............................................................................
FBpp0075785  -------q.............................................................................
FBpp0083319  A------erklrtsek.....................................................................
FBpp0076498  -------kt............................................................................
FBpp0290580  -------r.............................................................................
FBpp0290395  VKLAF--rrlcdvqteaiesdmesetniiklqqqaepiqqigetdgyqslnnepvtgsvikaegggklnetvkfaatvkhryvvq
FBpp0080720  -------npdaveqaeycl..................................................................
FBpp0086164  SMFT---ylkmlplmppdewkmclntaknvaryfhvlekhslaleamegaysvcgarftlediniylellilnkqyakvlrclre
FBpp0080741  -------lqaklm........................................................................
FBpp0087297  -------s.............................................................................
FBpp0070720  -------nrgvrshpsvqlnhrfldlmersdfelaevdeeirlilqrivtdmdmtvelhldylayrirntnasdeqqvaslraaf
FBpp0089396  -------nrgvrshpsvqlnhrfldlmersdfelaevdeeirlilqrivtdmdmtvelhldylayrirntnasdeqqvaslraaf
FBpp0111789  -------nrgvrshpsvqlnhrfldlmersdfelaevdeeirlilqrivtdmdmtvelhldylayrirntnasdeqqvaslraaf
FBpp0086683  -------gikdkitriskriteledtn..........................................................
FBpp0289328  -------fiqilgdpsehlhrqyikslfkygsttsepsksieeafimvqasqeeldnimsdlnepqndvevekdlyqvkrspsnc
FBpp0070667  -------tl............................................................................
FBpp0082624  -------qlgskehiktaqq.................................................................
FBpp0081552  -------kqse..........................................................................
FBpp0086749  -------csqvcdpritadfwqtwkefevrhgnedtmremlr...........................................
FBpp0087646  -------vlgnvvdhgddkaatilvamasmiydfqgea...............................................
FBpp0071879  ALNTL--ddalskcrv.....................................................................
FBpp0080894  -------el............................................................................
FBpp0112213  -------ikancy........................................................................
FBpp0087233  -------kraklnldamtmikmlqndprtakqeakqqkqkialdqakpvklenefvsplvridsnrqegrfarasadvkpgeell
FBpp0070906  -------k.............................................................................
FBpp0087646  ALQLWQ-eigqendayalclshekgvsklreavtilqtlensegnikslarcyfklge...........................
FBpp0082112  -------eh............................................................................
FBpp0086359  ALEVYG-kgvakg........................................................................
FBpp0076526  -------dkag..........................................................................
FBpp0085279  AEER---f.............................................................................
FBpp0074835  -------hmvekiidrsltsltvng............................................................
FBpp0078887  -------qrtad.........................................................................
FBpp0290580  -------..............................................................................
FBpp0085047  -------eyrilekrdltlsdiepieqdk........................................................
FBpp0086380  -------ekety.........................................................................
FBpp0083435  -------erm...........................................................................
FBpp0078891  AIT----rn............................................................................
FBpp0082419  -------plildkl.......................................................................
FBpp0082420  -------plildkl.......................................................................
FBpp0086749  -------lrtrrk........................................................................
FBpp0078027  -------lhdntrlftgnktkmfeqrlvvvdeniedacgpsmtqyisdkeklivhlkevqnkykpdtrplwkilkeqekcdvlsi
FBpp0088148  -------aslgdrmaqmeamdgaarcletlrlqnkicncrplefntrllevassigakflvrkircrlaliyralgdedq.....
FBpp0088149  -------aslgdrmaqmeamdgaarcletlrlqnkicncrplefntrllevassigakflvrkircrlaliyralgdedq.....
FBpp0290863  -------edl...........................................................................
FBpp0080720  -------..............................................................................
FBpp0083319  -------tkv...........................................................................
FBpp0071288  -------fgelrsdylrylwqersveearkeyaklailppmslalhrqmvqlessaaacdqaslkywrmcydfmacyfgktqprv
FBpp0081398  GAT----alrq..........................................................................
FBpp0085015  -------aqqtqk........................................................................
FBpp0084188  -------nn............................................................................
FBpp0290580  AEELMR-kv............................................................................
FBpp0085012  -------krfyekeiaq....................................................................
FBpp0086380  -------imservngmdhpstileythlslysfanghvgmslkllyra.....................................
FBpp0076382  -------kq............................................................................
FBpp0071879  -------eteqalal......................................................................
FBpp0076961  -------nksllhdnvrrhagtalksfenrlvvvdenlkdctgfslanffmehsaqlpgfyahqqeelrradrrplwkilkerke
FBpp0075717  -------ekm...........................................................................
FBpp0080267  -------hielnq........................................................................
FBpp0070907  -------gqeg..........................................................................
FBpp0085033  -------rlwkkt........................................................................
FBpp0082507  -------qihasdreyslasellavgaesadeasatylkvlfllsramilmierktndvlallnsagqiidnn............
FBpp0077738  ALEYFEKtqn...........................................................................
FBpp0292775  ALEYFEKtqn...........................................................................
FBpp0085676  -------arskdgeekaiinldicdvlyelnqfenskaemhn...........................................
FBpp0087091  -------an............................................................................
FBpp0082624  A------wnv...........................................................................
FBpp0070908  -------gqeg..........................................................................
FBpp0070431  -------ltvthgrdhrllteqlymlvlqar......................................................
FBpp0075442  -------ne............................................................................
FBpp0089265  -------gdkrslnlantwycl...............................................................
FBpp0075443  -------ne............................................................................
FBpp0070906  -------qhlvp.........................................................................
FBpp0073018  -------gdkrslnlantwycl...............................................................
FBpp0078634  -------aaatlima......................................................................
FBpp0087626  -------cgyperlrhkvimrqafcawklkkia....................................................
FBpp0075754  -------lyiqrtkqlystrsyqndqinkqae.....................................................
FBpp0087625  -------cgyperlrhkvimrqafcawklkkia....................................................
FBpp0071288  -------nkcffdimlkeaalasnernlaentlseqdiklerveavyrnsmanitq.............................
FBpp0085046  -------qeyqnl........................................................................
FBpp0110159  -------qeyqnl........................................................................
FBpp0072679  AVQ----ahlrfgdqkaavatcvnlrqw.........................................................
FBpp0082624  -------adnplkqrllfhlahklgneee........................................................
FBpp0084254  -------vatk..........................................................................
FBpp0085032  -------kks...........................................................................


                                                                                                    
                                                                                                    
d1zu2a1        .....................................................................................
FBpp0112456  stelksigyae..........................................................................
FBpp0112455  stelksigyae..........................................................................
FBpp0070352  .....................................................................................
FBpp0070351  .....................................................................................
FBpp0070402  rtqelfkaytkhekkygdragiedvivskrkyqyeqevaanptnydawfdylrlieaegdrdqiretyeraisnvppaneknfwr
FBpp0080138  idlrkilcsqqlrvpepsifkivsilffclsklkminspkvyslhaflvaacsdlmdacivsieqtilaraqdnerfqaeyeerf
FBpp0080139  idlrkilcsqqlrvpepsifkivsilffclsklkminspkvyslhaflvaacsdlmdacivsieqtilaraqdnerfqaeyeerf
FBpp0074609  dsisrldqwyttillrikkaaded.............................................................
FBpp0084171  nkatmaevnryeemppeeilprivslylyllgklytgtdvdslypllrklqiqigvalrhenllsrskllkivalnlfvvehnkp
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0271718  .....................................................................................
FBpp0290895  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0111849  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084692  dvtitlaneevirlrkdfherqq..............................................................
FBpp0084694  dvtitlaneevirlrkdfherqq..............................................................
FBpp0112211  dvtitlaneevirlrkdfherqq..............................................................
FBpp0084691  dvtitlaneevirlrkdfherqq..............................................................
FBpp0084693  dvtitlaneevirlrkdfherqq..............................................................
FBpp0076382  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0081607  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0085344  .....................................................................................
FBpp0081552  ghatnalkeireclkfdpeh.................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070573  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0076114  .....................................................................................
FBpp0076115  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0085409  .....................................................................................
FBpp0271717  .....................................................................................
FBpp0271719  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070907  fpkvnllnhlgdimrkqkepvkameyyykalrqdpks................................................
FBpp0073412  .....................................................................................
FBpp0070908  fpkvnllnhlgdimrkqkepvkameyyykalrqdpks................................................
FBpp0085842  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0076600  qnqhhnsnmvtpinnnnnnnnlnssismlrgglvqnssmlamledtpmgapqdpagqyqqnqqlydmssgtpfrkqfkylsaisp
FBpp0076382  .....................................................................................
FBpp0071712  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0079666  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  .....................................................................................
FBpp0111849  .....................................................................................
FBpp0082819  .....................................................................................
FBpp0292061  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0081805  .....................................................................................
FBpp0100021  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0074877  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0087232  erpfvsvllekfakthcencfmrtvvpvacprcadvlycseqcreeaskkyhkyecgivpiiwrsgasinnhialriiaskpldy
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0075786  .....................................................................................
FBpp0075788  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0075789  .....................................................................................
FBpp0075785  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076498  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0290395  alkkdelavyrnerrnavkrsitmivdlispfiednyndgynwcieiiktsnlawlanelelnkalvylrqndvhqaietlq...
FBpp0080720  .....................................................................................
FBpp0086164  rtnfelendqeesleliyfceipddyvpelraklcvslihmrahhllgyliqnvqehitltadrvelymditealmqehkyaeai
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  nhaweeltvlygdqadtryevlqlwaqveytqlgspdngreiwrqimgypgssirgllwlnfaqmeseyngghgtrdvlrkalsq
FBpp0089396  nhaweeltvlygdqadtryevlqlwaqveytqlgspdngreiwrqimgypgssirgllwlnfaqmeseyngghgtrdvlrkalsq
FBpp0111789  nhaweeltvlygdqadtryevlqlwaqveytqlgspdngreiwrqimgypgssirgllwlnfaqmeseyngghgtrdvlrkalsq
FBpp0086683  .....................................................................................
FBpp0289328  elgcrglyrqktnlvcrykstantflrlaplkleeisldpfmamyhevlydseirelkgqsmnmvngyasqrngteirdtvvryd
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0112213  .....................................................................................
FBpp0087233  verpfvsvllekfakthcencfmrtvvpvacprcadvlycseqcreeaskkyhkyecgivpiiwrsgasinnhialriiaskpld
FBpp0070906  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0082112  .....................................................................................
FBpp0086359  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085047  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0082420  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  peieeemlspleiarrsrafdvfnqmfidrswhdviflkhvrknpnlllnqcknsteylqtlstkkydeiksflkilearspmyn
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0071288  wveylaferdhgeaknislltqralstlepqyvaaf.................................................
FBpp0081398  .....................................................................................
FBpp0085015  .....................................................................................
FBpp0084188  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  cdvqsridrkevmlsplererrrrktkifyqnylgrswtdffflktlrrhpnclldnhfgssadrtkyleyafqrlktftrmlqa
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075442  .....................................................................................
FBpp0089265  .....................................................................................
FBpp0075443  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0073018  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0087626  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0085046  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................


                                                                                                    
                                                                                                    
d1zu2a1        .....................................................................................
FBpp0112456  .....................................................................................
FBpp0112455  .....................................................................................
FBpp0070352  .....................................................................................
FBpp0070351  .....................................................................................
FBpp0070402  ryiylwinyalyeeleaedaertrqiyktcleliphkqftfsklwllyaqfeirckelqrarkalglaigmcprdklfrgyidle
FBpp0080138  qefdtvvrksrneyknwlaavgecerkdkklmprphslkdcssdsrdsqhsgeeaktqeaadgdkigeavstrssdeakesdlkt
FBpp0080139  qefdtvvrksrneyknwlaavgecerkdkklmprphslkdcssdsrdsqhsgeeaktqeaadgdkigeavstrssdeakesdlkt
FBpp0074609  .....................................................................................
FBpp0084171  ktsrremryhsfnfansffglmmkktnqllagfvedstnvqclpeedfatvntylqfvnvyvrwlsisldvwepvrseehsfidc
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0271718  .....................................................................................
FBpp0290895  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0111849  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0081607  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0085344  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070573  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0076114  .....................................................................................
FBpp0076115  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0085409  .....................................................................................
FBpp0271717  .....................................................................................
FBpp0271719  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0073412  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0076600  ptpsfgimpltspctgndgsfignhtpvmnisyspmpqmlvevnqepkmmgkklkthvgglinrkegslnkpavftqagnitprt
FBpp0076382  .....................................................................................
FBpp0071712  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0079666  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  .....................................................................................
FBpp0111849  .....................................................................................
FBpp0082819  .....................................................................................
FBpp0292061  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0081805  .....................................................................................
FBpp0100021  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0074877  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0087232  flklkptideeltpeqlislpkddfrrvaqlerhqgerqpsnffqhvlmarfltnclraggyfgsepkpdevsiicslvlrslqf
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0075786  .....................................................................................
FBpp0075788  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0075789  .....................................................................................
FBpp0075785  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076498  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  al...................................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  pvlenglmvqeffrryercygtyesiaacq.......................................................
FBpp0089396  pvlenglmvqeffrryercygtyesiaacq.......................................................
FBpp0111789  pvlenglmvqeffrryercygtyesiaacq.......................................................
FBpp0086683  .....................................................................................
FBpp0289328  wwsntslvrerinqriidmtgfnflkdeklqianyglgtyfqphfdyssdgfetpnittlgdrlasilfyasevpqggatvfpei
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0112213  .....................................................................................
FBpp0087233  yflklkptideeltpeqlislpkddfrrvaqlerhqgerqpsnffqhvlmarfltnclraggyfgsepkpdevsiicslvlrslq
FBpp0070906  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0082112  .....................................................................................
FBpp0086359  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085047  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0082420  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  iryqkftnkklmdkfrqeylfrvqyqtrrnmisalrsirylrktksltkltsyveevmgdyvvkktnrimpwkfefinevynila
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0081398  .....................................................................................
FBpp0085015  .....................................................................................
FBpp0084188  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  rrpmykeyfhrnpqiearmrdanlfriqyqtrrnmvsilrtikvlrgrndikrlrkfveevmgsyvviktnrlmpwkaefmnevy
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075442  .....................................................................................
FBpp0089265  .....................................................................................
FBpp0075443  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0073018  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0087626  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0085046  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................


                                                                                                    
                                                                                                    
d1zu2a1        .....................................................................................
FBpp0112456  .....................................................................................
FBpp0112455  .....................................................................................
FBpp0070352  .....................................................................................
FBpp0070351  .....................................................................................
FBpp0070402  iqlrefercrmlyekflefgpencvtwmkfaelenllgdtdraraifelavqqprldm...........................
FBpp0080138  plsckskrrgmrlrrrrrkiaqsddsscydseseldtdfysdeedytdlssnfdtdfsdidaadpgepcgeeryaaanyskkerk
FBpp0080139  plsckskrrgmrlrrrrrkiaqsddsscydseseldtdfysdeedytdlssnfdtdfsdidaadpgepcgeeryaaanyskkerk
FBpp0074609  .....................................................................................
FBpp0084171  waeltilfeyieclmgkhklekneilldedvalrgftplgretlsmdylkrgserlqffervrrigqfqeyyvqhqealqqples
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0271718  .....................................................................................
FBpp0290895  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0111849  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0081607  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0085344  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070573  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0076114  .....................................................................................
FBpp0076115  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0085409  .....................................................................................
FBpp0271717  .....................................................................................
FBpp0271719  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0073412  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0076600  pnnnnvgnngnmnvppnpnaavrrssrlfsnsysvkennkspniankfvqprspprkaksrmtkiclnneliedkshhlsekrke
FBpp0076382  .....................................................................................
FBpp0071712  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0079666  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  .....................................................................................
FBpp0111849  .....................................................................................
FBpp0082819  .....................................................................................
FBpp0292061  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0081805  .....................................................................................
FBpp0100021  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0074877  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0087232  iqfnthevaelhkfsssgreksifiggaiyptlalfnhscdpgvvryfrgttihinsvrpieaglpinenygpmytqderserqa
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0075786  .....................................................................................
FBpp0075788  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0075789  .....................................................................................
FBpp0075785  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076498  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  .....................................................................................
FBpp0089396  .....................................................................................
FBpp0111789  .....................................................................................
FBpp0086683  .....................................................................................
FBpp0289328  nvtvfpqkgsmlywfnlhddgkpdi............................................................
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0112213  .....................................................................................
FBpp0087233  fiqfnthevaelhkfsssgreksifiggaiyptlalfnhscdpgvvryfrgttihinsvrpieaglpinenygpmytqderserq
FBpp0070906  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0082112  .....................................................................................
FBpp0086359  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085047  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0082420  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  layvdqytlpknfrfseknallrllrfpmdkskevkhfvfgdrtthqgsetvdpaltksrlmgnrlenrmnfakypieksyllhq
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0081398  .....................................................................................
FBpp0085015  .....................................................................................
FBpp0084188  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  nnlalslcegyrlpptrvtpydksamcqllnipvakplehtelifgdrstysyagadkqstdrladqnqieylekrllfarlpie
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075442  .....................................................................................
FBpp0089265  .....................................................................................
FBpp0075443  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0073018  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0087626  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0085046  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................


                                                                                                    
                                                                                                    
d1zu2a1        .....................................................................................
FBpp0112456  .....................................................................................
FBpp0112455  .....................................................................................
FBpp0070352  .....................................................................................
FBpp0070351  .....................................................................................
FBpp0070402  .....................................................................................
FBpp0080138  agggggggvggvvysdnedvvieeekivypneverrsnsqeadseellrsfevlqlnfksaedaqskpvapppvsfseppkklvy
FBpp0080139  agggggggvggvvysdnedvvieeekivypneverrsnsqeadseellrsfevlqlnfksaedaqskpvapppvsfseppkklvy
FBpp0074609  .....................................................................................
FBpp0084171  sftvehln.............................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0271718  .....................................................................................
FBpp0290895  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0111849  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0081607  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0085344  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070573  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0076114  .....................................................................................
FBpp0076115  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0085409  .....................................................................................
FBpp0271717  .....................................................................................
FBpp0271719  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0073412  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0076600  kvetitssgannnsggrsaaeeakvllnnslnnaqtmahqlmglkkqsadglmallrglaeayqllsnfqckaaikqlettipkh
FBpp0076382  .....................................................................................
FBpp0071712  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0079666  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  .....................................................................................
FBpp0111849  .....................................................................................
FBpp0082819  .....................................................................................
FBpp0292061  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0081805  .....................................................................................
FBpp0100021  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0074877  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0087232  rlkdlywfecscdacidnwpkfddlprdvirfrcdapnncsavievppscndfmvkcvtcgeitnilkglkvmqdtemmtrtakr
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0075786  .....................................................................................
FBpp0075788  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0075789  .....................................................................................
FBpp0075785  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076498  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  .....................................................................................
FBpp0089396  .....................................................................................
FBpp0111789  .....................................................................................
FBpp0086683  .....................................................................................
FBpp0289328  .....................................................................................
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0112213  .....................................................................................
FBpp0087233  arlkdlywfecscdacidnwpkfddlprdvirfrcdapnncsavievppscndfmvkcvtcgeitnilkglkvmqdtemmtrtak
FBpp0070906  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0082112  .....................................................................................
FBpp0086359  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085047  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0082420  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  maeihlkshrfdeccfsarksieeakkcnsyiwqflcylliikanaalhkvertsealdlalkiskelkekhihnfltacihcne
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0081398  .....................................................................................
FBpp0085015  .....................................................................................
FBpp0084188  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  rsyllheladrhmqknhfvqslsyaqkaieearvcnsliweflstmlmakshavlhkyerqtevlnsayelaaqlkspqlctfie
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075442  .....................................................................................
FBpp0089265  .....................................................................................
FBpp0075443  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0073018  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0087626  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0085046  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................


                                                                                                    
                                                                                                    
d1zu2a1        .....................................................................................
FBpp0112456  .....................................................................................
FBpp0112455  .....................................................................................
FBpp0070352  .....................................................................................
FBpp0070351  .....................................................................................
FBpp0070402  .....................................................................................
FBpp0080138  rnkytkinpnividclhneptiralkmlfdwlrinpeiligcyhsnpefvhkimkllnycnidiftrkvyferdllttanvrdsl
FBpp0080139  rnkytkinpnividclhneptiralkmlfdwlrinpeiligcyhsnpefvhkimkllnycnidiftrkvyferdllttanvrdsl
FBpp0074609  .....................................................................................
FBpp0084171  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0271718  .....................................................................................
FBpp0290895  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0111849  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0081607  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0085344  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070573  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0076114  .....................................................................................
FBpp0076115  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0085409  .....................................................................................
FBpp0271717  .....................................................................................
FBpp0271719  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0073412  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0076600  hlnsswvqsliglaryemreyeaavaifetihktep.................................................
FBpp0076382  .....................................................................................
FBpp0071712  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0079666  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  .....................................................................................
FBpp0111849  .....................................................................................
FBpp0082819  .....................................................................................
FBpp0292061  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0081805  .....................................................................................
FBpp0100021  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0074877  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0087232  lyetgeypkalakfvdlirim................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0075786  .....................................................................................
FBpp0075788  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0075789  .....................................................................................
FBpp0075785  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076498  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  .....................................................................................
FBpp0089396  .....................................................................................
FBpp0111789  .....................................................................................
FBpp0086683  .....................................................................................
FBpp0289328  .....................................................................................
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0112213  .....................................................................................
FBpp0087233  rlyetgeypkalakfvdlirimy..............................................................
FBpp0070906  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0082112  .....................................................................................
FBpp0086359  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085047  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0082420  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  ee...................................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0081398  .....................................................................................
FBpp0085015  .....................................................................................
FBpp0084188  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  lcr..................................................................................
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075442  .....................................................................................
FBpp0089265  .....................................................................................
FBpp0075443  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0073018  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0087626  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0085046  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................


                                                                                                    
                                                                                                    
d1zu2a1        .....................................................................................
FBpp0112456  .....................................................................................
FBpp0112455  .....................................................................................
FBpp0070352  .....................................................................................
FBpp0070351  .....................................................................................
FBpp0070402  .....................................................................................
FBpp0080138  velfdvranvpltedfafknfdifqstqitldwetiirervtpqeesilrifkmvdfgffickqkkfnyrfcvktrrftetqkkk
FBpp0080139  velfdvranvpltedfafknfdifqstqitldwetiirervtpqeesilrifkmvdfgffickqkkfnyrfcvktrrftetqkkk
FBpp0074609  .....................................................................................
FBpp0084171  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085421  .....................................................................................
FBpp0085422  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0271718  .....................................................................................
FBpp0290895  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0111849  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084692  .....................................................................................
FBpp0084694  .....................................................................................
FBpp0112211  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0084693  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0081607  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0085344  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070573  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0076114  .....................................................................................
FBpp0076115  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0079894  .....................................................................................
FBpp0079895  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0085409  .....................................................................................
FBpp0271717  .....................................................................................
FBpp0271719  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0073412  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0071712  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0079666  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  .....................................................................................
FBpp0111849  .....................................................................................
FBpp0082819  .....................................................................................
FBpp0292061  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0081805  .....................................................................................
FBpp0100021  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0074877  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0071561  .....................................................................................
FBpp0080423  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0292906  .....................................................................................
FBpp0079664  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0087232  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072562  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0075786  .....................................................................................
FBpp0075788  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0075789  .....................................................................................
FBpp0075785  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076498  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0290395  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  .....................................................................................
FBpp0089396  .....................................................................................
FBpp0111789  .....................................................................................
FBpp0086683  .....................................................................................
FBpp0289328  .....................................................................................
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0112213  .....................................................................................
FBpp0087233  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0082112  .....................................................................................
FBpp0086359  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085047  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0082420  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0088149  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0081398  .....................................................................................
FBpp0085015  .....................................................................................
FBpp0084188  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0076382  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  .....................................................................................
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070907  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0077738  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075442  .....................................................................................
FBpp0089265  .....................................................................................
FBpp0075443  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0073018  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0087626  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0085046  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................


                   
                   
d1zu2a1        ....
FBpp0112456  ....
FBpp0112455  ....
FBpp0070352  ....
FBpp0070351  ....
FBpp0070402  ....
FBpp0080138  qree
FBpp0080139  qree
FBpp0074609  ....
FBpp0084171  ....
FBpp0085420  ....
FBpp0085421  ....
FBpp0085422  ....
FBpp0085420  ....
FBpp0085421  ....
FBpp0085422  ....
FBpp0077790  ....
FBpp0082545  ....
FBpp0084693  ....
FBpp0084691  ....
FBpp0084692  ....
FBpp0084694  ....
FBpp0112211  ....
FBpp0072096  ....
FBpp0071560  ....
FBpp0071561  ....
FBpp0077790  ....
FBpp0076600  ....
FBpp0271716  ....
FBpp0077790  ....
FBpp0271718  ....
FBpp0290895  ....
FBpp0290896  ....
FBpp0081673  ....
FBpp0111849  ....
FBpp0077614  ....
FBpp0084692  ....
FBpp0084694  ....
FBpp0112211  ....
FBpp0084691  ....
FBpp0084693  ....
FBpp0076382  ....
FBpp0076382  ....
FBpp0080535  ....
FBpp0072164  ....
FBpp0084016  ....
FBpp0076382  ....
FBpp0076382  ....
FBpp0080894  ....
FBpp0081606  ....
FBpp0081607  ....
FBpp0084559  ....
FBpp0075683  ....
FBpp0081284  ....
FBpp0079468  ....
FBpp0087297  ....
FBpp0074835  ....
FBpp0079893  ....
FBpp0079894  ....
FBpp0079895  ....
FBpp0082765  ....
FBpp0079617  ....
FBpp0084440  ....
FBpp0080423  ....
FBpp0080424  ....
FBpp0085344  ....
FBpp0081552  ....
FBpp0087646  ....
FBpp0083769  ....
FBpp0070572  ....
FBpp0070573  ....
FBpp0070575  ....
FBpp0074835  ....
FBpp0080424  ....
FBpp0080423  ....
FBpp0076113  ....
FBpp0076114  ....
FBpp0076115  ....
FBpp0072561  ....
FBpp0072562  ....
FBpp0072561  ....
FBpp0072562  ....
FBpp0085923  ....
FBpp0079893  ....
FBpp0079894  ....
FBpp0079895  ....
FBpp0075683  ....
FBpp0077614  ....
FBpp0085409  ....
FBpp0271717  ....
FBpp0271719  ....
FBpp0086749  ....
FBpp0073411  ....
FBpp0070907  ....
FBpp0073412  ....
FBpp0070908  ....
FBpp0085842  ....
FBpp0077718  ....
FBpp0076600  ....
FBpp0076382  ....
FBpp0071712  ....
FBpp0086749  ....
FBpp0085479  ....
FBpp0112016  ....
FBpp0292906  ....
FBpp0079665  ....
FBpp0079666  ....
FBpp0079664  ....
FBpp0084076  ....
FBpp0111406  ....
FBpp0074918  ....
FBpp0082818  ....
FBpp0074480  ....
FBpp0111849  ....
FBpp0082819  ....
FBpp0292061  ....
FBpp0085279  ....
FBpp0081805  ....
FBpp0100021  ....
FBpp0100023  ....
FBpp0074877  ....
FBpp0071879  ....
FBpp0084559  ....
FBpp0075591  ....
FBpp0076526  ....
FBpp0079851  ....
FBpp0290395  ....
FBpp0072146  ....
FBpp0076382  ....
FBpp0083238  ....
FBpp0111383  ....
FBpp0080424  ....
FBpp0071560  ....
FBpp0071561  ....
FBpp0080423  ....
FBpp0071879  ....
FBpp0077738  ....
FBpp0077934  ....
FBpp0292775  ....
FBpp0087646  ....
FBpp0292906  ....
FBpp0079664  ....
FBpp0086749  ....
FBpp0082652  ....
FBpp0077619  ....
FBpp0086164  ....
FBpp0087232  ....
FBpp0072561  ....
FBpp0072562  ....
FBpp0088148  ....
FBpp0088149  ....
FBpp0075786  ....
FBpp0075788  ....
FBpp0075787  ....
FBpp0075789  ....
FBpp0075785  ....
FBpp0083319  ....
FBpp0076498  ....
FBpp0290580  ....
FBpp0290395  ....
FBpp0080720  ....
FBpp0086164  ....
FBpp0080741  ....
FBpp0087297  ....
FBpp0070720  ....
FBpp0089396  ....
FBpp0111789  ....
FBpp0086683  ....
FBpp0289328  ....
FBpp0070667  ....
FBpp0082624  ....
FBpp0081552  ....
FBpp0086749  ....
FBpp0087646  ....
FBpp0071879  ....
FBpp0080894  ....
FBpp0112213  ....
FBpp0087233  ....
FBpp0070906  ....
FBpp0087646  ....
FBpp0082112  ....
FBpp0086359  ....
FBpp0076526  ....
FBpp0085279  ....
FBpp0074835  ....
FBpp0078887  ....
FBpp0290580  ....
FBpp0085047  ....
FBpp0086380  ....
FBpp0083435  ....
FBpp0078891  ....
FBpp0082419  ....
FBpp0082420  ....
FBpp0086749  ....
FBpp0078027  ....
FBpp0088148  ....
FBpp0088149  ....
FBpp0290863  ....
FBpp0080720  ....
FBpp0083319  ....
FBpp0071288  ....
FBpp0081398  ....
FBpp0085015  ....
FBpp0084188  ....
FBpp0290580  ....
FBpp0085012  ....
FBpp0086380  ....
FBpp0076382  ....
FBpp0071879  ....
FBpp0076961  ....
FBpp0075717  ....
FBpp0080267  ....
FBpp0070907  ....
FBpp0085033  ....
FBpp0082507  ....
FBpp0077738  ....
FBpp0292775  ....
FBpp0085676  ....
FBpp0087091  ....
FBpp0082624  ....
FBpp0070908  ....
FBpp0070431  ....
FBpp0075442  ....
FBpp0089265  ....
FBpp0075443  ....
FBpp0070906  ....
FBpp0073018  ....
FBpp0078634  ....
FBpp0087626  ....
FBpp0075754  ....
FBpp0087625  ....
FBpp0071288  ....
FBpp0085046  ....
FBpp0110159  ....
FBpp0072679  ....
FBpp0082624  ....
FBpp0084254  ....
FBpp0085032  ....


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0051642 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


<
Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Drosophila melanogaster 58 (pseudogenes) - Fruit fly
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes