SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

TPR-like alignments

These alignments are sequences aligned to the 0040251 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1kt1a1                ke...........................................................................
hFl_ENSPANP00000004835 vlhidlwkcylsyvretkgklpsykekmaqaydfaldkigmeimsyqiwvdyinflkgveavgsyaenqritavrrv
hFl_ENSPANP00000017500 nirqaevlkadmtdsklgpaevwtsrqalqdlyqkmlvtdleyaldkkveqdlwnhafknqittlqgqaknranpnr
hFl_ENSPANP00000011496 tydkgyqfeeenplrdhpqpfeeglrrlqegdlpnavll......................................
hFl_ENSPANP00000005875 lyravveavhrldlilcnktayqevfkpenislrnklrelcvklmflhpvdygrkaeellwrkvyyeviqliktmkf
hFl_ENSPANP00000015319 asekgyyfhtenpfkdwpgafeeglkrlkegdlpvtilfm.....................................
hFl_ENSPANP00000019493 qlsnllsrdrispeglekmaqlraellqlyercilldiefsdnqnvdqilwknafyqviekfrqlvkdpnvenpeqi
hFl_ENSPANP00000015800 wvlynmasfywriknepyqvvecamralhfssrhnkdialvnlanvlhrahfsadaavvvhaalddsdfftsyytlg
hFl_ENSPANP00000017125 ednirk.......................................................................
hFl_ENSPANP00000011271 eamallaeaerkvknsqsffsglfggsskieeace..........................................
hFl_ENSPANP00000017151 eavqlmaeaekrvkashsflrglfggntrieeacemytr......................................
hFl_ENSPANP00000007093 v............................................................................
hFl_ENSPANP00000007238 eeqlsinvydynchvdlirllrlegeltkvrmarqkmseifplteelwlewlhdeismaqdgldrehvydlfekavk
hFl_ENSPANP00000007093 qagdfeaaerhcmqlwrqepdntgvllllssihfqcrrldrsahfst..............................
hFl_ENSPANP00000015526 meavlnelvsvedllkfekkfqsekaagsvskstqfeyawclvrskynd............................
hFl_ENSPANP00000010410 neglehlakaekylktgflkwkpdydsaasey.............................................
hFl_ENSPANP00000004737 kqal.........................................................................
hFl_ENSPANP00000020946 kkskkerelekqkaekelsrieealmdpgrqpesaddfdrlvlsspnssilwlqymafhlqateiekaravaeralk
hFl_ENSPANP00000020864 nspeawcaagncfslqrehdia.......................................................
hFl_ENSPANP00000007952 illinmlrcvvrsgqwrseeq........................................................
hFl_ENSPANP00000016788 nehevskrwtfeegikrpyfhvkplekaqlknwkeylefeiengthervvvlfercviscalyeefwikyakymenh
hFl_ENSPANP00000004737 lale.........................................................................
hFl_ENSPANP00000004737 qv...........................................................................
hFl_ENSPANP00000000707 lfrsgvqt.....................................................................
hFl_ENSPANP00000004108 k............................................................................
hFl_ENSPANP00000016788 tv...........................................................................
hFl_ENSPANP00000015646 sdyaaqg......................................................................
hFl_ENSPANP00000015647 sdyaaqg......................................................................
hFl_ENSPANP00000003166 .............................................................................
hFl_ENSPANP00000003324 e............................................................................
hFl_ENSPANP00000005479 s............................................................................
hFl_ENSPANP00000003528 k............................................................................
hFl_ENSPANP00000015647 sqakfralgnlgdifickkdingaikfyeqqlglahqvkdrrl..................................
hFl_ENSPANP00000014391 aaqd.........................................................................
hFl_ENSPANP00000015646 sqakfralgnlgdifickkdingaikfyeqqlglahqvkdrrl..................................
hFl_ENSPANP00000015646 nrmqdqakayrglgnghramgslqqalvcfekrlvvahelg....................................
hFl_ENSPANP00000015647 rmqdqakayrglgnghramgslqqalvcfekrlvvahelg.....................................
hFl_ENSPANP00000010352 ytlf.........................................................................
hFl_ENSPANP00000012491 s............................................................................
hFl_ENSPANP00000014791 svts.........................................................................
hFl_ENSPANP00000005591 kr...........................................................................
hFl_ENSPANP00000015348 fnlasqysvnemyaealntyqvivknkmfsnagilkmnmgniylkqrnyskaikfyrmaldqvpsvnkqmrikimqn
hFl_ENSPANP00000014791 yrsgikvn.....................................................................
hFl_ENSPANP00000013486 s............................................................................
hFl_ENSPANP00000015752 kasefyernlslvkelgdraaqg......................................................
hFl_ENSPANP00000014239 mlgkihllegdldka..............................................................
hFl_ENSPANP00000001617 aavdfyeenlslvtalgdraaqg......................................................
hFl_ENSPANP00000017253 kqdelhrkalqtleraqqlapgdpqvilyvslqlalvrqissam.................................
hFl_ENSPANP00000020687 yneayn.......................................................................
hFl_ENSPANP00000014947 e............................................................................
hFl_ENSPANP00000015753 kasefyernlslvkelgdraaqg......................................................
hFl_ENSPANP00000003528 aise.........................................................................
hFl_ENSPANP00000008218 vqigkcyyrlgmyreaekqfksalkqqemvdtflylakvyvsldqpvtalnlfk.......................
hFl_ENSPANP00000015646 aassalsslghvytaigdypnalashkqcvllakqskdel.....................................
hFl_ENSPANP00000013297 gkd..........................................................................
hFl_ENSPANP00000015647 aassalsslghvytaigdypnalashkqcvllakqskdel.....................................
hFl_ENSPANP00000007362 v............................................................................
hFl_ENSPANP00000014947 ekt..........................................................................
hFl_ENSPANP00000008383 e............................................................................
hFl_ENSPANP00000017676 ve...........................................................................
hFl_ENSPANP00000001814 estr.........................................................................
hFl_ENSPANP00000001168 a............................................................................
hFl_ENSPANP00000003176 .............................................................................
hFl_ENSPANP00000010724 alaree.......................................................................
hFl_ENSPANP00000013376 v............................................................................
hFl_ENSPANP00000013375 v............................................................................
hFl_ENSPANP00000000707 a............................................................................
hFl_ENSPANP00000012992 e............................................................................
hFl_ENSPANP00000020687 ka...........................................................................
hFl_ENSPANP00000000643 kvl..........................................................................
hFl_ENSPANP00000007559 gkd..........................................................................
hFl_ENSPANP00000003197 d............................................................................
hFl_ENSPANP00000003945 yevavplcrqaledlerssghc.......................................................
hFl_ENSPANP00000012699 dh...........................................................................
hFl_ENSPANP00000004293 inmmlanlykkagqerpsvtsykevlrqcplaldailgllslsvkgaevasmtmnviqtvpnldwlsvwikayafvh
hFl_ENSPANP00000014070 l............................................................................
hFl_ENSPANP00000008096 elgkkllaagqladalsqfhaavdgdlitilliigeatvflamgkskaalpd.........................
hFl_ENSPANP00000014947 pl...........................................................................
hFl_ENSPANP00000020577 lttksrlalynllayvkhlkgqnkdalecleeaeeiiqrehsdkeevrslvtwgnyawvyyhmnqleeaqkytgkig
hFl_ENSPANP00000020573 ypeld........................................................................
hFl_ENSPANP00000015642 l............................................................................
hFl_ENSPANP00000019972 eiensivhrvqgvfqrasakwkddvqlwlsyvvfckkwatktqlskvfsamlaihsnkpalwimaakwemedrlsse
hFl_ENSPANP00000002155 pkalsayqryyslqsd.............................................................
hFl_ENSPANP00000003197 ymeeenydkiisecskeidaegkymaealllratfyllignanaakpdldkvislkeanvklranalikrgsmymqq
hFl_ENSPANP00000010388 as...........................................................................
hFl_ENSPANP00000009536 q............................................................................
hFl_ENSPANP00000013401 qandk........................................................................
hFl_ENSPANP00000007559 lr...........................................................................
hFl_ENSPANP00000020038 av...........................................................................
hFl_ENSPANP00000020312 nfemaaayykerlvrepqnldhwldygafclltednikaqecfrkalslnqshihslllcgvlavllenyeqaeiff
hFl_ENSPANP00000000258 as...........................................................................
hFl_ENSPANP00000017676 f............................................................................
hFl_ENSPANP00000006518 ppy..........................................................................
hFl_ENSPANP00000013297 lr...........................................................................
hFl_ENSPANP00000003504 re...........................................................................
hFl_ENSPANP00000017184 rr...........................................................................
hFl_ENSPANP00000006801 .............................................................................
hFl_ENSPANP00000015190 atl..........................................................................
hFl_ENSPANP00000001081 e............................................................................
hFl_ENSPANP00000006437 gltlnclgkkeeayefv............................................................
hFl_ENSPANP00000012699 lr...........................................................................
hFl_ENSPANP00000007476 reeeddvdlelrlarfeqlisrrplllnsvllrqnphhvhewhkrvalhqgrpreiintyteavqtvdpfkatgkph
hFl_ENSPANP00000009269 k............................................................................
hFl_ENSPANP00000014391 nreqwiqdaeecdragsvatcqaavravigigieeedrkh.....................................
hFl_ENSPANP00000019581 hekm.........................................................................
hFl_ENSPANP00000020572 nqnerakv.....................................................................
hFl_ENSPANP00000007217 ra...........................................................................
hFl_ENSPANP00000020685 s............................................................................
hFl_ENSPANP00000020899 l............................................................................
hFl_ENSPANP00000008387 skhqglvsmedvni...............................................................
hFl_ENSPANP00000010352 y............................................................................
hFl_ENSPANP00000009338 aa...........................................................................
hFl_ENSPANP00000018160 pgllqtvfliakvkylsgdieaafnnlqhclehnpsyadahlllaqvylsqekvklcsqslelclsydfkvreyply
hFl_ENSPANP00000020864 seealfllatcyyrsgkaykayrllkghscttpqckyllakccvdlsklaegeqilsggvfnkqkshddivtefgds
hFl_ENSPANP00000008387 lrg..........................................................................
hFl_ENSPANP00000009057 lgkkeeayefvrkglrndvks........................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000007915 esllr........................................................................
hFl_ENSPANP00000003731 iertfmatpsyihvatelgyffilknqvkeallwyteamkldkdgmagltgiilchileghleeaehqleflkevqk
hFl_ENSPANP00000015625 lkva.........................................................................
hFl_ENSPANP00000014767 skq..........................................................................
hFl_ENSPANP00000002080 sqe..........................................................................
hFl_ENSPANP00000007403 l............................................................................
hFl_ENSPANP00000007476 wstyltkfiaryg................................................................
hFl_ENSPANP00000005487 tkeaiaylslaifaagsqa..........................................................
hFl_ENSPANP00000003731 ci...........................................................................
hFl_ENSPANP00000013410 vq...........................................................................
hFl_ENSPANP00000003097 .............................................................................
hFl_ENSPANP00000020575 r............................................................................
hFl_ENSPANP00000007248 ai...........................................................................
hFl_ENSPANP00000019375 plk..........................................................................
hFl_ENSPANP00000003854 ekakavp......................................................................
hFl_ENSPANP00000006795 walk.........................................................................
hFl_ENSPANP00000002479 eq...........................................................................
hFl_ENSPANP00000017125 vlwksyidfeieqeetertr.........................................................
hFl_ENSPANP00000005048 clq..........................................................................
hFl_ENSPANP00000003731 gt...........................................................................
hFl_ENSPANP00000018160 ek...........................................................................
hFl_ENSPANP00000019375 lt...........................................................................
hFl_ENSPANP00000014239 yvqalifrlegniqesle...........................................................
hFl_ENSPANP00000012835 rv...........................................................................
hFl_ENSPANP00000001460 kcgg.........................................................................
hFl_ENSPANP00000015753 eascle.......................................................................
hFl_ENSPANP00000003968 alwsevnrygqngdftralkt........................................................
hFl_ENSPANP00000006868 l............................................................................
hFl_ENSPANP00000001460 egek.........................................................................
hFl_ENSPANP00000004313 i............................................................................
hFl_ENSPANP00000001617 a............................................................................
hFl_ENSPANP00000019732 ldac.........................................................................
hFl_ENSPANP00000013913 rn...........................................................................
hFl_ENSPANP00000004649 qleq.........................................................................
hFl_ENSPANP00000013914 rn...........................................................................
hFl_ENSPANP00000003176 sclad........................................................................
hFl_ENSPANP00000003166 i............................................................................
hFl_ENSPANP00000015752 eascle.......................................................................
hFl_ENSPANP00000001460 gi...........................................................................
hFl_ENSPANP00000004498 gq...........................................................................
hFl_ENSPANP00000014540 l............................................................................
hFl_ENSPANP00000002479 n............................................................................
hFl_ENSPANP00000017858 .............................................................................
hFl_ENSPANP00000007886 qandk........................................................................
hFl_ENSPANP00000018968 .............................................................................
hFl_ENSPANP00000015642 .............................................................................
hFl_ENSPANP00000003731 kanmeaalgsfiqi...............................................................
hFl_ENSPANP00000019484 k............................................................................
hFl_ENSPANP00000019485 k............................................................................
hFl_ENSPANP00000020575 i............................................................................
hFl_ENSPANP00000017457 gaqavdrgdwaralhlfsgvpapp.....................................................
hFl_ENSPANP00000020575 rl...........................................................................
hFl_ENSPANP00000004562 lirgaryaeavql................................................................
hFl_ENSPANP00000004438 l............................................................................
hFl_ENSPANP00000008640 .............................................................................
hFl_ENSPANP00000020327 t............................................................................
hFl_ENSPANP00000020572 at...........................................................................
hFl_ENSPANP00000016643 yf...........................................................................
hFl_ENSPANP00000006588 efkrhvgeeeedtn...............................................................
hFl_ENSPANP00000003995 aeh..........................................................................
hFl_ENSPANP00000007718 q............................................................................
hFl_ENSPANP00000004384 easvlenpshvqlwlklaykylnqnegegsesldsalnv......................................
hFl_ENSPANP00000011118 q............................................................................
hFl_ENSPANP00000004252 rlirdaryaeavqllgrep..........................................................
hFl_ENSPANP00000007476 yedvn........................................................................
hFl_ENSPANP00000006588 qls..........................................................................
hFl_ENSPANP00000001745 ieg..........................................................................
hFl_ENSPANP00000014391 av...........................................................................
hFl_ENSPANP00000004313 knn..........................................................................
hFl_ENSPANP00000004562 qv...........................................................................
hFl_ENSPANP00000001425 rlvsnklkkrflrkpnvaeageqfgqlgrelraqeclpyaawcqlavarcqqalfhgpgealalteaarlflrqerd
hFl_ENSPANP00000015647 k............................................................................
hFl_ENSPANP00000019118 yrrglqelitgnpekalsslhevasglcprpvlvqvytalgschrkmgnpqrallylvaalkegsawgpplleasrl
hFl_ENSPANP00000015209 agn..........................................................................
hFl_ENSPANP00000006801 i............................................................................
hFl_ENSPANP00000003551 svdd.........................................................................
hFl_ENSPANP00000004252 vs...........................................................................
hFl_ENSPANP00000002479 lwqeas.......................................................................
hFl_ENSPANP00000004798 a............................................................................
hFl_ENSPANP00000000477 svdd.........................................................................
hFl_ENSPANP00000007362 f............................................................................
hFl_ENSPANP00000002485 rqetkeaql....................................................................
hFl_ENSPANP00000014498 ceekaksysnsheykqaihelvrcvaltricygdshwklaeahvnlaqgylqlkglslqakqhaekakqilansivp
hFl_ENSPANP00000017253 mc...........................................................................
hFl_ENSPANP00000016353 eeaeaalekgdesadchlwyavlcgqlaehesiqrriqsgfsfk.................................
hFl_ENSPANP00000016352 eeaeaalekgdesadchlwyavlcgqlaehesiqrriqsgfsfk.................................
hFl_ENSPANP00000018429 a............................................................................
hFl_ENSPANP00000013579 ave..........................................................................
hFl_ENSPANP00000000348 tvq..........................................................................
hFl_ENSPANP00000015511 lserainrapmnghchlwyavlcgyvsefeglqnkinyghlfke.................................
hFl_ENSPANP00000007718 sdlqgama.....................................................................
hFl_ENSPANP00000011118 sdlqgama.....................................................................
hFl_ENSPANP00000007718 aqragqrr.....................................................................
hFl_ENSPANP00000015642 ialgrrgqyemls................................................................
hFl_ENSPANP00000001022 lrifnkltelqi.................................................................
hFl_ENSPANP00000010920 qvalkd.......................................................................
hFl_ENSPANP00000007476 eeeimrnqfsvkcwlryiefkqgapkprln...............................................
hFl_ENSPANP00000003968 vkltnaegvefklskkqlqaiefnkallamytnqaeqcrkisaslqsqs............................
hFl_ENSPANP00000001022 mlrqalaaceeladrstqr..........................................................
hFl_ENSPANP00000009443 ilw..........................................................................
hFl_ENSPANP00000011463 erlrkrvrqyldqqqyqsalfwa......................................................
hFl_ENSPANP00000002961 ar...........................................................................
hFl_ENSPANP00000017623 qavpelrh.....................................................................
hFl_ENSPANP00000011215 ite..........................................................................
hFl_ENSPANP00000000119 qlqqr........................................................................
hFl_ENSPANP00000002418 e............................................................................
hFl_ENSPANP00000014391 di...........................................................................
hFl_ENSPANP00000020421 kekaiqvg.....................................................................
hFl_ENSPANP00000008387 .............................................................................
hFl_ENSPANP00000005487 qaaawe.......................................................................
hFl_ENSPANP00000002155 s............................................................................
hFl_ENSPANP00000002567 ldeakeillkkea................................................................
hFl_ENSPANP00000019509 h............................................................................
hFl_ENSPANP00000005069 ldeakeillkkea................................................................
hFl_ENSPANP00000000052 vm...........................................................................
hFl_ENSPANP00000005735 ddc..........................................................................
hFl_ENSPANP00000001022 npea.........................................................................
hFl_ENSPANP00000018160 a............................................................................
hFl_ENSPANP00000018982 arl..........................................................................
hFl_ENSPANP00000018968 r............................................................................
hFl_ENSPANP00000008513 d............................................................................
hFl_ENSPANP00000019509 as...........................................................................
hFl_ENSPANP00000006588 qcm..........................................................................
hFl_ENSPANP00000011118 lskakakaqragqrr..............................................................
hFl_ENSPANP00000003166 it...........................................................................
hFl_ENSPANP00000004798 aqaaqaeaadswylallgfaehfrtssppkirlcvhclqavfpfkppqriearthlqlgsv................
hFl_ENSPANP00000015019 dc...........................................................................
hFl_ENSPANP00000020573 k............................................................................
hFl_ENSPANP00000004562 pv...........................................................................
hFl_ENSPANP00000004252 vl...........................................................................
hFl_ENSPANP00000020003 elcleciewaksekrtflrqalearlvs.................................................
hFl_ENSPANP00000006922 q............................................................................
hFl_ENSPANP00000001081 lrsli........................................................................
hFl_ENSPANP00000020426 sly..........................................................................
hFl_ENSPANP00000014026 kqmdllqefyettlealkdakndrlwfktntklgklylereeygklqkilrqlhqscqtddgeddl...........
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000015639 eraiesnqssvdlklaklklctefwepstlvkewqkliflhpnntalwqkyllfcqsqfstfsiskihslygkclst
hFl_ENSPANP00000004438 rtlallrqvlksedprhqalawcylgmllerndtfsttpmgvhdcgysgtdpl........................
hFl_ENSPANP00000015636 eraiesnqssvdlklaklklctefwepstlvkewqkliflhpnntalwqkyllfcqsqfstfsiskihslygkclst
hFl_ENSPANP00000006186 ercvllsaellksqskyseaaallirltseqntwkgmdsdlrsallleqaahcfinmkspmvr..............
hFl_ENSPANP00000015209 .............................................................................
hFl_ENSPANP00000000119 at...........................................................................
hFl_ENSPANP00000011874 he...........................................................................
hFl_ENSPANP00000013299 yfslvgll.....................................................................
hFl_ENSPANP00000003968 s............................................................................
hFl_ENSPANP00000005681 am...........................................................................
hFl_ENSPANP00000012992 mlrsl........................................................................
hFl_ENSPANP00000004384 ayeaalgvamrcdivqkiwmdylvfannraagsrnkvqefkfftdlvnrclvtvparypipfssadywsnyefhnrv
hFl_ENSPANP00000020572 ligh.........................................................................
hFl_ENSPANP00000006404 eyereatkkgarg................................................................
hFl_ENSPANP00000000870 yqamg........................................................................
hFl_ENSPANP00000001745 ya...........................................................................
hFl_ENSPANP00000011077 eledaeknlgeseir..............................................................
hFl_ENSPANP00000003398 dkcrlmffi....................................................................
hFl_ENSPANP00000008218 l............................................................................
hFl_ENSPANP00000010361 lahhfla......................................................................
hFl_ENSPANP00000017310 ysqaiealppdkygqnesfariqvrfaelk...............................................
hFl_ENSPANP00000004678 alellgatyvd..................................................................
hFl_ENSPANP00000005519 trd..........................................................................
hFl_ENSPANP00000008921 qe...........................................................................
hFl_ENSPANP00000016699 ehs..........................................................................
hFl_ENSPANP00000001022 h............................................................................
hFl_ENSPANP00000015209 fqa..........................................................................
hFl_ENSPANP00000012305 ehs..........................................................................
hFl_ENSPANP00000018202 eyereatkkgarg................................................................


                                                                                                    
                                                                                                    
d1kt1a1                .............................................................................
hFl_ENSPANP00000004835 yqrgcvnpminieqlwrdynkyeeginihlakkmiedrsrdymnarrvakeyetvmkgldrnapsvppqntpqeaqq
hFl_ENSPANP00000017500 sevqanlslfleaasgfytqllqelctvfnvdlpcrvkssqlgiisnkqthtsaivkpqssscsyi...........
hFl_ENSPANP00000011496 .............................................................................
hFl_ENSPANP00000005875 qsqhihsrstlecayrthlvagigfyqhlllyiqshyqlelqccidwthvtdpligckkpvsasgkemdwaqmachr
hFl_ENSPANP00000015319 .............................................................................
hFl_ENSPANP00000019493 rnrllelldegsdffdsllqklqvtykfkledymdglairskplrktvkyalisaqrsmicqgdiaryreqandt..
hFl_ENSPANP00000015800 niyamlgeynhsvlcydhalqakpgfeqaikrkhavlcqqkleqkleaqhrslqrtlnelkeyqkqhdhylrqqeil
hFl_ENSPANP00000017125 .............................................................................
hFl_ENSPANP00000011271 .............................................................................
hFl_ENSPANP00000017151 .............................................................................
hFl_ENSPANP00000007093 .............................................................................
hFl_ENSPANP00000007238 dyicpniwleygqysvggigqkgglekvrsvferalssvglhmtkglalweayrefesaiveaarlekvhslfrrql
hFl_ENSPANP00000007093 .............................................................................
hFl_ENSPANP00000015526 .............................................................................
hFl_ENSPANP00000010410 .............................................................................
hFl_ENSPANP00000004737 .............................................................................
hFl_ENSPANP00000020946 tisfreeqeklnvwvallnlenmygsqesltkvferavqyneplk................................
hFl_ENSPANP00000020864 .............................................................................
hFl_ENSPANP00000007952 .............................................................................
hFl_ENSPANP00000016788 siegvrhvfsractihl............................................................
hFl_ENSPANP00000004737 .............................................................................
hFl_ENSPANP00000004737 .............................................................................
hFl_ENSPANP00000000707 .............................................................................
hFl_ENSPANP00000004108 .............................................................................
hFl_ENSPANP00000016788 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000003166 .............................................................................
hFl_ENSPANP00000003324 .............................................................................
hFl_ENSPANP00000005479 .............................................................................
hFl_ENSPANP00000003528 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000010352 .............................................................................
hFl_ENSPANP00000012491 .............................................................................
hFl_ENSPANP00000014791 .............................................................................
hFl_ENSPANP00000005591 .............................................................................
hFl_ENSPANP00000015348 igvtfiqagqysdainsyehimsmapnlkagynlticyfavgdrekmkkafqkliavpleidedkyispsddphtnl
hFl_ENSPANP00000014791 .............................................................................
hFl_ENSPANP00000013486 .............................................................................
hFl_ENSPANP00000015752 .............................................................................
hFl_ENSPANP00000014239 .............................................................................
hFl_ENSPANP00000001617 .............................................................................
hFl_ENSPANP00000017253 .............................................................................
hFl_ENSPANP00000020687 .............................................................................
hFl_ENSPANP00000014947 .............................................................................
hFl_ENSPANP00000015753 .............................................................................
hFl_ENSPANP00000003528 .............................................................................
hFl_ENSPANP00000008218 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000013297 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000007362 .............................................................................
hFl_ENSPANP00000014947 .............................................................................
hFl_ENSPANP00000008383 .............................................................................
hFl_ENSPANP00000017676 .............................................................................
hFl_ENSPANP00000001814 .............................................................................
hFl_ENSPANP00000001168 .............................................................................
hFl_ENSPANP00000003176 .............................................................................
hFl_ENSPANP00000010724 .............................................................................
hFl_ENSPANP00000013376 .............................................................................
hFl_ENSPANP00000013375 .............................................................................
hFl_ENSPANP00000000707 .............................................................................
hFl_ENSPANP00000012992 .............................................................................
hFl_ENSPANP00000020687 .............................................................................
hFl_ENSPANP00000000643 .............................................................................
hFl_ENSPANP00000007559 .............................................................................
hFl_ENSPANP00000003197 .............................................................................
hFl_ENSPANP00000003945 .............................................................................
hFl_ENSPANP00000012699 .............................................................................
hFl_ENSPANP00000004293 tgdnsrainticslekksll.........................................................
hFl_ENSPANP00000014070 .............................................................................
hFl_ENSPANP00000008096 .............................................................................
hFl_ENSPANP00000014947 .............................................................................
hFl_ENSPANP00000020577 nvckklsspsnyklecpeidcekgwallkfggkyyqkakaafekalevepdnpefnigyaitvyrlddsdregsvks
hFl_ENSPANP00000020573 .............................................................................
hFl_ENSPANP00000015642 .............................................................................
hFl_ENSPANP00000019972 .............................................................................
hFl_ENSPANP00000002155 .............................................................................
hFl_ENSPANP00000003197 qqpllst......................................................................
hFl_ENSPANP00000010388 .............................................................................
hFl_ENSPANP00000009536 .............................................................................
hFl_ENSPANP00000013401 .............................................................................
hFl_ENSPANP00000007559 .............................................................................
hFl_ENSPANP00000020038 .............................................................................
hFl_ENSPANP00000020312 edatcleptnvvawtllglyyeiqnndirmemafheaskqlqaqmlqaqvtkqksagvvedieergkresslgpwgi
hFl_ENSPANP00000000258 .............................................................................
hFl_ENSPANP00000017676 .............................................................................
hFl_ENSPANP00000006518 .............................................................................
hFl_ENSPANP00000013297 .............................................................................
hFl_ENSPANP00000003504 .............................................................................
hFl_ENSPANP00000017184 .............................................................................
hFl_ENSPANP00000006801 .............................................................................
hFl_ENSPANP00000015190 .............................................................................
hFl_ENSPANP00000001081 .............................................................................
hFl_ENSPANP00000006437 .............................................................................
hFl_ENSPANP00000012699 .............................................................................
hFl_ENSPANP00000007476 t............................................................................
hFl_ENSPANP00000009269 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000019581 .............................................................................
hFl_ENSPANP00000020572 .............................................................................
hFl_ENSPANP00000007217 .............................................................................
hFl_ENSPANP00000020685 .............................................................................
hFl_ENSPANP00000020899 .............................................................................
hFl_ENSPANP00000008387 .............................................................................
hFl_ENSPANP00000010352 .............................................................................
hFl_ENSPANP00000009338 .............................................................................
hFl_ENSPANP00000018160 hlikaqsqkkmgeiadaiktlhmamslpgmkrigastkskdrntevdtshrlsiflelielhrlngeqheaakvlqd
hFl_ENSPANP00000020864 acf..........................................................................
hFl_ENSPANP00000008387 .............................................................................
hFl_ENSPANP00000009057 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000007915 .............................................................................
hFl_ENSPANP00000003731 slgksevliflqalltskkhkgeqettallkeavelhfssmqglplgseyfekldpyflvciakeyllfcpkqprlp
hFl_ENSPANP00000015625 .............................................................................
hFl_ENSPANP00000014767 .............................................................................
hFl_ENSPANP00000002080 .............................................................................
hFl_ENSPANP00000007403 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000005487 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000013410 .............................................................................
hFl_ENSPANP00000003097 .............................................................................
hFl_ENSPANP00000020575 .............................................................................
hFl_ENSPANP00000007248 .............................................................................
hFl_ENSPANP00000019375 .............................................................................
hFl_ENSPANP00000003854 .............................................................................
hFl_ENSPANP00000006795 .............................................................................
hFl_ENSPANP00000002479 .............................................................................
hFl_ENSPANP00000017125 .............................................................................
hFl_ENSPANP00000005048 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000019375 .............................................................................
hFl_ENSPANP00000014239 .............................................................................
hFl_ENSPANP00000012835 .............................................................................
hFl_ENSPANP00000001460 .............................................................................
hFl_ENSPANP00000015753 .............................................................................
hFl_ENSPANP00000003968 .............................................................................
hFl_ENSPANP00000006868 .............................................................................
hFl_ENSPANP00000001460 .............................................................................
hFl_ENSPANP00000004313 .............................................................................
hFl_ENSPANP00000001617 .............................................................................
hFl_ENSPANP00000019732 .............................................................................
hFl_ENSPANP00000013913 .............................................................................
hFl_ENSPANP00000004649 .............................................................................
hFl_ENSPANP00000013914 .............................................................................
hFl_ENSPANP00000003176 .............................................................................
hFl_ENSPANP00000003166 .............................................................................
hFl_ENSPANP00000015752 .............................................................................
hFl_ENSPANP00000001460 .............................................................................
hFl_ENSPANP00000004498 .............................................................................
hFl_ENSPANP00000014540 .............................................................................
hFl_ENSPANP00000002479 .............................................................................
hFl_ENSPANP00000017858 .............................................................................
hFl_ENSPANP00000007886 .............................................................................
hFl_ENSPANP00000018968 .............................................................................
hFl_ENSPANP00000015642 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000019484 .............................................................................
hFl_ENSPANP00000019485 .............................................................................
hFl_ENSPANP00000020575 .............................................................................
hFl_ENSPANP00000017457 .............................................................................
hFl_ENSPANP00000020575 .............................................................................
hFl_ENSPANP00000004562 .............................................................................
hFl_ENSPANP00000004438 .............................................................................
hFl_ENSPANP00000008640 .............................................................................
hFl_ENSPANP00000020327 .............................................................................
hFl_ENSPANP00000020572 .............................................................................
hFl_ENSPANP00000016643 .............................................................................
hFl_ENSPANP00000006588 .............................................................................
hFl_ENSPANP00000003995 .............................................................................
hFl_ENSPANP00000007718 .............................................................................
hFl_ENSPANP00000004384 .............................................................................
hFl_ENSPANP00000011118 .............................................................................
hFl_ENSPANP00000004252 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000006588 .............................................................................
hFl_ENSPANP00000001745 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000004313 .............................................................................
hFl_ENSPANP00000004562 .............................................................................
hFl_ENSPANP00000001425 arqrlvcpaaygeplq.............................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000019118 yqqlgdttaeleslellvealnvpysskappflievelllpppdlasplhcgtqsqakh..................
hFl_ENSPANP00000015209 .............................................................................
hFl_ENSPANP00000006801 .............................................................................
hFl_ENSPANP00000003551 .............................................................................
hFl_ENSPANP00000004252 .............................................................................
hFl_ENSPANP00000002479 .............................................................................
hFl_ENSPANP00000004798 .............................................................................
hFl_ENSPANP00000000477 .............................................................................
hFl_ENSPANP00000007362 .............................................................................
hFl_ENSPANP00000002485 .............................................................................
hFl_ENSPANP00000014498 p............................................................................
hFl_ENSPANP00000017253 .............................................................................
hFl_ENSPANP00000016353 .............................................................................
hFl_ENSPANP00000016352 .............................................................................
hFl_ENSPANP00000018429 .............................................................................
hFl_ENSPANP00000013579 .............................................................................
hFl_ENSPANP00000000348 .............................................................................
hFl_ENSPANP00000015511 .............................................................................
hFl_ENSPANP00000007718 .............................................................................
hFl_ENSPANP00000011118 .............................................................................
hFl_ENSPANP00000007718 .............................................................................
hFl_ENSPANP00000015642 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000010920 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000003968 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000009443 .............................................................................
hFl_ENSPANP00000011463 .............................................................................
hFl_ENSPANP00000002961 .............................................................................
hFl_ENSPANP00000017623 .............................................................................
hFl_ENSPANP00000011215 .............................................................................
hFl_ENSPANP00000000119 .............................................................................
hFl_ENSPANP00000002418 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000020421 .............................................................................
hFl_ENSPANP00000008387 .............................................................................
hFl_ENSPANP00000005487 .............................................................................
hFl_ENSPANP00000002155 .............................................................................
hFl_ENSPANP00000002567 .............................................................................
hFl_ENSPANP00000019509 .............................................................................
hFl_ENSPANP00000005069 .............................................................................
hFl_ENSPANP00000000052 .............................................................................
hFl_ENSPANP00000005735 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000018982 .............................................................................
hFl_ENSPANP00000018968 .............................................................................
hFl_ENSPANP00000008513 .............................................................................
hFl_ENSPANP00000019509 .............................................................................
hFl_ENSPANP00000006588 .............................................................................
hFl_ENSPANP00000011118 .............................................................................
hFl_ENSPANP00000003166 .............................................................................
hFl_ENSPANP00000004798 .............................................................................
hFl_ENSPANP00000015019 .............................................................................
hFl_ENSPANP00000020573 .............................................................................
hFl_ENSPANP00000004562 .............................................................................
hFl_ENSPANP00000004252 .............................................................................
hFl_ENSPANP00000020003 .............................................................................
hFl_ENSPANP00000006922 .............................................................................
hFl_ENSPANP00000001081 .............................................................................
hFl_ENSPANP00000020426 .............................................................................
hFl_ENSPANP00000014026 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000015639 lsavkdgsilshpalpgteeamfalflqqchflrqaghsekavslfqamvdftffkpdsvkdlptkgqveffepfwd
hFl_ENSPANP00000004438 .............................................................................
hFl_ENSPANP00000015636 lsavkdgsilshpalpgteeamfalflqqchflrqaghsekavslfqamvdftffkpdsvkdlptkgqveffepfwd
hFl_ENSPANP00000006186 .............................................................................
hFl_ENSPANP00000015209 .............................................................................
hFl_ENSPANP00000000119 .............................................................................
hFl_ENSPANP00000011874 .............................................................................
hFl_ENSPANP00000013299 .............................................................................
hFl_ENSPANP00000003968 .............................................................................
hFl_ENSPANP00000005681 .............................................................................
hFl_ENSPANP00000012992 .............................................................................
hFl_ENSPANP00000004384 iffylscvpktqhsktlerfcsimpansglalrllqheweesnvqilklqakmftyniptclatwkiaiaaeivlkg
hFl_ENSPANP00000020572 .............................................................................
hFl_ENSPANP00000006404 .............................................................................
hFl_ENSPANP00000000870 .............................................................................
hFl_ENSPANP00000001745 .............................................................................
hFl_ENSPANP00000011077 .............................................................................
hFl_ENSPANP00000003398 .............................................................................
hFl_ENSPANP00000008218 .............................................................................
hFl_ENSPANP00000010361 .............................................................................
hFl_ENSPANP00000017310 .............................................................................
hFl_ENSPANP00000004678 .............................................................................
hFl_ENSPANP00000005519 .............................................................................
hFl_ENSPANP00000008921 .............................................................................
hFl_ENSPANP00000016699 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000015209 .............................................................................
hFl_ENSPANP00000012305 .............................................................................
hFl_ENSPANP00000018202 .............................................................................


                                                                                                    
                                                                                                    
d1kt1a1                .............................................................................
hFl_ENSPANP00000004835 vdmwkkyiqweksnplrtedqtlitkrvmfayeqcllvlghhpdiwyeaaqyleqsskllaekgdmnnaklf.....
hFl_ENSPANP00000017500 .............................................................................
hFl_ENSPANP00000011496 .............................................................................
hFl_ENSPANP00000005875 clvylgdlsryqnelagvdtel.......................................................
hFl_ENSPANP00000015319 .............................................................................
hFl_ENSPANP00000019493 .............................................................................
hFl_ENSPANP00000015800 ekhkliqeeqilrniihetqmakeaqlgnhqicrlvnqqhslhcqwdqpvryhrgdifenvdyvqfgedsstssmms
hFl_ENSPANP00000017125 .............................................................................
hFl_ENSPANP00000011271 .............................................................................
hFl_ENSPANP00000017151 .............................................................................
hFl_ENSPANP00000007093 .............................................................................
hFl_ENSPANP00000007238 aiplydmeatfaeyeewsedpvpesviqnynkalqqlekykpyeeallqaeaprlseyqayidfemkigdpariqli
hFl_ENSPANP00000007093 .............................................................................
hFl_ENSPANP00000015526 .............................................................................
hFl_ENSPANP00000010410 .............................................................................
hFl_ENSPANP00000004737 .............................................................................
hFl_ENSPANP00000020946 .............................................................................
hFl_ENSPANP00000020864 .............................................................................
hFl_ENSPANP00000007952 .............................................................................
hFl_ENSPANP00000016788 .............................................................................
hFl_ENSPANP00000004737 .............................................................................
hFl_ENSPANP00000004737 .............................................................................
hFl_ENSPANP00000000707 .............................................................................
hFl_ENSPANP00000004108 .............................................................................
hFl_ENSPANP00000016788 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000003166 .............................................................................
hFl_ENSPANP00000003324 .............................................................................
hFl_ENSPANP00000005479 .............................................................................
hFl_ENSPANP00000003528 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000010352 .............................................................................
hFl_ENSPANP00000012491 .............................................................................
hFl_ENSPANP00000014791 .............................................................................
hFl_ENSPANP00000005591 .............................................................................
hFl_ENSPANP00000015348 vteaikndhlrqmererkamaekyimtsakliapvietsfaagydwcvevvkasqyvelandleinkavtylrqkdy
hFl_ENSPANP00000014791 .............................................................................
hFl_ENSPANP00000013486 .............................................................................
hFl_ENSPANP00000015752 .............................................................................
hFl_ENSPANP00000014239 .............................................................................
hFl_ENSPANP00000001617 .............................................................................
hFl_ENSPANP00000017253 .............................................................................
hFl_ENSPANP00000020687 .............................................................................
hFl_ENSPANP00000014947 .............................................................................
hFl_ENSPANP00000015753 .............................................................................
hFl_ENSPANP00000003528 .............................................................................
hFl_ENSPANP00000008218 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000013297 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000007362 .............................................................................
hFl_ENSPANP00000014947 .............................................................................
hFl_ENSPANP00000008383 .............................................................................
hFl_ENSPANP00000017676 .............................................................................
hFl_ENSPANP00000001814 .............................................................................
hFl_ENSPANP00000001168 .............................................................................
hFl_ENSPANP00000003176 .............................................................................
hFl_ENSPANP00000010724 .............................................................................
hFl_ENSPANP00000013376 .............................................................................
hFl_ENSPANP00000013375 .............................................................................
hFl_ENSPANP00000000707 .............................................................................
hFl_ENSPANP00000012992 .............................................................................
hFl_ENSPANP00000020687 .............................................................................
hFl_ENSPANP00000000643 .............................................................................
hFl_ENSPANP00000007559 .............................................................................
hFl_ENSPANP00000003197 .............................................................................
hFl_ENSPANP00000003945 .............................................................................
hFl_ENSPANP00000012699 .............................................................................
hFl_ENSPANP00000004293 .............................................................................
hFl_ENSPANP00000014070 .............................................................................
hFl_ENSPANP00000008096 .............................................................................
hFl_ENSPANP00000014947 .............................................................................
hFl_ENSPANP00000020577 fslgplrkavtlnpdnsyikvflalklqdvhaeaegek.......................................
hFl_ENSPANP00000020573 .............................................................................
hFl_ENSPANP00000015642 .............................................................................
hFl_ENSPANP00000019972 .............................................................................
hFl_ENSPANP00000002155 .............................................................................
hFl_ENSPANP00000003197 .............................................................................
hFl_ENSPANP00000010388 .............................................................................
hFl_ENSPANP00000009536 .............................................................................
hFl_ENSPANP00000013401 .............................................................................
hFl_ENSPANP00000007559 .............................................................................
hFl_ENSPANP00000020038 .............................................................................
hFl_ENSPANP00000020312 tngsataikveapagpgaalsildkfleessklqsdsqepilttqtwdpsinqkpsntfikeiptkkeaskcqdssa
hFl_ENSPANP00000000258 .............................................................................
hFl_ENSPANP00000017676 .............................................................................
hFl_ENSPANP00000006518 .............................................................................
hFl_ENSPANP00000013297 .............................................................................
hFl_ENSPANP00000003504 .............................................................................
hFl_ENSPANP00000017184 .............................................................................
hFl_ENSPANP00000006801 .............................................................................
hFl_ENSPANP00000015190 .............................................................................
hFl_ENSPANP00000001081 .............................................................................
hFl_ENSPANP00000006437 .............................................................................
hFl_ENSPANP00000012699 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000009269 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000019581 .............................................................................
hFl_ENSPANP00000020572 .............................................................................
hFl_ENSPANP00000007217 .............................................................................
hFl_ENSPANP00000020685 .............................................................................
hFl_ENSPANP00000020899 .............................................................................
hFl_ENSPANP00000008387 .............................................................................
hFl_ENSPANP00000010352 .............................................................................
hFl_ENSPANP00000009338 .............................................................................
hFl_ENSPANP00000018160 aihefsgtseevrvtianadlalaqgdieralsilqnvtaeqpyfiearekmadiylkhrkdkmlyitcfrei....
hFl_ENSPANP00000020864 .............................................................................
hFl_ENSPANP00000008387 .............................................................................
hFl_ENSPANP00000009057 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000007915 .............................................................................
hFl_ENSPANP00000003731 gqivspllkqvaviln.............................................................
hFl_ENSPANP00000015625 .............................................................................
hFl_ENSPANP00000014767 .............................................................................
hFl_ENSPANP00000002080 .............................................................................
hFl_ENSPANP00000007403 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000005487 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000013410 .............................................................................
hFl_ENSPANP00000003097 .............................................................................
hFl_ENSPANP00000020575 .............................................................................
hFl_ENSPANP00000007248 .............................................................................
hFl_ENSPANP00000019375 .............................................................................
hFl_ENSPANP00000003854 .............................................................................
hFl_ENSPANP00000006795 .............................................................................
hFl_ENSPANP00000002479 .............................................................................
hFl_ENSPANP00000017125 .............................................................................
hFl_ENSPANP00000005048 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000019375 .............................................................................
hFl_ENSPANP00000014239 .............................................................................
hFl_ENSPANP00000012835 .............................................................................
hFl_ENSPANP00000001460 .............................................................................
hFl_ENSPANP00000015753 .............................................................................
hFl_ENSPANP00000003968 .............................................................................
hFl_ENSPANP00000006868 .............................................................................
hFl_ENSPANP00000001460 .............................................................................
hFl_ENSPANP00000004313 .............................................................................
hFl_ENSPANP00000001617 .............................................................................
hFl_ENSPANP00000019732 .............................................................................
hFl_ENSPANP00000013913 .............................................................................
hFl_ENSPANP00000004649 .............................................................................
hFl_ENSPANP00000013914 .............................................................................
hFl_ENSPANP00000003176 .............................................................................
hFl_ENSPANP00000003166 .............................................................................
hFl_ENSPANP00000015752 .............................................................................
hFl_ENSPANP00000001460 .............................................................................
hFl_ENSPANP00000004498 .............................................................................
hFl_ENSPANP00000014540 .............................................................................
hFl_ENSPANP00000002479 .............................................................................
hFl_ENSPANP00000017858 .............................................................................
hFl_ENSPANP00000007886 .............................................................................
hFl_ENSPANP00000018968 .............................................................................
hFl_ENSPANP00000015642 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000019484 .............................................................................
hFl_ENSPANP00000019485 .............................................................................
hFl_ENSPANP00000020575 .............................................................................
hFl_ENSPANP00000017457 .............................................................................
hFl_ENSPANP00000020575 .............................................................................
hFl_ENSPANP00000004562 .............................................................................
hFl_ENSPANP00000004438 .............................................................................
hFl_ENSPANP00000008640 .............................................................................
hFl_ENSPANP00000020327 .............................................................................
hFl_ENSPANP00000020572 .............................................................................
hFl_ENSPANP00000016643 .............................................................................
hFl_ENSPANP00000006588 .............................................................................
hFl_ENSPANP00000003995 .............................................................................
hFl_ENSPANP00000007718 .............................................................................
hFl_ENSPANP00000004384 .............................................................................
hFl_ENSPANP00000011118 .............................................................................
hFl_ENSPANP00000004252 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000006588 .............................................................................
hFl_ENSPANP00000001745 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000004313 .............................................................................
hFl_ENSPANP00000004562 .............................................................................
hFl_ENSPANP00000001425 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000019118 .............................................................................
hFl_ENSPANP00000015209 .............................................................................
hFl_ENSPANP00000006801 .............................................................................
hFl_ENSPANP00000003551 .............................................................................
hFl_ENSPANP00000004252 .............................................................................
hFl_ENSPANP00000002479 .............................................................................
hFl_ENSPANP00000004798 .............................................................................
hFl_ENSPANP00000000477 .............................................................................
hFl_ENSPANP00000007362 .............................................................................
hFl_ENSPANP00000002485 .............................................................................
hFl_ENSPANP00000014498 .............................................................................
hFl_ENSPANP00000017253 .............................................................................
hFl_ENSPANP00000016353 .............................................................................
hFl_ENSPANP00000016352 .............................................................................
hFl_ENSPANP00000018429 .............................................................................
hFl_ENSPANP00000013579 .............................................................................
hFl_ENSPANP00000000348 .............................................................................
hFl_ENSPANP00000015511 .............................................................................
hFl_ENSPANP00000007718 .............................................................................
hFl_ENSPANP00000011118 .............................................................................
hFl_ENSPANP00000007718 .............................................................................
hFl_ENSPANP00000015642 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000010920 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000003968 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000009443 .............................................................................
hFl_ENSPANP00000011463 .............................................................................
hFl_ENSPANP00000002961 .............................................................................
hFl_ENSPANP00000017623 .............................................................................
hFl_ENSPANP00000011215 .............................................................................
hFl_ENSPANP00000000119 .............................................................................
hFl_ENSPANP00000002418 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000020421 .............................................................................
hFl_ENSPANP00000008387 .............................................................................
hFl_ENSPANP00000005487 .............................................................................
hFl_ENSPANP00000002155 .............................................................................
hFl_ENSPANP00000002567 .............................................................................
hFl_ENSPANP00000019509 .............................................................................
hFl_ENSPANP00000005069 .............................................................................
hFl_ENSPANP00000000052 .............................................................................
hFl_ENSPANP00000005735 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000018982 .............................................................................
hFl_ENSPANP00000018968 .............................................................................
hFl_ENSPANP00000008513 .............................................................................
hFl_ENSPANP00000019509 .............................................................................
hFl_ENSPANP00000006588 .............................................................................
hFl_ENSPANP00000011118 .............................................................................
hFl_ENSPANP00000003166 .............................................................................
hFl_ENSPANP00000004798 .............................................................................
hFl_ENSPANP00000015019 .............................................................................
hFl_ENSPANP00000020573 .............................................................................
hFl_ENSPANP00000004562 .............................................................................
hFl_ENSPANP00000004252 .............................................................................
hFl_ENSPANP00000020003 .............................................................................
hFl_ENSPANP00000006922 .............................................................................
hFl_ENSPANP00000001081 .............................................................................
hFl_ENSPANP00000020426 .............................................................................
hFl_ENSPANP00000014026 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000015639 sgepragekgargwkawmhqqerggwvvinpdedddepeeddqeikdktlprwqiwlaaersrdqrhwrpwrpdktk
hFl_ENSPANP00000004438 .............................................................................
hFl_ENSPANP00000015636 sgepragekgargwkawmhqqerggwvvinpdedddepeeddqeikdktlprwqiwlaaersrdqrhwrpwrpdktk
hFl_ENSPANP00000006186 .............................................................................
hFl_ENSPANP00000015209 .............................................................................
hFl_ENSPANP00000000119 .............................................................................
hFl_ENSPANP00000011874 .............................................................................
hFl_ENSPANP00000013299 .............................................................................
hFl_ENSPANP00000003968 .............................................................................
hFl_ENSPANP00000005681 .............................................................................
hFl_ENSPANP00000012992 .............................................................................
hFl_ENSPANP00000004384 qrevh........................................................................
hFl_ENSPANP00000020572 .............................................................................
hFl_ENSPANP00000006404 .............................................................................
hFl_ENSPANP00000000870 .............................................................................
hFl_ENSPANP00000001745 .............................................................................
hFl_ENSPANP00000011077 .............................................................................
hFl_ENSPANP00000003398 .............................................................................
hFl_ENSPANP00000008218 .............................................................................
hFl_ENSPANP00000010361 .............................................................................
hFl_ENSPANP00000017310 .............................................................................
hFl_ENSPANP00000004678 .............................................................................
hFl_ENSPANP00000005519 .............................................................................
hFl_ENSPANP00000008921 .............................................................................
hFl_ENSPANP00000016699 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000015209 .............................................................................
hFl_ENSPANP00000012305 .............................................................................
hFl_ENSPANP00000018202 .............................................................................


                                                                                                    
                                                                                                    
d1kt1a1                .............................................................................
hFl_ENSPANP00000004835 .............................................................................
hFl_ENSPANP00000017500 .............................................................................
hFl_ENSPANP00000011496 .............................................................................
hFl_ENSPANP00000005875 .............................................................................
hFl_ENSPANP00000015319 .............................................................................
hFl_ENSPANP00000019493 .............................................................................
hFl_ENSPANP00000015800 vnfdvqsnqsdindsvksspvahsilwiwgrdsdayrdkqhilwpkradctesyprvpvggelptyflppenkglri
hFl_ENSPANP00000017125 .............................................................................
hFl_ENSPANP00000011271 .............................................................................
hFl_ENSPANP00000017151 .............................................................................
hFl_ENSPANP00000007093 .............................................................................
hFl_ENSPANP00000007238 feralvenclvpdlwirysqyldrqlkvkdlvlsvhnravrncpwtvalwsryllamerhgvdhqvisvtfekalna
hFl_ENSPANP00000007093 .............................................................................
hFl_ENSPANP00000015526 .............................................................................
hFl_ENSPANP00000010410 .............................................................................
hFl_ENSPANP00000004737 .............................................................................
hFl_ENSPANP00000020946 .............................................................................
hFl_ENSPANP00000020864 .............................................................................
hFl_ENSPANP00000007952 .............................................................................
hFl_ENSPANP00000016788 .............................................................................
hFl_ENSPANP00000004737 .............................................................................
hFl_ENSPANP00000004737 .............................................................................
hFl_ENSPANP00000000707 .............................................................................
hFl_ENSPANP00000004108 .............................................................................
hFl_ENSPANP00000016788 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000003166 .............................................................................
hFl_ENSPANP00000003324 .............................................................................
hFl_ENSPANP00000005479 .............................................................................
hFl_ENSPANP00000003528 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000010352 .............................................................................
hFl_ENSPANP00000012491 .............................................................................
hFl_ENSPANP00000014791 .............................................................................
hFl_ENSPANP00000005591 .............................................................................
hFl_ENSPANP00000015348 nqaveilkmlekkdsrvksaaatnlsalyymgkdfaqassya...................................
hFl_ENSPANP00000014791 .............................................................................
hFl_ENSPANP00000013486 .............................................................................
hFl_ENSPANP00000015752 .............................................................................
hFl_ENSPANP00000014239 .............................................................................
hFl_ENSPANP00000001617 .............................................................................
hFl_ENSPANP00000017253 .............................................................................
hFl_ENSPANP00000020687 .............................................................................
hFl_ENSPANP00000014947 .............................................................................
hFl_ENSPANP00000015753 .............................................................................
hFl_ENSPANP00000003528 .............................................................................
hFl_ENSPANP00000008218 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000013297 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000007362 .............................................................................
hFl_ENSPANP00000014947 .............................................................................
hFl_ENSPANP00000008383 .............................................................................
hFl_ENSPANP00000017676 .............................................................................
hFl_ENSPANP00000001814 .............................................................................
hFl_ENSPANP00000001168 .............................................................................
hFl_ENSPANP00000003176 .............................................................................
hFl_ENSPANP00000010724 .............................................................................
hFl_ENSPANP00000013376 .............................................................................
hFl_ENSPANP00000013375 .............................................................................
hFl_ENSPANP00000000707 .............................................................................
hFl_ENSPANP00000012992 .............................................................................
hFl_ENSPANP00000020687 .............................................................................
hFl_ENSPANP00000000643 .............................................................................
hFl_ENSPANP00000007559 .............................................................................
hFl_ENSPANP00000003197 .............................................................................
hFl_ENSPANP00000003945 .............................................................................
hFl_ENSPANP00000012699 .............................................................................
hFl_ENSPANP00000004293 .............................................................................
hFl_ENSPANP00000014070 .............................................................................
hFl_ENSPANP00000008096 .............................................................................
hFl_ENSPANP00000014947 .............................................................................
hFl_ENSPANP00000020577 .............................................................................
hFl_ENSPANP00000020573 .............................................................................
hFl_ENSPANP00000015642 .............................................................................
hFl_ENSPANP00000019972 .............................................................................
hFl_ENSPANP00000002155 .............................................................................
hFl_ENSPANP00000003197 .............................................................................
hFl_ENSPANP00000010388 .............................................................................
hFl_ENSPANP00000009536 .............................................................................
hFl_ENSPANP00000013401 .............................................................................
hFl_ENSPANP00000007559 .............................................................................
hFl_ENSPANP00000020038 .............................................................................
hFl_ENSPANP00000020312 flhpglhygvsqtttifmetirflmkvkavqyvhrvlahellcpqggpsceyylvlaqthilkkdfakae.......
hFl_ENSPANP00000000258 .............................................................................
hFl_ENSPANP00000017676 .............................................................................
hFl_ENSPANP00000006518 .............................................................................
hFl_ENSPANP00000013297 .............................................................................
hFl_ENSPANP00000003504 .............................................................................
hFl_ENSPANP00000017184 .............................................................................
hFl_ENSPANP00000006801 .............................................................................
hFl_ENSPANP00000015190 .............................................................................
hFl_ENSPANP00000001081 .............................................................................
hFl_ENSPANP00000006437 .............................................................................
hFl_ENSPANP00000012699 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000009269 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000019581 .............................................................................
hFl_ENSPANP00000020572 .............................................................................
hFl_ENSPANP00000007217 .............................................................................
hFl_ENSPANP00000020685 .............................................................................
hFl_ENSPANP00000020899 .............................................................................
hFl_ENSPANP00000008387 .............................................................................
hFl_ENSPANP00000010352 .............................................................................
hFl_ENSPANP00000009338 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000020864 .............................................................................
hFl_ENSPANP00000008387 .............................................................................
hFl_ENSPANP00000009057 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000007915 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000015625 .............................................................................
hFl_ENSPANP00000014767 .............................................................................
hFl_ENSPANP00000002080 .............................................................................
hFl_ENSPANP00000007403 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000005487 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000013410 .............................................................................
hFl_ENSPANP00000003097 .............................................................................
hFl_ENSPANP00000020575 .............................................................................
hFl_ENSPANP00000007248 .............................................................................
hFl_ENSPANP00000019375 .............................................................................
hFl_ENSPANP00000003854 .............................................................................
hFl_ENSPANP00000006795 .............................................................................
hFl_ENSPANP00000002479 .............................................................................
hFl_ENSPANP00000017125 .............................................................................
hFl_ENSPANP00000005048 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000019375 .............................................................................
hFl_ENSPANP00000014239 .............................................................................
hFl_ENSPANP00000012835 .............................................................................
hFl_ENSPANP00000001460 .............................................................................
hFl_ENSPANP00000015753 .............................................................................
hFl_ENSPANP00000003968 .............................................................................
hFl_ENSPANP00000006868 .............................................................................
hFl_ENSPANP00000001460 .............................................................................
hFl_ENSPANP00000004313 .............................................................................
hFl_ENSPANP00000001617 .............................................................................
hFl_ENSPANP00000019732 .............................................................................
hFl_ENSPANP00000013913 .............................................................................
hFl_ENSPANP00000004649 .............................................................................
hFl_ENSPANP00000013914 .............................................................................
hFl_ENSPANP00000003176 .............................................................................
hFl_ENSPANP00000003166 .............................................................................
hFl_ENSPANP00000015752 .............................................................................
hFl_ENSPANP00000001460 .............................................................................
hFl_ENSPANP00000004498 .............................................................................
hFl_ENSPANP00000014540 .............................................................................
hFl_ENSPANP00000002479 .............................................................................
hFl_ENSPANP00000017858 .............................................................................
hFl_ENSPANP00000007886 .............................................................................
hFl_ENSPANP00000018968 .............................................................................
hFl_ENSPANP00000015642 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000019484 .............................................................................
hFl_ENSPANP00000019485 .............................................................................
hFl_ENSPANP00000020575 .............................................................................
hFl_ENSPANP00000017457 .............................................................................
hFl_ENSPANP00000020575 .............................................................................
hFl_ENSPANP00000004562 .............................................................................
hFl_ENSPANP00000004438 .............................................................................
hFl_ENSPANP00000008640 .............................................................................
hFl_ENSPANP00000020327 .............................................................................
hFl_ENSPANP00000020572 .............................................................................
hFl_ENSPANP00000016643 .............................................................................
hFl_ENSPANP00000006588 .............................................................................
hFl_ENSPANP00000003995 .............................................................................
hFl_ENSPANP00000007718 .............................................................................
hFl_ENSPANP00000004384 .............................................................................
hFl_ENSPANP00000011118 .............................................................................
hFl_ENSPANP00000004252 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000006588 .............................................................................
hFl_ENSPANP00000001745 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000004313 .............................................................................
hFl_ENSPANP00000004562 .............................................................................
hFl_ENSPANP00000001425 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000019118 .............................................................................
hFl_ENSPANP00000015209 .............................................................................
hFl_ENSPANP00000006801 .............................................................................
hFl_ENSPANP00000003551 .............................................................................
hFl_ENSPANP00000004252 .............................................................................
hFl_ENSPANP00000002479 .............................................................................
hFl_ENSPANP00000004798 .............................................................................
hFl_ENSPANP00000000477 .............................................................................
hFl_ENSPANP00000007362 .............................................................................
hFl_ENSPANP00000002485 .............................................................................
hFl_ENSPANP00000014498 .............................................................................
hFl_ENSPANP00000017253 .............................................................................
hFl_ENSPANP00000016353 .............................................................................
hFl_ENSPANP00000016352 .............................................................................
hFl_ENSPANP00000018429 .............................................................................
hFl_ENSPANP00000013579 .............................................................................
hFl_ENSPANP00000000348 .............................................................................
hFl_ENSPANP00000015511 .............................................................................
hFl_ENSPANP00000007718 .............................................................................
hFl_ENSPANP00000011118 .............................................................................
hFl_ENSPANP00000007718 .............................................................................
hFl_ENSPANP00000015642 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000010920 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000003968 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000009443 .............................................................................
hFl_ENSPANP00000011463 .............................................................................
hFl_ENSPANP00000002961 .............................................................................
hFl_ENSPANP00000017623 .............................................................................
hFl_ENSPANP00000011215 .............................................................................
hFl_ENSPANP00000000119 .............................................................................
hFl_ENSPANP00000002418 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000020421 .............................................................................
hFl_ENSPANP00000008387 .............................................................................
hFl_ENSPANP00000005487 .............................................................................
hFl_ENSPANP00000002155 .............................................................................
hFl_ENSPANP00000002567 .............................................................................
hFl_ENSPANP00000019509 .............................................................................
hFl_ENSPANP00000005069 .............................................................................
hFl_ENSPANP00000000052 .............................................................................
hFl_ENSPANP00000005735 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000018982 .............................................................................
hFl_ENSPANP00000018968 .............................................................................
hFl_ENSPANP00000008513 .............................................................................
hFl_ENSPANP00000019509 .............................................................................
hFl_ENSPANP00000006588 .............................................................................
hFl_ENSPANP00000011118 .............................................................................
hFl_ENSPANP00000003166 .............................................................................
hFl_ENSPANP00000004798 .............................................................................
hFl_ENSPANP00000015019 .............................................................................
hFl_ENSPANP00000020573 .............................................................................
hFl_ENSPANP00000004562 .............................................................................
hFl_ENSPANP00000004252 .............................................................................
hFl_ENSPANP00000020003 .............................................................................
hFl_ENSPANP00000006922 .............................................................................
hFl_ENSPANP00000001081 .............................................................................
hFl_ENSPANP00000020426 .............................................................................
hFl_ENSPANP00000014026 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000015639 kqteedcedperqvlfddigqslirlsshnlqfqlveaflqflgvpsgltppasclylamdensifdnglydekplt
hFl_ENSPANP00000004438 .............................................................................
hFl_ENSPANP00000015636 kqteedcedperqvlfddigqslirlsshnlqfqlveaflqflgvpsgltppasclylamdensifdnglydekplt
hFl_ENSPANP00000006186 .............................................................................
hFl_ENSPANP00000015209 .............................................................................
hFl_ENSPANP00000000119 .............................................................................
hFl_ENSPANP00000011874 .............................................................................
hFl_ENSPANP00000013299 .............................................................................
hFl_ENSPANP00000003968 .............................................................................
hFl_ENSPANP00000005681 .............................................................................
hFl_ENSPANP00000012992 .............................................................................
hFl_ENSPANP00000004384 .............................................................................
hFl_ENSPANP00000020572 .............................................................................
hFl_ENSPANP00000006404 .............................................................................
hFl_ENSPANP00000000870 .............................................................................
hFl_ENSPANP00000001745 .............................................................................
hFl_ENSPANP00000011077 .............................................................................
hFl_ENSPANP00000003398 .............................................................................
hFl_ENSPANP00000008218 .............................................................................
hFl_ENSPANP00000010361 .............................................................................
hFl_ENSPANP00000017310 .............................................................................
hFl_ENSPANP00000004678 .............................................................................
hFl_ENSPANP00000005519 .............................................................................
hFl_ENSPANP00000008921 .............................................................................
hFl_ENSPANP00000016699 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000015209 .............................................................................
hFl_ENSPANP00000012305 .............................................................................
hFl_ENSPANP00000018202 .............................................................................


                                                                                                    
                                                                                                    
d1kt1a1                .............................................................................
hFl_ENSPANP00000004835 .............................................................................
hFl_ENSPANP00000017500 .............................................................................
hFl_ENSPANP00000011496 .............................................................................
hFl_ENSPANP00000005875 .............................................................................
hFl_ENSPANP00000015319 .............................................................................
hFl_ENSPANP00000019493 .............................................................................
hFl_ENSPANP00000015800 helssddysteeeaqtpdcsitdfrkshtlsylvkelevrmdlkakmpddharkillsrinnytvpeeeigsflfha
hFl_ENSPANP00000017125 .............................................................................
hFl_ENSPANP00000011271 .............................................................................
hFl_ENSPANP00000017151 .............................................................................
hFl_ENSPANP00000007093 .............................................................................
hFl_ENSPANP00000007238 gfiqatdyveiwqayldylrrrvdfkqdsskeleel.........................................
hFl_ENSPANP00000007093 .............................................................................
hFl_ENSPANP00000015526 .............................................................................
hFl_ENSPANP00000010410 .............................................................................
hFl_ENSPANP00000004737 .............................................................................
hFl_ENSPANP00000020946 .............................................................................
hFl_ENSPANP00000020864 .............................................................................
hFl_ENSPANP00000007952 .............................................................................
hFl_ENSPANP00000016788 .............................................................................
hFl_ENSPANP00000004737 .............................................................................
hFl_ENSPANP00000004737 .............................................................................
hFl_ENSPANP00000000707 .............................................................................
hFl_ENSPANP00000004108 .............................................................................
hFl_ENSPANP00000016788 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000003166 .............................................................................
hFl_ENSPANP00000003324 .............................................................................
hFl_ENSPANP00000005479 .............................................................................
hFl_ENSPANP00000003528 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000010352 .............................................................................
hFl_ENSPANP00000012491 .............................................................................
hFl_ENSPANP00000014791 .............................................................................
hFl_ENSPANP00000005591 .............................................................................
hFl_ENSPANP00000015348 .............................................................................
hFl_ENSPANP00000014791 .............................................................................
hFl_ENSPANP00000013486 .............................................................................
hFl_ENSPANP00000015752 .............................................................................
hFl_ENSPANP00000014239 .............................................................................
hFl_ENSPANP00000001617 .............................................................................
hFl_ENSPANP00000017253 .............................................................................
hFl_ENSPANP00000020687 .............................................................................
hFl_ENSPANP00000014947 .............................................................................
hFl_ENSPANP00000015753 .............................................................................
hFl_ENSPANP00000003528 .............................................................................
hFl_ENSPANP00000008218 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000013297 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000007362 .............................................................................
hFl_ENSPANP00000014947 .............................................................................
hFl_ENSPANP00000008383 .............................................................................
hFl_ENSPANP00000017676 .............................................................................
hFl_ENSPANP00000001814 .............................................................................
hFl_ENSPANP00000001168 .............................................................................
hFl_ENSPANP00000003176 .............................................................................
hFl_ENSPANP00000010724 .............................................................................
hFl_ENSPANP00000013376 .............................................................................
hFl_ENSPANP00000013375 .............................................................................
hFl_ENSPANP00000000707 .............................................................................
hFl_ENSPANP00000012992 .............................................................................
hFl_ENSPANP00000020687 .............................................................................
hFl_ENSPANP00000000643 .............................................................................
hFl_ENSPANP00000007559 .............................................................................
hFl_ENSPANP00000003197 .............................................................................
hFl_ENSPANP00000003945 .............................................................................
hFl_ENSPANP00000012699 .............................................................................
hFl_ENSPANP00000004293 .............................................................................
hFl_ENSPANP00000014070 .............................................................................
hFl_ENSPANP00000008096 .............................................................................
hFl_ENSPANP00000014947 .............................................................................
hFl_ENSPANP00000020577 .............................................................................
hFl_ENSPANP00000020573 .............................................................................
hFl_ENSPANP00000015642 .............................................................................
hFl_ENSPANP00000019972 .............................................................................
hFl_ENSPANP00000002155 .............................................................................
hFl_ENSPANP00000003197 .............................................................................
hFl_ENSPANP00000010388 .............................................................................
hFl_ENSPANP00000009536 .............................................................................
hFl_ENSPANP00000013401 .............................................................................
hFl_ENSPANP00000007559 .............................................................................
hFl_ENSPANP00000020038 .............................................................................
hFl_ENSPANP00000020312 .............................................................................
hFl_ENSPANP00000000258 .............................................................................
hFl_ENSPANP00000017676 .............................................................................
hFl_ENSPANP00000006518 .............................................................................
hFl_ENSPANP00000013297 .............................................................................
hFl_ENSPANP00000003504 .............................................................................
hFl_ENSPANP00000017184 .............................................................................
hFl_ENSPANP00000006801 .............................................................................
hFl_ENSPANP00000015190 .............................................................................
hFl_ENSPANP00000001081 .............................................................................
hFl_ENSPANP00000006437 .............................................................................
hFl_ENSPANP00000012699 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000009269 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000019581 .............................................................................
hFl_ENSPANP00000020572 .............................................................................
hFl_ENSPANP00000007217 .............................................................................
hFl_ENSPANP00000020685 .............................................................................
hFl_ENSPANP00000020899 .............................................................................
hFl_ENSPANP00000008387 .............................................................................
hFl_ENSPANP00000010352 .............................................................................
hFl_ENSPANP00000009338 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000020864 .............................................................................
hFl_ENSPANP00000008387 .............................................................................
hFl_ENSPANP00000009057 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000007915 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000015625 .............................................................................
hFl_ENSPANP00000014767 .............................................................................
hFl_ENSPANP00000002080 .............................................................................
hFl_ENSPANP00000007403 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000005487 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000013410 .............................................................................
hFl_ENSPANP00000003097 .............................................................................
hFl_ENSPANP00000020575 .............................................................................
hFl_ENSPANP00000007248 .............................................................................
hFl_ENSPANP00000019375 .............................................................................
hFl_ENSPANP00000003854 .............................................................................
hFl_ENSPANP00000006795 .............................................................................
hFl_ENSPANP00000002479 .............................................................................
hFl_ENSPANP00000017125 .............................................................................
hFl_ENSPANP00000005048 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000019375 .............................................................................
hFl_ENSPANP00000014239 .............................................................................
hFl_ENSPANP00000012835 .............................................................................
hFl_ENSPANP00000001460 .............................................................................
hFl_ENSPANP00000015753 .............................................................................
hFl_ENSPANP00000003968 .............................................................................
hFl_ENSPANP00000006868 .............................................................................
hFl_ENSPANP00000001460 .............................................................................
hFl_ENSPANP00000004313 .............................................................................
hFl_ENSPANP00000001617 .............................................................................
hFl_ENSPANP00000019732 .............................................................................
hFl_ENSPANP00000013913 .............................................................................
hFl_ENSPANP00000004649 .............................................................................
hFl_ENSPANP00000013914 .............................................................................
hFl_ENSPANP00000003176 .............................................................................
hFl_ENSPANP00000003166 .............................................................................
hFl_ENSPANP00000015752 .............................................................................
hFl_ENSPANP00000001460 .............................................................................
hFl_ENSPANP00000004498 .............................................................................
hFl_ENSPANP00000014540 .............................................................................
hFl_ENSPANP00000002479 .............................................................................
hFl_ENSPANP00000017858 .............................................................................
hFl_ENSPANP00000007886 .............................................................................
hFl_ENSPANP00000018968 .............................................................................
hFl_ENSPANP00000015642 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000019484 .............................................................................
hFl_ENSPANP00000019485 .............................................................................
hFl_ENSPANP00000020575 .............................................................................
hFl_ENSPANP00000017457 .............................................................................
hFl_ENSPANP00000020575 .............................................................................
hFl_ENSPANP00000004562 .............................................................................
hFl_ENSPANP00000004438 .............................................................................
hFl_ENSPANP00000008640 .............................................................................
hFl_ENSPANP00000020327 .............................................................................
hFl_ENSPANP00000020572 .............................................................................
hFl_ENSPANP00000016643 .............................................................................
hFl_ENSPANP00000006588 .............................................................................
hFl_ENSPANP00000003995 .............................................................................
hFl_ENSPANP00000007718 .............................................................................
hFl_ENSPANP00000004384 .............................................................................
hFl_ENSPANP00000011118 .............................................................................
hFl_ENSPANP00000004252 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000006588 .............................................................................
hFl_ENSPANP00000001745 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000004313 .............................................................................
hFl_ENSPANP00000004562 .............................................................................
hFl_ENSPANP00000001425 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000019118 .............................................................................
hFl_ENSPANP00000015209 .............................................................................
hFl_ENSPANP00000006801 .............................................................................
hFl_ENSPANP00000003551 .............................................................................
hFl_ENSPANP00000004252 .............................................................................
hFl_ENSPANP00000002479 .............................................................................
hFl_ENSPANP00000004798 .............................................................................
hFl_ENSPANP00000000477 .............................................................................
hFl_ENSPANP00000007362 .............................................................................
hFl_ENSPANP00000002485 .............................................................................
hFl_ENSPANP00000014498 .............................................................................
hFl_ENSPANP00000017253 .............................................................................
hFl_ENSPANP00000016353 .............................................................................
hFl_ENSPANP00000016352 .............................................................................
hFl_ENSPANP00000018429 .............................................................................
hFl_ENSPANP00000013579 .............................................................................
hFl_ENSPANP00000000348 .............................................................................
hFl_ENSPANP00000015511 .............................................................................
hFl_ENSPANP00000007718 .............................................................................
hFl_ENSPANP00000011118 .............................................................................
hFl_ENSPANP00000007718 .............................................................................
hFl_ENSPANP00000015642 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000010920 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000003968 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000009443 .............................................................................
hFl_ENSPANP00000011463 .............................................................................
hFl_ENSPANP00000002961 .............................................................................
hFl_ENSPANP00000017623 .............................................................................
hFl_ENSPANP00000011215 .............................................................................
hFl_ENSPANP00000000119 .............................................................................
hFl_ENSPANP00000002418 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000020421 .............................................................................
hFl_ENSPANP00000008387 .............................................................................
hFl_ENSPANP00000005487 .............................................................................
hFl_ENSPANP00000002155 .............................................................................
hFl_ENSPANP00000002567 .............................................................................
hFl_ENSPANP00000019509 .............................................................................
hFl_ENSPANP00000005069 .............................................................................
hFl_ENSPANP00000000052 .............................................................................
hFl_ENSPANP00000005735 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000018982 .............................................................................
hFl_ENSPANP00000018968 .............................................................................
hFl_ENSPANP00000008513 .............................................................................
hFl_ENSPANP00000019509 .............................................................................
hFl_ENSPANP00000006588 .............................................................................
hFl_ENSPANP00000011118 .............................................................................
hFl_ENSPANP00000003166 .............................................................................
hFl_ENSPANP00000004798 .............................................................................
hFl_ENSPANP00000015019 .............................................................................
hFl_ENSPANP00000020573 .............................................................................
hFl_ENSPANP00000004562 .............................................................................
hFl_ENSPANP00000004252 .............................................................................
hFl_ENSPANP00000020003 .............................................................................
hFl_ENSPANP00000006922 .............................................................................
hFl_ENSPANP00000001081 .............................................................................
hFl_ENSPANP00000020426 .............................................................................
hFl_ENSPANP00000014026 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000015639 ffnpsfsgascvgrmdrlgcprwtrgqnregeefirnvfhlvmplfsgkeksqlcfswlqyeiakviwclhtknkkr
hFl_ENSPANP00000004438 .............................................................................
hFl_ENSPANP00000015636 ffnpsfsgascvgrmdrlgcprwtrgqnregeefirnvfhlvmplfsgkeksqlcfswlqyeiakviwclhtknkkr
hFl_ENSPANP00000006186 .............................................................................
hFl_ENSPANP00000015209 .............................................................................
hFl_ENSPANP00000000119 .............................................................................
hFl_ENSPANP00000011874 .............................................................................
hFl_ENSPANP00000013299 .............................................................................
hFl_ENSPANP00000003968 .............................................................................
hFl_ENSPANP00000005681 .............................................................................
hFl_ENSPANP00000012992 .............................................................................
hFl_ENSPANP00000004384 .............................................................................
hFl_ENSPANP00000020572 .............................................................................
hFl_ENSPANP00000006404 .............................................................................
hFl_ENSPANP00000000870 .............................................................................
hFl_ENSPANP00000001745 .............................................................................
hFl_ENSPANP00000011077 .............................................................................
hFl_ENSPANP00000003398 .............................................................................
hFl_ENSPANP00000008218 .............................................................................
hFl_ENSPANP00000010361 .............................................................................
hFl_ENSPANP00000017310 .............................................................................
hFl_ENSPANP00000004678 .............................................................................
hFl_ENSPANP00000005519 .............................................................................
hFl_ENSPANP00000008921 .............................................................................
hFl_ENSPANP00000016699 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000015209 .............................................................................
hFl_ENSPANP00000012305 .............................................................................
hFl_ENSPANP00000018202 .............................................................................


                                                                                                  10
                                                                                                   |
d1kt1a1                ...................................................................--SWEMDTKE
hFl_ENSPANP00000004835 ...................................................................----------
hFl_ENSPANP00000017500 ...................................................................----------
hFl_ENSPANP00000011496 ...................................................................---FEAAVQQ
hFl_ENSPANP00000005875 ...................................................................----------
hFl_ENSPANP00000015319 ...................................................................----EAAILQ
hFl_ENSPANP00000019493 ...................................................................----------
hFl_ENSPANP00000015800 inkpnapvwlilneaglywravgnstfaiaclqralnlaplqyqdvplvnlanllihyglhldatkl---LLQALAI
hFl_ENSPANP00000017125 ...................................................................----------
hFl_ENSPANP00000011271 ...................................................................----------
hFl_ENSPANP00000017151 ...................................................................----------
hFl_ENSPANP00000007093 ...................................................................----------
hFl_ENSPANP00000007238 ...................................................................----------
hFl_ENSPANP00000007093 ...................................................................-----LAIKQ
hFl_ENSPANP00000015526 ...................................................................----------
hFl_ENSPANP00000010410 ...................................................................----------
hFl_ENSPANP00000004737 ...................................................................----------
hFl_ENSPANP00000020946 ...................................................................----------
hFl_ENSPANP00000020864 ...................................................................IKFFQRAIQV
hFl_ENSPANP00000007952 ...................................................................--LFRSALSV
hFl_ENSPANP00000016788 ...................................................................----------
hFl_ENSPANP00000004737 ...................................................................----------
hFl_ENSPANP00000004737 ...................................................................----------
hFl_ENSPANP00000000707 ...................................................................----------
hFl_ENSPANP00000004108 ...................................................................----------
hFl_ENSPANP00000016788 ...................................................................----------
hFl_ENSPANP00000015646 ...................................................................----------
hFl_ENSPANP00000015647 ...................................................................----------
hFl_ENSPANP00000003166 ...................................................................----------
hFl_ENSPANP00000003324 ...................................................................---------E
hFl_ENSPANP00000005479 ...................................................................---WEMNSEE
hFl_ENSPANP00000003528 ...................................................................----------
hFl_ENSPANP00000015647 ...................................................................----------
hFl_ENSPANP00000014391 ...................................................................--LCEEALRH
hFl_ENSPANP00000015646 ...................................................................----------
hFl_ENSPANP00000015646 ...................................................................---------E
hFl_ENSPANP00000015647 ...................................................................---------E
hFl_ENSPANP00000010352 ...................................................................----MSALKV
hFl_ENSPANP00000012491 ...................................................................---WEMDTKE
hFl_ENSPANP00000014791 ...................................................................----------
hFl_ENSPANP00000005591 ...................................................................----------
hFl_ENSPANP00000015348 ...................................................................----DIAVNS
hFl_ENSPANP00000014791 ...................................................................----------
hFl_ENSPANP00000013486 ...................................................................----------
hFl_ENSPANP00000015752 ...................................................................----------
hFl_ENSPANP00000014239 ...................................................................IEIYKKAVEF
hFl_ENSPANP00000001617 ...................................................................----------
hFl_ENSPANP00000017253 ...................................................................-EQLQEALKV
hFl_ENSPANP00000020687 ...................................................................--YYTKAIDM
hFl_ENSPANP00000014947 ...................................................................----------
hFl_ENSPANP00000015753 ...................................................................----------
hFl_ENSPANP00000003528 ...................................................................----------
hFl_ENSPANP00000008218 ...................................................................-----QGLDK
hFl_ENSPANP00000015646 ...................................................................----------
hFl_ENSPANP00000013297 ...................................................................----------
hFl_ENSPANP00000015647 ...................................................................----------
hFl_ENSPANP00000007362 ...................................................................----------
hFl_ENSPANP00000014947 ...................................................................----------
hFl_ENSPANP00000008383 ...................................................................----------
hFl_ENSPANP00000017676 ...................................................................----------
hFl_ENSPANP00000001814 ...................................................................----------
hFl_ENSPANP00000001168 ...................................................................----------
hFl_ENSPANP00000003176 ...................................................................----------
hFl_ENSPANP00000010724 ...................................................................----------
hFl_ENSPANP00000013376 ...................................................................----------
hFl_ENSPANP00000013375 ...................................................................----------
hFl_ENSPANP00000000707 ...................................................................----------
hFl_ENSPANP00000012992 ...................................................................----------
hFl_ENSPANP00000020687 ...................................................................----------
hFl_ENSPANP00000000643 ...................................................................----------
hFl_ENSPANP00000007559 ...................................................................----------
hFl_ENSPANP00000003197 ...................................................................----------
hFl_ENSPANP00000003945 ...................................................................----------
hFl_ENSPANP00000012699 ...................................................................----------
hFl_ENSPANP00000004293 ...................................................................----------
hFl_ENSPANP00000014070 ...................................................................--------KE
hFl_ENSPANP00000008096 ...................................................................---LTKVIQL
hFl_ENSPANP00000014947 ...................................................................----------
hFl_ENSPANP00000020577 ...................................................................--YIEEILDQ
hFl_ENSPANP00000020573 ...................................................................----------
hFl_ENSPANP00000015642 ...................................................................----------
hFl_ENSPANP00000019972 ...................................................................----------
hFl_ENSPANP00000002155 ...................................................................----------
hFl_ENSPANP00000003197 ...................................................................-QDFNMAADI
hFl_ENSPANP00000010388 ...................................................................----------
hFl_ENSPANP00000009536 ...................................................................----------
hFl_ENSPANP00000013401 ...................................................................----------
hFl_ENSPANP00000007559 ...................................................................----------
hFl_ENSPANP00000020038 ...................................................................----------
hFl_ENSPANP00000020312 ...................................................................-EYLQQAAQM
hFl_ENSPANP00000000258 ...................................................................----------
hFl_ENSPANP00000017676 ...................................................................----------
hFl_ENSPANP00000006518 ...................................................................----------
hFl_ENSPANP00000013297 ...................................................................----------
hFl_ENSPANP00000003504 ...................................................................----------
hFl_ENSPANP00000017184 ...................................................................----------
hFl_ENSPANP00000006801 ...................................................................----------
hFl_ENSPANP00000015190 ...................................................................----------
hFl_ENSPANP00000001081 ...................................................................----------
hFl_ENSPANP00000006437 ...................................................................----RKGLRN
hFl_ENSPANP00000012699 ...................................................................----------
hFl_ENSPANP00000007476 ...................................................................----------
hFl_ENSPANP00000009269 ...................................................................----------
hFl_ENSPANP00000014391 ...................................................................----------
hFl_ENSPANP00000019581 ...................................................................----------
hFl_ENSPANP00000020572 ...................................................................--CFEKALEK
hFl_ENSPANP00000007217 ...................................................................----------
hFl_ENSPANP00000020685 ...................................................................----------
hFl_ENSPANP00000020899 ...................................................................----------
hFl_ENSPANP00000008387 ...................................................................----------
hFl_ENSPANP00000010352 ...................................................................-------INE
hFl_ENSPANP00000009338 ...................................................................-------LDS
hFl_ENSPANP00000018160 ...................................................................--------AE
hFl_ENSPANP00000020864 ...................................................................----------
hFl_ENSPANP00000008387 ...................................................................----------
hFl_ENSPANP00000009057 ...................................................................----------
hFl_ENSPANP00000018160 ...................................................................----------
hFl_ENSPANP00000007915 ...................................................................----------
hFl_ENSPANP00000003731 ...................................................................-----PVVKA
hFl_ENSPANP00000015625 ...................................................................----------
hFl_ENSPANP00000014767 ...................................................................----------
hFl_ENSPANP00000002080 ...................................................................----------
hFl_ENSPANP00000007403 ...................................................................----------
hFl_ENSPANP00000007476 ...................................................................----------
hFl_ENSPANP00000005487 ...................................................................----------
hFl_ENSPANP00000003731 ...................................................................----------
hFl_ENSPANP00000013410 ...................................................................----------
hFl_ENSPANP00000003097 ...................................................................----------
hFl_ENSPANP00000020575 ...................................................................-----QAVSL
hFl_ENSPANP00000007248 ...................................................................----------
hFl_ENSPANP00000019375 ...................................................................----------
hFl_ENSPANP00000003854 ...................................................................----------
hFl_ENSPANP00000006795 ...................................................................----------
hFl_ENSPANP00000002479 ...................................................................----------
hFl_ENSPANP00000017125 ...................................................................----------
hFl_ENSPANP00000005048 ...................................................................-----ELRRQ
hFl_ENSPANP00000003731 ...................................................................----------
hFl_ENSPANP00000018160 ...................................................................----------
hFl_ENSPANP00000019375 ...................................................................----------
hFl_ENSPANP00000014239 ...................................................................--LFQTCAVL
hFl_ENSPANP00000012835 ...................................................................----------
hFl_ENSPANP00000001460 ...................................................................----------
hFl_ENSPANP00000015753 ...................................................................----------
hFl_ENSPANP00000003968 ...................................................................---VNKILQI
hFl_ENSPANP00000006868 ...................................................................----------
hFl_ENSPANP00000001460 ...................................................................--YIEEALTS
hFl_ENSPANP00000004313 ...................................................................----------
hFl_ENSPANP00000001617 ...................................................................----------
hFl_ENSPANP00000019732 ...................................................................----------
hFl_ENSPANP00000013913 ...................................................................----------
hFl_ENSPANP00000004649 ...................................................................----------
hFl_ENSPANP00000013914 ...................................................................----------
hFl_ENSPANP00000003176 ...................................................................----------
hFl_ENSPANP00000003166 ...................................................................---YKQVLRN
hFl_ENSPANP00000015752 ...................................................................----------
hFl_ENSPANP00000001460 ...................................................................----------
hFl_ENSPANP00000004498 ...................................................................----------
hFl_ENSPANP00000014540 ...................................................................---LSKAVKL
hFl_ENSPANP00000002479 ...................................................................----------
hFl_ENSPANP00000017858 ...................................................................----------
hFl_ENSPANP00000007886 ...................................................................----------
hFl_ENSPANP00000018968 ...................................................................----------
hFl_ENSPANP00000015642 ...................................................................----------
hFl_ENSPANP00000003731 ...................................................................-------AQA
hFl_ENSPANP00000019484 ...................................................................----------
hFl_ENSPANP00000019485 ...................................................................----------
hFl_ENSPANP00000020575 ...................................................................----------
hFl_ENSPANP00000017457 ...................................................................----------
hFl_ENSPANP00000020575 ...................................................................----------
hFl_ENSPANP00000004562 ...................................................................---LGRELQR
hFl_ENSPANP00000004438 ...................................................................----------
hFl_ENSPANP00000008640 ...................................................................----------
hFl_ENSPANP00000020327 ...................................................................----------
hFl_ENSPANP00000020572 ...................................................................----------
hFl_ENSPANP00000016643 ...................................................................----------
hFl_ENSPANP00000006588 ...................................................................----------
hFl_ENSPANP00000003995 ...................................................................----------
hFl_ENSPANP00000007718 ...................................................................----------
hFl_ENSPANP00000004384 ...................................................................---LARALEN
hFl_ENSPANP00000011118 ...................................................................----------
hFl_ENSPANP00000004252 ...................................................................--------QQ
hFl_ENSPANP00000007476 ...................................................................----------
hFl_ENSPANP00000006588 ...................................................................----------
hFl_ENSPANP00000001745 ...................................................................----------
hFl_ENSPANP00000014391 ...................................................................----------
hFl_ENSPANP00000004313 ...................................................................----------
hFl_ENSPANP00000004562 ...................................................................----------
hFl_ENSPANP00000001425 ...................................................................----------
hFl_ENSPANP00000015647 ...................................................................----------
hFl_ENSPANP00000019118 ...................................................................----------
hFl_ENSPANP00000015209 ...................................................................----------
hFl_ENSPANP00000006801 ...................................................................----------
hFl_ENSPANP00000003551 ...................................................................----------
hFl_ENSPANP00000004252 ...................................................................----------
hFl_ENSPANP00000002479 ...................................................................----------
hFl_ENSPANP00000004798 ...................................................................----------
hFl_ENSPANP00000000477 ...................................................................----------
hFl_ENSPANP00000007362 ...................................................................----------
hFl_ENSPANP00000002485 ...................................................................----------
hFl_ENSPANP00000014498 ...................................................................---YNENTDV
hFl_ENSPANP00000017253 ...................................................................----------
hFl_ENSPANP00000016353 ...................................................................----------
hFl_ENSPANP00000016352 ...................................................................----------
hFl_ENSPANP00000018429 ...................................................................----------
hFl_ENSPANP00000013579 ...................................................................----------
hFl_ENSPANP00000000348 ...................................................................----------
hFl_ENSPANP00000015511 ...................................................................--HLDIAIKL
hFl_ENSPANP00000007718 ...................................................................----------
hFl_ENSPANP00000011118 ...................................................................----------
hFl_ENSPANP00000007718 ...................................................................----------
hFl_ENSPANP00000015642 ...................................................................-ECLERAMKF
hFl_ENSPANP00000001022 ...................................................................----------
hFl_ENSPANP00000010920 ...................................................................----------
hFl_ENSPANP00000007476 ...................................................................----------
hFl_ENSPANP00000003968 ...................................................................----------
hFl_ENSPANP00000001022 ...................................................................----------
hFl_ENSPANP00000009443 ...................................................................----------
hFl_ENSPANP00000011463 ...................................................................----DKVASL
hFl_ENSPANP00000002961 ...................................................................----------
hFl_ENSPANP00000017623 ...................................................................----------
hFl_ENSPANP00000011215 ...................................................................---------E
hFl_ENSPANP00000000119 ...................................................................----------
hFl_ENSPANP00000002418 ...................................................................----------
hFl_ENSPANP00000014391 ...................................................................----------
hFl_ENSPANP00000020421 ...................................................................----------
hFl_ENSPANP00000008387 ...................................................................----------
hFl_ENSPANP00000005487 ...................................................................----------
hFl_ENSPANP00000002155 ...................................................................----------
hFl_ENSPANP00000002567 ...................................................................---------A
hFl_ENSPANP00000019509 ...................................................................----------
hFl_ENSPANP00000005069 ...................................................................---------A
hFl_ENSPANP00000000052 ...................................................................----------
hFl_ENSPANP00000005735 ...................................................................----------
hFl_ENSPANP00000001022 ...................................................................----------
hFl_ENSPANP00000018160 ...................................................................----------
hFl_ENSPANP00000018982 ...................................................................----------
hFl_ENSPANP00000018968 ...................................................................----------
hFl_ENSPANP00000008513 ...................................................................----------
hFl_ENSPANP00000019509 ...................................................................----------
hFl_ENSPANP00000006588 ...................................................................----------
hFl_ENSPANP00000011118 ...................................................................----------
hFl_ENSPANP00000003166 ...................................................................----------
hFl_ENSPANP00000004798 ...................................................................----------
hFl_ENSPANP00000015019 ...................................................................----------
hFl_ENSPANP00000020573 ...................................................................----------
hFl_ENSPANP00000004562 ...................................................................----------
hFl_ENSPANP00000004252 ...................................................................----------
hFl_ENSPANP00000020003 ...................................................................----------
hFl_ENSPANP00000006922 ...................................................................----------
hFl_ENSPANP00000001081 ...................................................................----------
hFl_ENSPANP00000020426 ...................................................................----------
hFl_ENSPANP00000014026 ...................................................................----------
hFl_ENSPANP00000015646 ...................................................................----------
hFl_ENSPANP00000015647 ...................................................................----------
hFl_ENSPANP00000015639 ...............................................lksqgknckklaknllkepe----------
hFl_ENSPANP00000004438 ...................................................................-DCFGKAIEI
hFl_ENSPANP00000015636 ...............................................lksqgknckklaknllkepe----------
hFl_ENSPANP00000006186 ...................................................................----------
hFl_ENSPANP00000015209 ...................................................................----------
hFl_ENSPANP00000000119 ...................................................................----------
hFl_ENSPANP00000011874 ...................................................................----------
hFl_ENSPANP00000013299 ...................................................................----------
hFl_ENSPANP00000003968 ...................................................................----------
hFl_ENSPANP00000005681 ...................................................................----------
hFl_ENSPANP00000012992 ...................................................................----------
hFl_ENSPANP00000004384 ...................................................................----------
hFl_ENSPANP00000020572 ...................................................................----------
hFl_ENSPANP00000006404 ...................................................................----------
hFl_ENSPANP00000000870 ...................................................................----------
hFl_ENSPANP00000001745 ...................................................................----------
hFl_ENSPANP00000011077 ...................................................................----------
hFl_ENSPANP00000003398 ...................................................................----------
hFl_ENSPANP00000008218 ...................................................................----------
hFl_ENSPANP00000010361 ...................................................................----------
hFl_ENSPANP00000017310 ...................................................................----------
hFl_ENSPANP00000004678 ...................................................................----------
hFl_ENSPANP00000005519 ...................................................................----------
hFl_ENSPANP00000008921 ...................................................................----------
hFl_ENSPANP00000016699 ...................................................................----------
hFl_ENSPANP00000001022 ...................................................................----------
hFl_ENSPANP00000015209 ...................................................................----------
hFl_ENSPANP00000012305 ...................................................................----------
hFl_ENSPANP00000018202 ...................................................................----------


                               20        30                               40        50              
                                |         |                                |         |              
d1kt1a1                KLEQAAIVKEKGTVYFKGGK....................Y...VQAVIQYGKIVSWLEMEYGLS............
hFl_ENSPANP00000004835 --------------------....................S...DEAANIYERAIS---------............
hFl_ENSPANP00000017500 --------------------....................-...---------------------............
hFl_ENSPANP00000011496 DPKHMEAWQYLGTTQAENEQ....................E...LLAISALRRCLELKPDNQTALmalavsftnesl
hFl_ENSPANP00000005875 --------------------....................-...---------------------............
hFl_ENSPANP00000015319 DPGDAEAWQFLGITQAENEN....................E...QAAIVALQRCLELQPNNLKALmalavsytntgh
hFl_ENSPANP00000019493 --------------------....................-...---------------------............
hFl_ENSPANP00000015800 NSSEPLTFLSLGNAYLALKN....................I...SGALEAFRQALKLTTKCPECEnslklircmqfy
hFl_ENSPANP00000017125 NRTVISNWIKYAQWEESLKE....................I...QRARSIYERAL----------............
hFl_ENSPANP00000011271 ------IYARAANMFKMAKN....................W...SAAGNAFCQAAQLHLQL----............
hFl_ENSPANP00000017151 ----------AANMFKMAKN....................W...SAAGNAFCQAAKLHMQL----............
hFl_ENSPANP00000007093 --------------LQQQGK....................L...QEALMHYKEAI----------............
hFl_ENSPANP00000007238 --------------------....................-...---RAAFTRALEYLKQEVEER............
hFl_ENSPANP00000007093 NPLLAEAYSNLGNVYKERGQ....................L...QEAIEHYRHALRLKPDFIDGYinlaaalvaagd
hFl_ENSPANP00000015526 --------------------....................-...---------------------............
hFl_ENSPANP00000010410 --------------------....................-...---------------------............
hFl_ENSPANP00000004737 ------KEKELGNDAYKKKD....................F...DTALKHYDKAK----------............
hFl_ENSPANP00000020946 ------VFLHLADIYAKSEK....................F...QEAGELYNRML----------............
hFl_ENSPANP00000020864 DPNYAYAYTLLGHEFVLTEE....................L...DKALACFRNAI----------............
hFl_ENSPANP00000007952 CPLNAKVHYNIGKNLADKGN....................Q...TAAIRYYREAV----------............
hFl_ENSPANP00000016788 -PKKPMVHMLWAAFEEQQGN....................I...NEARNILRTFE----------............
hFl_ENSPANP00000004737 -------EKNKGNECFQKGD....................Y...PQAMKHYTEAI----------............
hFl_ENSPANP00000004737 -----NELKEKGNKALSAGN....................I...DDALQCYSEAI----------............
hFl_ENSPANP00000000707 LPHNAKVHYNYANFLKDQGR....................N...KEAIYHYRTALKLYPRHASALnnlgtlirdtae
hFl_ENSPANP00000004108 ----ADQLKDEGNNHMKEEN....................Y...AAAVDCYTQAI----------............
hFl_ENSPANP00000016788 --------------------....................-...---------------------............
hFl_ENSPANP00000015646 -----RAYGNMGNAYNALGM....................Y...DQAVKYHRQELQISMEV----............
hFl_ENSPANP00000015647 -----RAYGNMGNAYNALGM....................Y...DQAVKYHRQELQISMEV----............
hFl_ENSPANP00000003166 ----PEILNNVGALHFRLGN....................L...GEAKKYFLASLDRAKAEAEHD............
hFl_ENSPANP00000003324 DSAEAERLKTEGNEQMKVEN....................F...EAAVHFYGKAI----------............
hFl_ENSPANP00000005479 KLEQSTIVKERGTVYFKEGK....................Y...KQALLQYKKIVSWLEYESSFS............
hFl_ENSPANP00000003528 ----ALVLKEKGNKYFKQGK....................Y...DEAIDCYTKGM----------............
hFl_ENSPANP00000015647 ---EASAYAALGTAYRMIQK....................Y...DKALGYHTQELEVYQEL----............
hFl_ENSPANP00000014391 YEDFPKLWMMKGQIEEQKEM....................M...ENAREAYNQGL----------............
hFl_ENSPANP00000015646 ---EASAYAALGTAYRMIQK....................Y...DKALGYHTQELEVYQEL----............
hFl_ENSPANP00000015646 AFNKAQAYGELGSLHSQLGN....................Y...EQAISCLERQLNIARDM----............
hFl_ENSPANP00000015647 AFNKAQAYGELGSLHSQLGN....................Y...EQAISCLERQLNIARDM----............
hFl_ENSPANP00000010352 NKNNAKLWNNVGHALENEKN....................F...ERALKYFLQATHVQPDDIGAHmnvgrtyknlnr
hFl_ENSPANP00000012491 KLEQAAIVKEKGTVYFKGGK....................Y...MQAVIQYGKIVSWLEMEYGLS............
hFl_ENSPANP00000014791 ------CLYNLGKLYHEQGH....................Y...EEALSVYKEAIQKMPRQFAPQslynmmgeaymr
hFl_ENSPANP00000005591 ----AEELKTQANDYFKAKD....................Y...ENAIKFYSQAI----------............
hFl_ENSPANP00000015348 DRYNPAALTNKGNTVFANGD....................Y...EKAAEFYKEAL----------............
hFl_ENSPANP00000014791 ---PAKAWGNLGNVLKSQSK....................I...SEAESAYRNAL----------............
hFl_ENSPANP00000013486 ----AQELKEQGNRLFVGRK....................Y...PEAAACYGRAI----------............
hFl_ENSPANP00000015752 -----RAYGNLGNTHYLLGN....................F...TEATTFHKERLAIAKEF----............
hFl_ENSPANP00000014239 SPENTELLTTLGLLYLQLGI....................Y...QKAFEHLGNALTYDPTNYKAIlaagsmmqthgd
hFl_ENSPANP00000001617 -----RAFGNLGNTHYLLGN....................F...RDAVIAHEQRLLIAKEF----............
hFl_ENSPANP00000017253 CKDDAHALHLLALLFSAQKH....................H...QHALDVVNMAITEHPENFNLMftkvkleqalkg
hFl_ENSPANP00000020687 CPKNASYYGNRAATLMMLGR....................F...REALGDAQQSVRLDDSFVRGHlregkchlslgn
hFl_ENSPANP00000014947 --------KEKGNEAFNSGD....................Y...EEAVMYYTRSI----------............
hFl_ENSPANP00000015753 -----RAYGNLGNTHYLLGN....................F...TEATTFHKERLAIAKEF----............
hFl_ENSPANP00000003528 --------KDRGNGFFKEGK....................Y...ERAIECYTRGI----------............
hFl_ENSPANP00000008218 FPGEVTLLCGIARIYEEMNN....................M...SSAAEYYKEVLKQDNTHVEAIacigsnhfysdq
hFl_ENSPANP00000015646 --SEARELGNMGAVYIAMGD....................F...ENAVQCHEQHLKIAKDL----............
hFl_ENSPANP00000013297 HPAVAATLNNLAVLYGKRGK....................Y...KEAEPLCKRALEIREKVLG--............
hFl_ENSPANP00000015647 --SEARELGNMGAVYIAMGD....................F...ENAVQCHEQHLKIAKDL----............
hFl_ENSPANP00000007362 -----ETCCVIGNYYSLRSQ....................H...EKAALYFQRAL----------............
hFl_ENSPANP00000014947 ----FKALKEEGNQCVNDKN....................Y...KDALRKYSECL----------............
hFl_ENSPANP00000008383 ------DLKNIGNTFFKSQN....................W...EMAIKKYAKVLRYVDSSKAVIe...........
hFl_ENSPANP00000017676 ---KAKVLKEEGNELVKKGN....................H...KKAIEKYSESL----------............
hFl_ENSPANP00000001814 -------LKEEGNEQFKKGD....................Y...IEAESSYSRALEMCPC-----............
hFl_ENSPANP00000001168 -----RAQRSKALLHLRNKE....................F...QECVECFERSV----------............
hFl_ENSPANP00000003176 -PDNARTLNELGVLYYLQNN....................L...ETADQFLKRSLEMRERVLG--............
hFl_ENSPANP00000010724 --------RARGTELFRAGN....................A...EGAARCYGRALRLLLTLPP--............
hFl_ENSPANP00000013376 -----EQLRKEGNELFKCGD....................Y...EGALGAYTQALGLD-------............
hFl_ENSPANP00000013375 -----EQLRKEGNELFKCGD....................Y...EGALGAYTQALGLD-------............
hFl_ENSPANP00000000707 -----EILSPLGALYYNTGR....................Y...EEALQIYQEAAALQPSQRELRlalaqvlavmgq
hFl_ENSPANP00000012992 ------LMKMKGNEEFSKER....................F...DIAIIYYTRAI----------............
hFl_ENSPANP00000020687 -------KKEDGNKAFKEGN....................Y...KLAYELYTEALGIDP------............
hFl_ENSPANP00000000643 ----ADALKEKGNEAFAEGN....................Y...ETAILHYSEGL----------............
hFl_ENSPANP00000007559 HPAVAATLNNLAVLYGKRGK....................Y...KEAEPLCKRALEIREKVLG--............
hFl_ENSPANP00000003197 ---RAQAAKNKGNKYFKAGK....................Y...EQAIQCYTEAISLCPT-----............
hFl_ENSPANP00000003945 HPDVATMLNILALVYRDQNK....................Y...KEATDLLHDALQIREQTLG--............
hFl_ENSPANP00000012699 -PAVAATLNNLAVLYGKRGK....................Y...KEAEPLCQRALEIREKVLG--............
hFl_ENSPANP00000004293 -RDNVDLLGSLADLYFRAGD....................N...KNSVLKFEQAQMLDPYLIKGMdvygyllaregr
hFl_ENSPANP00000014070 EEKNPEWLKDKGNKLFATEN....................Y...LAAINAYNLAI----------............
hFl_ENSPANP00000008096 KMDFTAARLQRGHLLLKQGK....................L...DEAEDDFKKVLKSNPSENEEKeaqsqliksdem
hFl_ENSPANP00000014947 ---SPAGLKSQGNELFRSGQ....................F...AEAASKYSAAIALLEPAGS--............
hFl_ENSPANP00000020577 ISSQPYVLRYAAKFYRRKNS....................W...NKALELLKKALEVTPTSSFLHhqmglcyraqmi
hFl_ENSPANP00000020573 --------CEEGWTQLKCGR....................N...ERAKVCFEKALEEKPNNPEFSsglaiamyhldn
hFl_ENSPANP00000015642 ----AQIWLHAAEVYIGIGK....................P...AEATACTQEAA----------............
hFl_ENSPANP00000019972 --------------------....................-...---------------------............
hFl_ENSPANP00000002155 YWKNAAFLYGLGLVYFHYNA....................F...QWAIKAFQEVLYVDPSFCRAKeihlrlglmfkv
hFl_ENSPANP00000003197 DPQNADVYHHRGQLKILLDQ....................V...EEAVADFDECIRLRPESALAQaqkcfalyrqay
hFl_ENSPANP00000010388 ------QLRHEGNRLYRERQ....................V...EAALLKYNEAV----------............
hFl_ENSPANP00000009536 ----AKTYKDEGNDYFKEKD....................Y...KKAVISYTEGLKKKC------............
hFl_ENSPANP00000013401 --------KVAAIEALNDGE....................L...QKAIDLFTDAI----------............
hFl_ENSPANP00000007559 ------TLHNLVIQYASQGR....................Y...EVAVPLCKQALEDLEKTSG--............
hFl_ENSPANP00000020038 ------QLKEEGNRHFQLQD....................Y...KAATKSYSQALKLT-------............
hFl_ENSPANP00000020312 DYLNPNVWGLKGHLYFLSGN....................H...SEAKACYERTISFV-------............
hFl_ENSPANP00000000258 ------QLRHEGNRLYRERQ....................V...EAALLKYNEAV----------............
hFl_ENSPANP00000017676 -PDSVEKLRAAGNESFRNGQ....................Y...AEASALYGRALRVLQAQGS--............
hFl_ENSPANP00000006518 ----LERVKQQANEAFACQQ....................W...TQAIQLYSKAV----------............
hFl_ENSPANP00000013297 ------TLHNLVIQYASQGR....................Y...EVAVPLCKQALEDLEKTSG--............
hFl_ENSPANP00000003504 ----------CGNAHYQRAD....................F...VLAANSYDLAIKAITSSAKVDmt..........
hFl_ENSPANP00000017184 ----AHEFKSQGAQCYKDKK....................F...REAIGKYHRALLELKGLLPPPgereqdsraasp
hFl_ENSPANP00000006801 ----------MGNAFLGLSV....................F...QKALESFEKALRYAHNN----............
hFl_ENSPANP00000015190 ---------TLAQAHFNKGE....................Y...AEAETLYSAYIRQCACAASSG............
hFl_ENSPANP00000001081 ------LMKMKGNEEFSKER....................F...DIAIIYYTRAI----------............
hFl_ENSPANP00000006437 DVKSHVCWHVYGLLQRSDKK....................Y...DEAIKCYRNALKLDKDNLQILrdlsllqiqmrd
hFl_ENSPANP00000012699 ------TLHNLVIQYAAQGR....................Y...EVAVPLCKQALEDLERTSG--............
hFl_ENSPANP00000007476 ------LWVAFAKFYEDNGQ....................L...DDARVILEKATKVNF------............
hFl_ENSPANP00000009269 -------LMEEGNVMYKKGK....................M...KEAAQRYQYALRKFPREGFGE............
hFl_ENSPANP00000014391 ------TWMEDADSCVAHNA....................L...ECARAIYAYAL----------............
hFl_ENSPANP00000019581 --KVVPVLHGEGNRLFKLGR....................Y...EEASSKYQEAIICLRNLQTKEkpw.........
hFl_ENSPANP00000020572 KPKNPEFTSGLAIASYRLDN....................WppsQNAIDPLRQAIRLNPDNQYLKvllalklhkmre
hFl_ENSPANP00000007217 ----AVAFKAEGQRCYREKK....................F...REAIGKYHRALLQLKAAQASSpgparls.....
hFl_ENSPANP00000020685 -------YMAEGERLYLCGE....................F...SKAAQSFSNAL----------............
hFl_ENSPANP00000020899 --------MEEGDMFYKKGK....................V...KEAAQRYQYALKKFPREGFGE............
hFl_ENSPANP00000008387 ----------AAELYISNKQ....................Y...DKALEVITDFSGIVLSEEGTSeenkapenvtct
hFl_ENSPANP00000010352 EPLDANGYFNLGMLAMDDKK....................D...NEAEVWMKKAI----------............
hFl_ENSPANP00000009338 SLRAAVAFKAEGQRCYREKK....................F...REAIGKYHRALLQLKAAQGARpgglpapapgpt
hFl_ENSPANP00000018160 RMANPRSFLLLGDAYMNILE....................P...EEAIVAYEQAL----------............
hFl_ENSPANP00000020864 ------TLSLLGHVYCKTDR....................L...AKGSECYQKSLSLNPFLWSPFeslceigekpdp
hFl_ENSPANP00000008387 -------LMGEANIRFARGE....................R...EEAILMCMEII----------............
hFl_ENSPANP00000009057 ---HVCSWHVYGLLQRSDKK....................Y...DEAIKCYRNALKLDKDNLQILrdlsllqiqmrd
hFl_ENSPANP00000018160 ----AEICAEIAKHSVAQRD....................Y...EKAIKFYREAL----------............
hFl_ENSPANP00000007915 ------TYRLLSDKMLQNKE....................Y...KQAIKILIKASEIAKEG----............
hFl_ENSPANP00000003731 APALIDPLYLMAQVRYYSGE....................L...ENAQSILQRCLELDPASVDAHllmcqiylaqgn
hFl_ENSPANP00000015625 -----ATEREFGNYLFRQNR....................F...CDAKVRYKRALLLLRRRSAPS............
hFl_ENSPANP00000014767 -------LKDEGASLAENKR....................Y...REAIQKWDEAL----------............
hFl_ENSPANP00000002080 -------LAKLGTSFAQNGF....................Y...HEAVVLFTQAL----------............
hFl_ENSPANP00000007403 --------------------....................-...-------TKAL----------............
hFl_ENSPANP00000007476 -----------------GRK....................L...ERARDLFEQALDGCP------............
hFl_ENSPANP00000005487 ----SESLLARARCYGFLGQ....................K...KTAMFDFNAVL----------............
hFl_ENSPANP00000003731 ---------QFAEHYLAEKE....................Y...DKAVRSYKDVF----------............
hFl_ENSPANP00000013410 ------NLFAEGNDLFREKD....................Y...KQALVQYMEGLNVADYAASDQ............
hFl_ENSPANP00000003097 ----AELLKESGNQVLKNGN....................F...SLAIRKYDEAIQILLQLYQW-............
hFl_ENSPANP00000020575 NPDNGYLKVLLALKLQDNGQ....................E...AEGEKYLEEAL----------............
hFl_ENSPANP00000007248 ------SLWNEGVLAADKKD....................W...KGALDAFSAVQ----------............
hFl_ENSPANP00000019375 ----VREYYSRGQQCLEQAD....................W...ETAVLFFSRAL----------............
hFl_ENSPANP00000003854 ------LIHQEGNRLYREGH....................V...KEAAAKYYDAIACLKNLQMKEqpg.........
hFl_ENSPANP00000006795 -------CVKIGVDYFKVGR....................H...VDAMNEYNKAL----------............
hFl_ENSPANP00000002479 ----ATVLRNLGMAHNALGN....................Y...REAQEFHQKAADLHGSV----............
hFl_ENSPANP00000017125 --------------------....................-...---------------------............
hFl_ENSPANP00000005048 FPGSHRVKRLTGMRFEAMER....................Y...DDAVQLYDRILQEDPTNTAARkrkiairkaqgk
hFl_ENSPANP00000003731 ------ALYYAGVFLWLIGH....................H...DKAKEYIDRML----------............
hFl_ENSPANP00000018160 ------ALYHAGLFLWHIGR....................H...DKAREYIDRMI----------............
hFl_ENSPANP00000019375 -------YNDFAVHCYRQGA....................Y...QEGVLLLNKAL----------............
hFl_ENSPANP00000014239 SPQSADNLKQVARSLFLLGK....................H...KAAIEVYNEAA----------............
hFl_ENSPANP00000012835 -------MYSMANCLLLMKD....................Y...VLAVEAYHAVIKYYPEQEPQLlsgigrislqvr
hFl_ENSPANP00000001460 ------------------KN....................Y...ERAKACFEKALEGDPENPEFNtgyaitvyrldn
hFl_ENSPANP00000015753 -------LALEGERLCKAGD....................F...KAGVAFFEAAVQVGT------............
hFl_ENSPANP00000003968 NKDDVTALHCKVVCLIQNGS....................F...KEALNVINTHTKVLANNSLSFekayceyrlnri
hFl_ENSPANP00000006868 ---------------LHQGR....................Y...REALAAACEAL----------............
hFl_ENSPANP00000001460 MSSQTYVFRYAAKFYRRKGS....................V...DKALELLKMALETTPTSAFLHhqmglcykaqmi
hFl_ENSPANP00000004313 -----ETLAMKGLTLNCLGK....................K...EEAYELVRRGL----------............
hFl_ENSPANP00000001617 ------IYSQLGNAYFYLHD....................Y...AKALEYHHHDLTLASRTI---............
hFl_ENSPANP00000019732 -----------ARYLLFSKQ....................P...SQAQRMYEKALQISEEIQG--............
hFl_ENSPANP00000013913 -------LFNEGNDVYRERD....................W...NNSISQYTEALNIADYAKSEE............
hFl_ENSPANP00000004649 ----SKALELQGVMAAEAGD....................L...STALERFGQAI----------............
hFl_ENSPANP00000013914 -------LFNEGNDVYRERD....................W...NNSISQYTEALNIADYAKSEE............
hFl_ENSPANP00000003176 -------LMKLGRFLKDLGL....................L...SQAVVPLQRSLEIRETALD--............
hFl_ENSPANP00000003166 DAKNLYAANGIGAVLAHKGY....................F...REARDVFAQVR----------............
hFl_ENSPANP00000015752 -------LALEGERLCKAGD....................F...KAGVAFFEAAVQVGT------............
hFl_ENSPANP00000001460 -------HNLLAYVKHLKGQ....................N...EEALVTLKKAEDLIQKEHAN-............
hFl_ENSPANP00000004498 -----------ARSLQRQQQ....................P...EAALLRCDQAL----------............
hFl_ENSPANP00000014540 EPKLVEAWNQLGEVYWKKGD....................V...AAAHTCFSGALTHCRNKVSLQnlsmvlrqlrtg
hFl_ENSPANP00000002479 ----------VALAYHALGE....................L...PQALAWYHRALGHY-------............
hFl_ENSPANP00000017858 --------------YLDNGN....................N...KMAIQQADKLL----------............
hFl_ENSPANP00000007886 --------KVAAIEALNDGE....................L...QKAIDLFTNTI----------............
hFl_ENSPANP00000018968 ----AFALYHKALDLQKHDR....................F...EESAKAYHELLEARLLREAVSsg..........
hFl_ENSPANP00000015642 --------------------....................-...-KALLAFQRAH----------............
hFl_ENSPANP00000003731 EKDSVPALLALAQAYVFLKQ....................I...PKARMQLKRLAKAPWVL----............
hFl_ENSPANP00000019484 DSDAPLFYREQGNKKFQEKD....................Y...TGAAVLYSKGVSHSR------............
hFl_ENSPANP00000019485 DSDAPLFYREQGNKKFQEKD....................Y...TGAAVLYSKGVSHSR------............
hFl_ENSPANP00000020575 -------HNLLAYVKHLKGQ....................N...EAALKSLKEAEDLMQKEHAN-............
hFl_ENSPANP00000017457 ----ARLCFNAGCVHLLAGD....................A...EAALRAFDQAV----------............
hFl_ENSPANP00000020575 --------------------....................-...--AIFHFESAV----------............
hFl_ENSPANP00000004562 SPRSRAGLSLLGYCYYRLQE....................F...ALAAECYEQLG----------............
hFl_ENSPANP00000004438 ----------LGAFAFYLEE....................L...DEARECFLEVTREHPGNLNAWanlahvygrlgq
hFl_ENSPANP00000008640 --------------YLDNGN....................N...KMAIQQADKLL----------............
hFl_ENSPANP00000020327 ----AEDCFELGKVAYTEAD....................Y...YHTELWMEQALRQLDEG----............
hFl_ENSPANP00000020572 ------MCNLLAYLKHLKGQ....................N...EEALECLCKAEELIQQEHAD-............
hFl_ENSPANP00000016643 --------------------....................-...---------------------............
hFl_ENSPANP00000006588 --------LWIGYCAFHLGD....................Y...KRALEEYENAT----------............
hFl_ENSPANP00000003995 --------------CLGVQD....................F...GTAYAHYLLVLSLAPELKD--............
hFl_ENSPANP00000007718 --------------------....................-...--AQAAFEKSLAIVDEELEGT............
hFl_ENSPANP00000004384 NKDNPEIWCHYLRLFSKRGT....................K...DEVQEMCETAVEYAPDYQSFWtflhlestfeek
hFl_ENSPANP00000011118 --------------------....................-...--AQAAFEKSLAIVDEELEGT............
hFl_ENSPANP00000004252 SPRTRAVLSLLGYCYYRLQE....................F...ALAAECYEQLG----------............
hFl_ENSPANP00000007476 --------------------....................-...----NCHERAF----------............
hFl_ENSPANP00000006588 ----------LASIHYMRSH....................Y...QEAIDIYKRIL----------............
hFl_ENSPANP00000001745 -------VYRKAVVLQAQNQ....................M...SEAHKLLQKLLVHCQKL----............
hFl_ENSPANP00000014391 --------------------....................-...---------------------............
hFl_ENSPANP00000004313 -----YVLKSAANMLERLKI....................Y...EEAWTKYPRGLVPRRLPL--Nflsgekfkecld
hFl_ENSPANP00000004562 ---------NLGCLLYKEGQ....................Y...EAACSKFSAAL----------............
hFl_ENSPANP00000001425 --------------------....................-...-AAASALGAAVRLHLEL----............
hFl_ENSPANP00000015647 ------AYFRQGVALQYLGR....................H...ADALAAFASGLAQDPKSLQLLvgmveaamkspm
hFl_ENSPANP00000019118 ---------VLASRCLQMGR....................A...EDAAEHYLDLLALLLDSSEPRfspppsppgpcm
hFl_ENSPANP00000015209 ---SAPSLFLKSNFEYLRGN....................Y...RKAVKLLNSSNIAEHPG----............
hFl_ENSPANP00000006801 ---------EKGLQLYQSNQ....................T...EKALQVWMKVLEKSSDLMGRFrvlgclvtahse
hFl_ENSPANP00000003551 -------CFGMGRSAYNEGD....................Y...YHTVLWMEQVLKQLDAGE---............
hFl_ENSPANP00000004252 ----------LGCLLYREGQ....................Y...EAACSKFFAAL----------............
hFl_ENSPANP00000002479 ----IQALTRAGHGALQAGR....................N...HEALNNFQRAFLLASKTPQT-............
hFl_ENSPANP00000004798 ----AQLHTLLGLYCVSVNC....................M...DNAEAQFTTALRLT-------............
hFl_ENSPANP00000000477 -------CFGMGRSAYNEGD....................Y...YHTVLWMEQVLKQLDAGE---............
hFl_ENSPANP00000007362 ---------FLAHIYTELQL....................I...EEALQKYQNLID---------............
hFl_ENSPANP00000002485 --------------------....................-...---------------------............
hFl_ENSPANP00000014498 FKFSIELFHTMGRALLSLQK....................F...KEASENLTKAERLSKELLQCG............
hFl_ENSPANP00000017253 -----EAMLILGKLHYVEGS....................Y...RDAISMYARAGIDDVSMENKPlyqmrllseafv
hFl_ENSPANP00000016353 --------------------....................-...---------------------............
hFl_ENSPANP00000016352 --------------------....................-...---------------------............
hFl_ENSPANP00000018429 -----RLCFLLGRLCSRRLK....................L...SQARVYFEEALGALEGSF---............
hFl_ENSPANP00000013579 --------------TFAKGN....................F...LKASELWEQILQDHPTDMLALkfshdvyfylgc
hFl_ENSPANP00000000348 -------------ILLKLDR....................L...DLARKELKRMQ----------............
hFl_ENSPANP00000015511 LPEEPFLYYLKGRYCYTVSKlswiekkmaatlfgkipsstV...QEALHNFLKAE----------............
hFl_ENSPANP00000007718 ------ICEQLGDLFSKAGD....................F...PRAAEAYQKQLRFAELLD---............
hFl_ENSPANP00000011118 ------ICEQLGDLFSKAGD....................F...PRAAEAYQKQLRFAELLD---............
hFl_ENSPANP00000007718 --EEAALCHQLGELLAGHGR....................Y...AEALEQHWQELRLRESA----............
hFl_ENSPANP00000015642 AFEEFHLWYQFALSLMAAGK....................S...ARAVKVLKECI----------............
hFl_ENSPANP00000001022 ----------------SLEG....................Y...EKALEFATLAARLSTVT----............
hFl_ENSPANP00000010920 -----------ASSCYRQKK....................Y...ALAAGQFRTALELCSKGAVLGepf.........
hFl_ENSPANP00000007476 --------------------....................-...---------------------............
hFl_ENSPANP00000003968 -PEHLLPVLIQAAQLCREKQ....................H...TKAIELLQEFSDQHPENAAEIkltmaqlkisqg
hFl_ENSPANP00000001022 --------------------....................-...---------------------............
hFl_ENSPANP00000009443 ---------RKATSSFEVQN....................Y...ADALQWYYYSLRFYSPD----............
hFl_ENSPANP00000011463 SHEEPQDIYWLAQCLYLTAQ....................Y...HRAAHALRSR-----------............
hFl_ENSPANP00000002961 --------------------....................-...---------------------............
hFl_ENSPANP00000017623 --------------------....................-...---------AP----------............
hFl_ENSPANP00000011215 MMDQANDKKVAAIEALNDGE....................L...QKAIDLFIGAI----------............
hFl_ENSPANP00000000119 QKYLIEFCYTVAQKYLFEGK....................H...EDAVPAALHSLRFRVNLYG--............
hFl_ENSPANP00000002418 --------------------....................-...--ALEYAKRALQKNESHFAAHkwyaiclsdvgd
hFl_ENSPANP00000014391 --------------------....................-...---------------------............
hFl_ENSPANP00000020421 --------FVLGGFLSDAGW....................Y...SDAEKVFLSCLQLCTLHDEMLhwfraveccvrl
hFl_ENSPANP00000008387 -PENHALCVLNGHNAFVSGS....................F...KHALGQYVQAF----------............
hFl_ENSPANP00000005487 -----------AGTLLDAGQ....................P...RRALGYCSLSV----------............
hFl_ENSPANP00000002155 --------------------....................-...---------------------............
hFl_ENSPANP00000002567 YPNSSLFMFFKGRIQRLECQ....................I...NSALTSFHTALELAV------............
hFl_ENSPANP00000019509 -PNTIQEYMHLALYCFASSQ....................L...STALSLLYRARYLMLLVFG--............
hFl_ENSPANP00000005069 YPNSSLFMFFKGRIQRLECQ....................I...NSALTSFHTALELAV------............
hFl_ENSPANP00000000052 ------LYYTLGVAWLLQNQ....................C...REAYFNLQKAERNMKELKELY............
hFl_ENSPANP00000005735 --------FQVGKVAYDMGD....................Y...YHAIPWLEEAVSLFRGSYGEW............
hFl_ENSPANP00000001022 --------------------....................-...--CITYHEHWLALAQQL----............
hFl_ENSPANP00000018160 ------------DLALAQGD....................I...ERALSILQNVT----------............
hFl_ENSPANP00000018982 -------CFLLGRLRSRRLK....................L...SQAWVYFEEAPGALEGSF---............
hFl_ENSPANP00000018968 ------VYWLKARFLALQGD....................M...EQALENYDICTEMLQSSTAIQveagagrrdivi
hFl_ENSPANP00000008513 ------LLYASGAAAYYSGD....................Y...RQAVRDLEAALRSHRRLREIRtrcarhcaarhp
hFl_ENSPANP00000019509 ---DAFHFFQSGQAKVQQGF....................L...KEGCELINEALNLFNNVYG--............
hFl_ENSPANP00000006588 -----------ASCFFLLKQ....................F...DDVLIYLNSFK----------............
hFl_ENSPANP00000011118 --EEAALCHQLGELLAGHGR....................Y...AEALEQHWQELRLRESA----............
hFl_ENSPANP00000003166 --------------------....................-...-QATLLYTMAD----------............
hFl_ENSPANP00000004798 -------------LYHHTKN....................S...EQARSHLEKAWLISQQIP---............
hFl_ENSPANP00000015019 -----------GAILENMKQ....................F...SEAAQLYEKGL----------............
hFl_ENSPANP00000020573 ----ATMYNLLAYIKHLDGK....................N...EAALECLRQAEELIQQEHAD-............
hFl_ENSPANP00000004562 -------LMAQAKIYWNLEN....................Y...PMVEKIFRKSV----------............
hFl_ENSPANP00000004252 --------MTQAKIYWNLEN....................Y...PMVEKIFRKSV----------............
hFl_ENSPANP00000020003 -------------LYFDTKR....................Y...QEALHLGSQLLRELKKM----............
hFl_ENSPANP00000006922 -----------ARCLAHLGR....................H...MEALEIAANLENKAT------............
hFl_ENSPANP00000001081 ---------QDGYTALLEQR....................C...RSAAQAFTELLNGLDPQKIKQ............
hFl_ENSPANP00000020426 ----IQAQNNLGILWSEREE....................I...ETAQAYLESSEALYTQYMKEVgcppldpterfl
hFl_ENSPANP00000014026 --------------------....................-...---------------------............
hFl_ENSPANP00000015646 --------------------....................-...---------------------............
hFl_ENSPANP00000015647 --------------------....................-...---------------------............
hFl_ENSPANP00000015639 NRNNFCLWKQYAHLEWLLGN....................T...EDARKVFDTAL----------............
hFl_ENSPANP00000004438 AKNQPPILNRLAKIFYFLGK....................Q...DMAIGTCNMALDVLQDPELNWqayctrakihir
hFl_ENSPANP00000015636 NRNNFCLWKQYAHLEWLLGN....................T...EDARKVFDTAL----------............
hFl_ENSPANP00000006186 --KYAFHMILAGHRFSKAGQ....................K...KHALRCYCQAMQVYKGK----............
hFl_ENSPANP00000015209 --------YNCGIQLLHIGR....................P...LAAFECLIEAVQVYHANPRLWlrlaecciaank
hFl_ENSPANP00000000119 --------------------....................-...---------------------............
hFl_ENSPANP00000011874 ----------------SLGL....................L...RDATACYDRAIQLEPDQIIHYhgvvksmlglgq
hFl_ENSPANP00000013299 --------------------....................-...---------------------............
hFl_ENSPANP00000003968 --------FEKAYCEYRLNR....................I...ENALKTIESAN----------............
hFl_ENSPANP00000005681 ------GYHEKGRAFLKRKE....................Y...GIALPCLLDADKYFCECCREL............
hFl_ENSPANP00000012992 --------IQDGYTALLEQR....................C...RSAAQAFTELLNGLDPQKIKQ............
hFl_ENSPANP00000004384 --------------------....................-...----RLYQRAL----------............
hFl_ENSPANP00000020572 --------------------....................-...--AVAHLKKAD----------............
hFl_ENSPANP00000006404 ----VEGLVEQARHWEQAGE....................Y...SRAVDCYLKVR----------............
hFl_ENSPANP00000000870 --------------------....................-...---------------------............
hFl_ENSPANP00000001745 -------ALNLAALHCRFGH....................Y...QQAELALQEAIRIAQESNDHVclqhclswlyvl
hFl_ENSPANP00000011077 -----DAMMAKAEYLCRIGD....................K...EGALTAFRKTYDKTVAL----............
hFl_ENSPANP00000003398 -----------GSFLKFMGK....................T...NEAEELLLSVEDMLVQSQ---............
hFl_ENSPANP00000008218 ----------LAWSYFRRRK....................F...QLCADLCTQMLEKSPYDQEPDpelpvhqaawil
hFl_ENSPANP00000010361 -----------------LGE....................N...NK-------------------............
hFl_ENSPANP00000017310 --------------------....................-...---------------------............
hFl_ENSPANP00000004678 ----------------KKRD....................L...LGALKHWRRAMELRHQGGEYLpkpeppqlvlay
hFl_ENSPANP00000005519 ---LVYILMAKGLHCSTVKD....................F...SHAKQLFAACLELVTEFSPKLrqvmlnemllld
hFl_ENSPANP00000008921 --------FRLGVRLYSEEQ....................P...QEAVPHLEAALHEYFVAYEEChalcegpydydg
hFl_ENSPANP00000016699 ------------------EE....................Y...QQAQHKFLVAVESMEPNNIVV............
hFl_ENSPANP00000001022 ----ARLCFLLGRLSVRKVK....................L...SQARVYFEEAIHILNGAF---............
hFl_ENSPANP00000015209 ---------------FTSGN....................Y...DACLQHLACLQDINKDDYKIIlntavaeffksn
hFl_ENSPANP00000012305 ------------------EE....................Y...QQAQHKFLVAVESMEPNNIVV............
hFl_ENSPANP00000018202 ----VEGLVEQARHWEQAGE....................Y...SRAVDCYLKVR----------............


                                                                                                    
                                                                                                    
d1kt1a1                .............................................................................
hFl_ENSPANP00000004835 .............................................................................
hFl_ENSPANP00000017500 .............................................................................
hFl_ENSPANP00000011496 qrqacetlrdwlrytpayahlvtpaeegaggaglgpskrilgsllsdslflevkel.....................
hFl_ENSPANP00000005875 .............................................................................
hFl_ENSPANP00000015319 qqdacealknwikqnpkykylvkskkgspgltrrmskspvdssvlegvkel..........................
hFl_ENSPANP00000019493 .............................................................................
hFl_ENSPANP00000015800 pflynitssvcsgnchektldnshdkqkyfdnsqsldaaeeepsergteedpvfsvensgrdsdalrlestvveesn
hFl_ENSPANP00000017125 .............................................................................
hFl_ENSPANP00000011271 .............................................................................
hFl_ENSPANP00000017151 .............................................................................
hFl_ENSPANP00000007093 .............................................................................
hFl_ENSPANP00000007238 .............................................................................
hFl_ENSPANP00000007093 megavqayvsalqynpdlycvrsdlgnllkalgrleeakacylkaietqpnfavawsnlgcvfnaqgeiwlaihh..
hFl_ENSPANP00000015526 .............................................................................
hFl_ENSPANP00000010410 .............................................................................
hFl_ENSPANP00000004737 .............................................................................
hFl_ENSPANP00000020946 .............................................................................
hFl_ENSPANP00000020864 .............................................................................
hFl_ENSPANP00000007952 .............................................................................
hFl_ENSPANP00000016788 .............................................................................
hFl_ENSPANP00000004737 .............................................................................
hFl_ENSPANP00000004737 .............................................................................
hFl_ENSPANP00000000707 akmyyqkalqlhpqhnralfnlgnllksqekkeeaitl.......................................
hFl_ENSPANP00000004108 .............................................................................
hFl_ENSPANP00000016788 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000003166 .............................................................................
hFl_ENSPANP00000003324 .............................................................................
hFl_ENSPANP00000005479 .............................................................................
hFl_ENSPANP00000003528 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000010352 tkeaeesymmakslmpqiipg........................................................
hFl_ENSPANP00000012491 .............................................................................
hFl_ENSPANP00000014791 lsklpeaehwymeslrsktdhipahltygkllaltgrkseaekl.................................
hFl_ENSPANP00000005591 .............................................................................
hFl_ENSPANP00000015348 .............................................................................
hFl_ENSPANP00000014791 .............................................................................
hFl_ENSPANP00000013486 .............................................................................
hFl_ENSPANP00000015752 .............................................................................
hFl_ENSPANP00000014239 fdvaltk......................................................................
hFl_ENSPANP00000001617 .............................................................................
hFl_ENSPANP00000017253 peealvtcrqmlrlwqtlysfsqlgglekdgslgegltmkkqsgmhltlpdahdadsgsrrassiaasrleeamsel
hFl_ENSPANP00000020687 amaacrsfqraleldhknaqaqqefknanavmeyekiaetdfekrdfrkvvfc........................
hFl_ENSPANP00000014947 .............................................................................
hFl_ENSPANP00000015753 .............................................................................
hFl_ENSPANP00000003528 .............................................................................
hFl_ENSPANP00000008218 peialrf......................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000013297 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000007362 .............................................................................
hFl_ENSPANP00000014947 .............................................................................
hFl_ENSPANP00000008383 .............................................................................
hFl_ENSPANP00000017676 .............................................................................
hFl_ENSPANP00000001814 .............................................................................
hFl_ENSPANP00000001168 .............................................................................
hFl_ENSPANP00000003176 .............................................................................
hFl_ENSPANP00000010724 .............................................................................
hFl_ENSPANP00000013376 .............................................................................
hFl_ENSPANP00000013375 .............................................................................
hFl_ENSPANP00000000707 tkeaekm......................................................................
hFl_ENSPANP00000012992 .............................................................................
hFl_ENSPANP00000020687 .............................................................................
hFl_ENSPANP00000000643 .............................................................................
hFl_ENSPANP00000007559 .............................................................................
hFl_ENSPANP00000003197 .............................................................................
hFl_ENSPANP00000003945 .............................................................................
hFl_ENSPANP00000012699 .............................................................................
hFl_ENSPANP00000004293 ledvenl......................................................................
hFl_ENSPANP00000014070 .............................................................................
hFl_ENSPANP00000008096 qrlrsqaldafesgdyaaaiafldkilevcvwdaelrelraecfikegeprkaisdlkaasklkndnteafykistl
hFl_ENSPANP00000014947 .............................................................................
hFl_ENSPANP00000020577 qikkathnrpkgkdklkvdelissaifh.................................................
hFl_ENSPANP00000020573 npekqfstdv...................................................................
hFl_ENSPANP00000015642 .............................................................................
hFl_ENSPANP00000019972 .............................................................................
hFl_ENSPANP00000002155 ntdyesslkhfqla...............................................................
hFl_ENSPANP00000003197 tgnnssqiqaamkg...............................................................
hFl_ENSPANP00000010388 .............................................................................
hFl_ENSPANP00000009536 .............................................................................
hFl_ENSPANP00000013401 .............................................................................
hFl_ENSPANP00000007559 .............................................................................
hFl_ENSPANP00000020038 .............................................................................
hFl_ENSPANP00000020312 .............................................................................
hFl_ENSPANP00000000258 .............................................................................
hFl_ENSPANP00000017676 .............................................................................
hFl_ENSPANP00000006518 .............................................................................
hFl_ENSPANP00000013297 .............................................................................
hFl_ENSPANP00000003504 .............................................................................
hFl_ENSPANP00000017184 agapkpgrls...................................................................
hFl_ENSPANP00000006801 .............................................................................
hFl_ENSPANP00000015190 .............................................................................
hFl_ENSPANP00000001081 .............................................................................
hFl_ENSPANP00000006437 legyretryqllqlrptqraswigyaiayhllkdydmalklleefrqtqqvppnkidyeyselilyqnqvmreadlf
hFl_ENSPANP00000012699 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000009269 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000019581 .............................................................................
hFl_ENSPANP00000020572 egeeegegekl..................................................................
hFl_ENSPANP00000007217 .............................................................................
hFl_ENSPANP00000020685 .............................................................................
hFl_ENSPANP00000020899 .............................................................................
hFl_ENSPANP00000008387 ipdgvpiditvklmvclvhlnileplnpl................................................
hFl_ENSPANP00000010352 .............................................................................
hFl_ENSPANP00000009338 sspgparls....................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000020864 dqtfkftsfqnfsnclpnscttqvpnhslshrqpetvltetpqdtivqnkpktgrsllggpaalspltpsfgilple
hFl_ENSPANP00000008387 .............................................................................
hFl_ENSPANP00000009057 legyretryqllqlrptqraswigyaiayhllkdydmalklleefrqtqqqvppnkidyeyselilyqnqvmreadl
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000007915 .............................................................................
hFl_ENSPANP00000003731 fgmcfhclelgvshnfqvrdhplyhlikaralnkagdypeaiktlkmviklpalkkeegrkflgpclqtsqrasill
hFl_ENSPANP00000015625 .............................................................................
hFl_ENSPANP00000014767 .............................................................................
hFl_ENSPANP00000002080 .............................................................................
hFl_ENSPANP00000007403 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000005487 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000013410 .............................................................................
hFl_ENSPANP00000003097 .............................................................................
hFl_ENSPANP00000020575 .............................................................................
hFl_ENSPANP00000007248 .............................................................................
hFl_ENSPANP00000019375 .............................................................................
hFl_ENSPANP00000003854 .............................................................................
hFl_ENSPANP00000006795 .............................................................................
hFl_ENSPANP00000002479 .............................................................................
hFl_ENSPANP00000017125 .............................................................................
hFl_ENSPANP00000005048 nveaire......................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000019375 .............................................................................
hFl_ENSPANP00000014239 .............................................................................
hFl_ENSPANP00000012835 ghaqivwenlnk.................................................................
hFl_ENSPANP00000001460 fniaaernetfslhv..............................................................
hFl_ENSPANP00000015753 .............................................................................
hFl_ENSPANP00000003968 enalktiesanqqtdklkelygqvlyrlerydeclavyrdlvrnsqddydeerktnlsavvaaqsnwekv.......
hFl_ENSPANP00000006868 .............................................................................
hFl_ENSPANP00000001460 qikeathwqprgqdretvnrlvrlaick.................................................
hFl_ENSPANP00000004313 .............................................................................
hFl_ENSPANP00000001617 .............................................................................
hFl_ENSPANP00000019732 .............................................................................
hFl_ENSPANP00000013913 .............................................................................
hFl_ENSPANP00000004649 .............................................................................
hFl_ENSPANP00000013914 .............................................................................
hFl_ENSPANP00000003176 .............................................................................
hFl_ENSPANP00000003166 .............................................................................
hFl_ENSPANP00000015752 .............................................................................
hFl_ENSPANP00000001460 .............................................................................
hFl_ENSPANP00000004498 .............................................................................
hFl_ENSPANP00000014540 tedehshhvmdsvrq..............................................................
hFl_ENSPANP00000002479 .............................................................................
hFl_ENSPANP00000017858 .............................................................................
hFl_ENSPANP00000007886 .............................................................................
hFl_ENSPANP00000018968 .............................................................................
hFl_ENSPANP00000015642 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000019484 .............................................................................
hFl_ENSPANP00000019485 .............................................................................
hFl_ENSPANP00000020575 .............................................................................
hFl_ENSPANP00000017457 .............................................................................
hFl_ENSPANP00000020575 .............................................................................
hFl_ENSPANP00000004562 .............................................................................
hFl_ENSPANP00000004438 eeeeeacaarlaslmglaeepeaagdpqlraarclaeqgyahgfdvgcaspeerarglaagialydkalgygqqipm
hFl_ENSPANP00000008640 .............................................................................
hFl_ENSPANP00000020327 .............................................................................
hFl_ENSPANP00000020572 .............................................................................
hFl_ENSPANP00000016643 .............................................................................
hFl_ENSPANP00000006588 .............................................................................
hFl_ENSPANP00000003995 .............................................................................
hFl_ENSPANP00000007718 .............................................................................
hFl_ENSPANP00000004384 dyvcermleflmgaakretssilsfqlleallfrvqlhiftgrcqsalailqnalksandgivaeylktsdrclawl
hFl_ENSPANP00000011118 .............................................................................
hFl_ENSPANP00000004252 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000006588 .............................................................................
hFl_ENSPANP00000001745 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000004313 kflrmnfskgcppvfntlrslykdkekvaiieelvvgyetslkscrlfnpn..........................
hFl_ENSPANP00000004562 .............................................................................
hFl_ENSPANP00000001425 .............................................................................
hFl_ENSPANP00000015647 rdsleptyqqlqkmkldkspfvvvsvvgqelltaghhgasvvvleaa..............................
hFl_ENSPANP00000019118 pevfleaavaliqagraqdaltlceellrrtssllpkmsrlwenarkg.............................
hFl_ENSPANP00000015209 .............................................................................
hFl_ENSPANP00000006801 mgrykemlkfavvqid.............................................................
hFl_ENSPANP00000003551 .............................................................................
hFl_ENSPANP00000004252 .............................................................................
hFl_ENSPANP00000002479 .............................................................................
hFl_ENSPANP00000004798 .............................................................................
hFl_ENSPANP00000000477 .............................................................................
hFl_ENSPANP00000007362 .............................................................................
hFl_ENSPANP00000002485 .............................................................................
hFl_ENSPANP00000014498 .............................................................................
hFl_ENSPANP00000017253 ikglslerlpnsiasrfrltereeeviacferaswiaqvflqelekttnnstsrhlkgchpvdyeltyfleaalqsa
hFl_ENSPANP00000016353 .............................................................................
hFl_ENSPANP00000016352 .............................................................................
hFl_ENSPANP00000018429 .............................................................................
hFl_ENSPANP00000013579 qeqmrdsvarv..................................................................
hFl_ENSPANP00000000348 .............................................................................
hFl_ENSPANP00000015511 .............................................................................
hFl_ENSPANP00000007718 .............................................................................
hFl_ENSPANP00000011118 .............................................................................
hFl_ENSPANP00000007718 .............................................................................
hFl_ENSPANP00000015642 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000010920 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000003968 niskacl......................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000009443 .............................................................................
hFl_ENSPANP00000011463 .............................................................................
hFl_ENSPANP00000002961 .............................................................................
hFl_ENSPANP00000017623 .............................................................................
hFl_ENSPANP00000011215 .............................................................................
hFl_ENSPANP00000000119 .............................................................................
hFl_ENSPANP00000002418 yegikakianayiikehfekrlsknrkdflsiyck..........................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000020421 lhvrngnckyhlgeetfklaqtymd....................................................
hFl_ENSPANP00000008387 .............................................................................
hFl_ENSPANP00000005487 .............................................................................
hFl_ENSPANP00000002155 .............................................................................
hFl_ENSPANP00000002567 .............................................................................
hFl_ENSPANP00000019509 .............................................................................
hFl_ENSPANP00000005069 .............................................................................
hFl_ENSPANP00000000052 .............................................................................
hFl_ENSPANP00000005735 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000018982 .............................................................................
hFl_ENSPANP00000018968 rlpnlhndsvvsleeidknlkslercqsleeiqrlyeagdykavvhllrptlctsgfdrakhlefmtsiperpaqll
hFl_ENSPANP00000008513 laplgegpgaelplfrsllgrarcyrscetqrlggpasrhrvsedvrsdfqrrvpynylqrayiklnqlekameaah
hFl_ENSPANP00000019509 .............................................................................
hFl_ENSPANP00000006588 .............................................................................
hFl_ENSPANP00000011118 .............................................................................
hFl_ENSPANP00000003166 .............................................................................
hFl_ENSPANP00000004798 .............................................................................
hFl_ENSPANP00000015019 .............................................................................
hFl_ENSPANP00000020573 .............................................................................
hFl_ENSPANP00000004562 .............................................................................
hFl_ENSPANP00000004252 .............................................................................
hFl_ENSPANP00000020003 .............................................................................
hFl_ENSPANP00000006922 .............................................................................
hFl_ENSPANP00000001081 .............................................................................
hFl_ENSPANP00000020426 peeeklte.....................................................................
hFl_ENSPANP00000014026 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000015639 .............................................................................
hFl_ENSPANP00000004438 aylhdlerakmglggmpdrnhlacakad.................................................
hFl_ENSPANP00000015636 .............................................................................
hFl_ENSPANP00000006186 .............................................................................
hFl_ENSPANP00000015209 gtseqetkglpskkgivqsivgqgyhrkivlasqsiqntvyndgqssaipvasmefaaiclrnallllpeeqqdpkq
hFl_ENSPANP00000000119 .............................................................................
hFl_ENSPANP00000011874 lstvitqvngvhansrsewtdelntyrveaawklsqwdlvenylaadgksttwsvrlgqlllsakkrditafydtlk
hFl_ENSPANP00000013299 .............................................................................
hFl_ENSPANP00000003968 .............................................................................
hFl_ENSPANP00000005681 .............................................................................
hFl_ENSPANP00000012992 .............................................................................
hFl_ENSPANP00000004384 .............................................................................
hFl_ENSPANP00000020572 .............................................................................
hFl_ENSPANP00000006404 .............................................................................
hFl_ENSPANP00000000870 .............................................................................
hFl_ENSPANP00000001745 gqkrsdsyvllehsvkkavhfglpylaslgiqslvqqrafagktanklmdalkdsdl....................
hFl_ENSPANP00000011077 .............................................................................
hFl_ENSPANP00000003398 .............................................................................
hFl_ENSPANP00000008218 karaltemvyideidvdqegiaemmldenaiaqvprpgtslklpgtnqtggssqavrpitqagrpitgflrpstqsg
hFl_ENSPANP00000010361 .............................................................................
hFl_ENSPANP00000017310 .............................................................................
hFl_ENSPANP00000004678 dysrevntteelealitdpdemrmqallir...............................................
hFl_ENSPANP00000005519 ihtheagtgqagerppsdlisrvrgylemrlpdiplrqviaeecvafmlnwreseyltlqvpafllqsnpyvklgql
hFl_ENSPANP00000008921 ynyleynadlfqaitdhyiqvlsckqncvtelash..........................................
hFl_ENSPANP00000016699 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000015209 qtttdnlrqtlnqlknqvhsav.......................................................
hFl_ENSPANP00000012305 .............................................................................
hFl_ENSPANP00000018202 .............................................................................


                                                                                                    
                                                                                                    
d1kt1a1                .............................................................................
hFl_ENSPANP00000004835 .............................................................................
hFl_ENSPANP00000017500 .............................................................................
hFl_ENSPANP00000011496 .............................................................................
hFl_ENSPANP00000005875 .............................................................................
hFl_ENSPANP00000015319 .............................................................................
hFl_ENSPANP00000019493 .............................................................................
hFl_ENSPANP00000015800 gsdemensdetkmseeilalvdefqqawplegfggalemkgrrldlqgirvlkkgpqdgvarsscygdcrseddeat
hFl_ENSPANP00000017125 .............................................................................
hFl_ENSPANP00000011271 .............................................................................
hFl_ENSPANP00000017151 .............................................................................
hFl_ENSPANP00000007093 .............................................................................
hFl_ENSPANP00000007238 .............................................................................
hFl_ENSPANP00000007093 .............................................................................
hFl_ENSPANP00000015526 .............................................................................
hFl_ENSPANP00000010410 .............................................................................
hFl_ENSPANP00000004737 .............................................................................
hFl_ENSPANP00000020946 .............................................................................
hFl_ENSPANP00000020864 .............................................................................
hFl_ENSPANP00000007952 .............................................................................
hFl_ENSPANP00000016788 .............................................................................
hFl_ENSPANP00000004737 .............................................................................
hFl_ENSPANP00000004737 .............................................................................
hFl_ENSPANP00000000707 .............................................................................
hFl_ENSPANP00000004108 .............................................................................
hFl_ENSPANP00000016788 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000003166 .............................................................................
hFl_ENSPANP00000003324 .............................................................................
hFl_ENSPANP00000005479 .............................................................................
hFl_ENSPANP00000003528 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000010352 .............................................................................
hFl_ENSPANP00000012491 .............................................................................
hFl_ENSPANP00000014791 .............................................................................
hFl_ENSPANP00000005591 .............................................................................
hFl_ENSPANP00000015348 .............................................................................
hFl_ENSPANP00000014791 .............................................................................
hFl_ENSPANP00000013486 .............................................................................
hFl_ENSPANP00000015752 .............................................................................
hFl_ENSPANP00000014239 .............................................................................
hFl_ENSPANP00000001617 .............................................................................
hFl_ENSPANP00000017253 tmpssvlkqgpmqlwttleqiwlqaaelfmeqkhlkeagfc....................................
hFl_ENSPANP00000020687 .............................................................................
hFl_ENSPANP00000014947 .............................................................................
hFl_ENSPANP00000015753 .............................................................................
hFl_ENSPANP00000003528 .............................................................................
hFl_ENSPANP00000008218 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000013297 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000007362 .............................................................................
hFl_ENSPANP00000014947 .............................................................................
hFl_ENSPANP00000008383 .............................................................................
hFl_ENSPANP00000017676 .............................................................................
hFl_ENSPANP00000001814 .............................................................................
hFl_ENSPANP00000001168 .............................................................................
hFl_ENSPANP00000003176 .............................................................................
hFl_ENSPANP00000010724 .............................................................................
hFl_ENSPANP00000013376 .............................................................................
hFl_ENSPANP00000013375 .............................................................................
hFl_ENSPANP00000000707 .............................................................................
hFl_ENSPANP00000012992 .............................................................................
hFl_ENSPANP00000020687 .............................................................................
hFl_ENSPANP00000000643 .............................................................................
hFl_ENSPANP00000007559 .............................................................................
hFl_ENSPANP00000003197 .............................................................................
hFl_ENSPANP00000003945 .............................................................................
hFl_ENSPANP00000012699 .............................................................................
hFl_ENSPANP00000004293 .............................................................................
hFl_ENSPANP00000014070 .............................................................................
hFl_ENSPANP00000008096 yyqlgdhelslrymnsevreclkldqdhkrcfahykqvkklnkliesaeelirdgrytdatskyesv..........
hFl_ENSPANP00000014947 .............................................................................
hFl_ENSPANP00000020577 .............................................................................
hFl_ENSPANP00000020573 .............................................................................
hFl_ENSPANP00000015642 .............................................................................
hFl_ENSPANP00000019972 .............................................................................
hFl_ENSPANP00000002155 .............................................................................
hFl_ENSPANP00000003197 .............................................................................
hFl_ENSPANP00000010388 .............................................................................
hFl_ENSPANP00000009536 .............................................................................
hFl_ENSPANP00000013401 .............................................................................
hFl_ENSPANP00000007559 .............................................................................
hFl_ENSPANP00000020038 .............................................................................
hFl_ENSPANP00000020312 .............................................................................
hFl_ENSPANP00000000258 .............................................................................
hFl_ENSPANP00000017676 .............................................................................
hFl_ENSPANP00000006518 .............................................................................
hFl_ENSPANP00000013297 .............................................................................
hFl_ENSPANP00000003504 .............................................................................
hFl_ENSPANP00000017184 .............................................................................
hFl_ENSPANP00000006801 .............................................................................
hFl_ENSPANP00000015190 .............................................................................
hFl_ENSPANP00000001081 .............................................................................
hFl_ENSPANP00000006437 qeslehietyekqicdkllveeikgeillklgrlkeasevfknlidrnaenwcyyeglekalqistleerlqiyeei
hFl_ENSPANP00000012699 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000009269 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000019581 .............................................................................
hFl_ENSPANP00000020572 .............................................................................
hFl_ENSPANP00000007217 .............................................................................
hFl_ENSPANP00000020685 .............................................................................
hFl_ENSPANP00000020899 .............................................................................
hFl_ENSPANP00000008387 .............................................................................
hFl_ENSPANP00000010352 .............................................................................
hFl_ENSPANP00000009338 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000020864 tpspgdgsylqnytntpsvidvpstgapskksvarigqtgtksvfsqsgnsrevtpilaqtqssgpqtsttpqvlsp
hFl_ENSPANP00000008387 .............................................................................
hFl_ENSPANP00000009057 fqeslehietyekqicdkllveeikgeillklgrlkeasevfknlidrnaenwcyyeglekalqistleerlqiyee
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000007915 .............................................................................
hFl_ENSPANP00000003731 elvealrlngelheatkvmqdtinefggtpeenritianvdlvlskgnvdvalnmlrnispkqscymearekmanvy
hFl_ENSPANP00000015625 .............................................................................
hFl_ENSPANP00000014767 .............................................................................
hFl_ENSPANP00000002080 .............................................................................
hFl_ENSPANP00000007403 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000005487 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000013410 .............................................................................
hFl_ENSPANP00000003097 .............................................................................
hFl_ENSPANP00000020575 .............................................................................
hFl_ENSPANP00000007248 .............................................................................
hFl_ENSPANP00000019375 .............................................................................
hFl_ENSPANP00000003854 .............................................................................
hFl_ENSPANP00000006795 .............................................................................
hFl_ENSPANP00000002479 .............................................................................
hFl_ENSPANP00000017125 .............................................................................
hFl_ENSPANP00000005048 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000019375 .............................................................................
hFl_ENSPANP00000014239 .............................................................................
hFl_ENSPANP00000012835 .............................................................................
hFl_ENSPANP00000001460 .............................................................................
hFl_ENSPANP00000015753 .............................................................................
hFl_ENSPANP00000003968 .............................................................................
hFl_ENSPANP00000006868 .............................................................................
hFl_ENSPANP00000001460 .............................................................................
hFl_ENSPANP00000004313 .............................................................................
hFl_ENSPANP00000001617 .............................................................................
hFl_ENSPANP00000019732 .............................................................................
hFl_ENSPANP00000013913 .............................................................................
hFl_ENSPANP00000004649 .............................................................................
hFl_ENSPANP00000013914 .............................................................................
hFl_ENSPANP00000003176 .............................................................................
hFl_ENSPANP00000003166 .............................................................................
hFl_ENSPANP00000015752 .............................................................................
hFl_ENSPANP00000001460 .............................................................................
hFl_ENSPANP00000004498 .............................................................................
hFl_ENSPANP00000014540 .............................................................................
hFl_ENSPANP00000002479 .............................................................................
hFl_ENSPANP00000017858 .............................................................................
hFl_ENSPANP00000007886 .............................................................................
hFl_ENSPANP00000018968 .............................................................................
hFl_ENSPANP00000015642 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000019484 .............................................................................
hFl_ENSPANP00000019485 .............................................................................
hFl_ENSPANP00000020575 .............................................................................
hFl_ENSPANP00000017457 .............................................................................
hFl_ENSPANP00000020575 .............................................................................
hFl_ENSPANP00000004562 .............................................................................
hFl_ENSPANP00000004438 eekrgwyftmatlyirldgiflelgseeqkrlpafnrtlallrqvlksedprhqalawcylgmllerndtfsttpmg
hFl_ENSPANP00000008640 .............................................................................
hFl_ENSPANP00000020327 .............................................................................
hFl_ENSPANP00000020572 .............................................................................
hFl_ENSPANP00000016643 .............................................................................
hFl_ENSPANP00000006588 .............................................................................
hFl_ENSPANP00000003995 .............................................................................
hFl_ENSPANP00000007718 .............................................................................
hFl_ENSPANP00000004384 ayihliefnilpskfydpsndnpsrivntesfvmpwqavqdvktnpdmllavfedavkactdes.............
hFl_ENSPANP00000011118 .............................................................................
hFl_ENSPANP00000004252 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000006588 .............................................................................
hFl_ENSPANP00000001745 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000004313 .............................................................................
hFl_ENSPANP00000004562 .............................................................................
hFl_ENSPANP00000001425 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000019118 .............................................................................
hFl_ENSPANP00000015209 .............................................................................
hFl_ENSPANP00000006801 .............................................................................
hFl_ENSPANP00000003551 .............................................................................
hFl_ENSPANP00000004252 .............................................................................
hFl_ENSPANP00000002479 .............................................................................
hFl_ENSPANP00000004798 .............................................................................
hFl_ENSPANP00000000477 .............................................................................
hFl_ENSPANP00000007362 .............................................................................
hFl_ENSPANP00000002485 .............................................................................
hFl_ENSPANP00000014498 .............................................................................
hFl_ENSPANP00000017253 yvknlkkgnivkgmrelrevlrtvetkatqnfkvmaakhlagvllhslseecywsplshplpefmgkeensfatqal
hFl_ENSPANP00000016353 .............................................................................
hFl_ENSPANP00000016352 .............................................................................
hFl_ENSPANP00000018429 .............................................................................
hFl_ENSPANP00000013579 .............................................................................
hFl_ENSPANP00000000348 .............................................................................
hFl_ENSPANP00000015511 .............................................................................
hFl_ENSPANP00000007718 .............................................................................
hFl_ENSPANP00000011118 .............................................................................
hFl_ENSPANP00000007718 .............................................................................
hFl_ENSPANP00000015642 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000010920 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000003968 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000009443 .............................................................................
hFl_ENSPANP00000011463 .............................................................................
hFl_ENSPANP00000002961 .............................................................................
hFl_ENSPANP00000017623 .............................................................................
hFl_ENSPANP00000011215 .............................................................................
hFl_ENSPANP00000000119 .............................................................................
hFl_ENSPANP00000002418 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000020421 .............................................................................
hFl_ENSPANP00000008387 .............................................................................
hFl_ENSPANP00000005487 .............................................................................
hFl_ENSPANP00000002155 .............................................................................
hFl_ENSPANP00000002567 .............................................................................
hFl_ENSPANP00000019509 .............................................................................
hFl_ENSPANP00000005069 .............................................................................
hFl_ENSPANP00000000052 .............................................................................
hFl_ENSPANP00000005735 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000018982 .............................................................................
hFl_ENSPANP00000018968 llqdsllrlkdyrqcfecsdvalneavqqmvnsseaaakeewvatvtqllmgieqalsadssgsilkesssttglvr
hFl_ENSPANP00000008513 tffvanpehmemqqnienyratagve...................................................
hFl_ENSPANP00000019509 .............................................................................
hFl_ENSPANP00000006588 .............................................................................
hFl_ENSPANP00000011118 .............................................................................
hFl_ENSPANP00000003166 .............................................................................
hFl_ENSPANP00000004798 .............................................................................
hFl_ENSPANP00000015019 .............................................................................
hFl_ENSPANP00000020573 .............................................................................
hFl_ENSPANP00000004562 .............................................................................
hFl_ENSPANP00000004252 .............................................................................
hFl_ENSPANP00000020003 .............................................................................
hFl_ENSPANP00000006922 .............................................................................
hFl_ENSPANP00000001081 .............................................................................
hFl_ENSPANP00000020426 .............................................................................
hFl_ENSPANP00000014026 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000015639 .............................................................................
hFl_ENSPANP00000004438 .............................................................................
hFl_ENSPANP00000015636 .............................................................................
hFl_ENSPANP00000006186 .............................................................................
hFl_ENSPANP00000015209 engaknsnqlggntessessetcsskshdgdkfipappss.....................................
hFl_ENSPANP00000000119 .............................................................................
hFl_ENSPANP00000011874 lvraeqivplsaasfergsyqrgyeyivrlhmlcelehsikplfqhspgdssqedslnwvarlemtqnsyrakepil
hFl_ENSPANP00000013299 .............................................................................
hFl_ENSPANP00000003968 .............................................................................
hFl_ENSPANP00000005681 .............................................................................
hFl_ENSPANP00000012992 .............................................................................
hFl_ENSPANP00000004384 .............................................................................
hFl_ENSPANP00000020572 .............................................................................
hFl_ENSPANP00000006404 .............................................................................
hFl_ENSPANP00000000870 .............................................................................
hFl_ENSPANP00000001745 .............................................................................
hFl_ENSPANP00000011077 .............................................................................
hFl_ENSPANP00000003398 .............................................................................
hFl_ENSPANP00000008218 rpgtmeqairtprtaytarpitsssgrfvrlgtasmltspdgpfinlsrlnltkysqkpklaka.............
hFl_ENSPANP00000010361 .............................................................................
hFl_ENSPANP00000017310 .............................................................................
hFl_ENSPANP00000004678 .............................................................................
hFl_ENSPANP00000005519 laatckelpgpkesrrtakdlwevvvqicsvssqhkrgndgrvslikqrestlgimyrsellsfikklreplvltii
hFl_ENSPANP00000008921 .............................................................................
hFl_ENSPANP00000016699 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000015209 .............................................................................
hFl_ENSPANP00000012305 .............................................................................
hFl_ENSPANP00000018202 .............................................................................


                                                                                                    
                                                                                                    
d1kt1a1                .............................................................................
hFl_ENSPANP00000004835 .............................................................................
hFl_ENSPANP00000017500 .............................................................................
hFl_ENSPANP00000011496 .............................................................................
hFl_ENSPANP00000005875 .............................................................................
hFl_ENSPANP00000015319 .............................................................................
hFl_ENSPANP00000019493 .............................................................................
hFl_ENSPANP00000015800 ewitfqvkrvkkpkgdhkktpgkkvetsqienghryqanleitgpkvaspgpqgkkrdyqrlgwpspdecvklrwve
hFl_ENSPANP00000017125 .............................................................................
hFl_ENSPANP00000011271 .............................................................................
hFl_ENSPANP00000017151 .............................................................................
hFl_ENSPANP00000007093 .............................................................................
hFl_ENSPANP00000007238 .............................................................................
hFl_ENSPANP00000007093 .............................................................................
hFl_ENSPANP00000015526 .............................................................................
hFl_ENSPANP00000010410 .............................................................................
hFl_ENSPANP00000004737 .............................................................................
hFl_ENSPANP00000020946 .............................................................................
hFl_ENSPANP00000020864 .............................................................................
hFl_ENSPANP00000007952 .............................................................................
hFl_ENSPANP00000016788 .............................................................................
hFl_ENSPANP00000004737 .............................................................................
hFl_ENSPANP00000004737 .............................................................................
hFl_ENSPANP00000000707 .............................................................................
hFl_ENSPANP00000004108 .............................................................................
hFl_ENSPANP00000016788 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000003166 .............................................................................
hFl_ENSPANP00000003324 .............................................................................
hFl_ENSPANP00000005479 .............................................................................
hFl_ENSPANP00000003528 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000010352 .............................................................................
hFl_ENSPANP00000012491 .............................................................................
hFl_ENSPANP00000014791 .............................................................................
hFl_ENSPANP00000005591 .............................................................................
hFl_ENSPANP00000015348 .............................................................................
hFl_ENSPANP00000014791 .............................................................................
hFl_ENSPANP00000013486 .............................................................................
hFl_ENSPANP00000015752 .............................................................................
hFl_ENSPANP00000014239 .............................................................................
hFl_ENSPANP00000001617 .............................................................................
hFl_ENSPANP00000017253 .............................................................................
hFl_ENSPANP00000020687 .............................................................................
hFl_ENSPANP00000014947 .............................................................................
hFl_ENSPANP00000015753 .............................................................................
hFl_ENSPANP00000003528 .............................................................................
hFl_ENSPANP00000008218 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000013297 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000007362 .............................................................................
hFl_ENSPANP00000014947 .............................................................................
hFl_ENSPANP00000008383 .............................................................................
hFl_ENSPANP00000017676 .............................................................................
hFl_ENSPANP00000001814 .............................................................................
hFl_ENSPANP00000001168 .............................................................................
hFl_ENSPANP00000003176 .............................................................................
hFl_ENSPANP00000010724 .............................................................................
hFl_ENSPANP00000013376 .............................................................................
hFl_ENSPANP00000013375 .............................................................................
hFl_ENSPANP00000000707 .............................................................................
hFl_ENSPANP00000012992 .............................................................................
hFl_ENSPANP00000020687 .............................................................................
hFl_ENSPANP00000000643 .............................................................................
hFl_ENSPANP00000007559 .............................................................................
hFl_ENSPANP00000003197 .............................................................................
hFl_ENSPANP00000003945 .............................................................................
hFl_ENSPANP00000012699 .............................................................................
hFl_ENSPANP00000004293 .............................................................................
hFl_ENSPANP00000014070 .............................................................................
hFl_ENSPANP00000008096 .............................................................................
hFl_ENSPANP00000014947 .............................................................................
hFl_ENSPANP00000020577 .............................................................................
hFl_ENSPANP00000020573 .............................................................................
hFl_ENSPANP00000015642 .............................................................................
hFl_ENSPANP00000019972 .............................................................................
hFl_ENSPANP00000002155 .............................................................................
hFl_ENSPANP00000003197 .............................................................................
hFl_ENSPANP00000010388 .............................................................................
hFl_ENSPANP00000009536 .............................................................................
hFl_ENSPANP00000013401 .............................................................................
hFl_ENSPANP00000007559 .............................................................................
hFl_ENSPANP00000020038 .............................................................................
hFl_ENSPANP00000020312 .............................................................................
hFl_ENSPANP00000000258 .............................................................................
hFl_ENSPANP00000017676 .............................................................................
hFl_ENSPANP00000006518 .............................................................................
hFl_ENSPANP00000013297 .............................................................................
hFl_ENSPANP00000003504 .............................................................................
hFl_ENSPANP00000017184 .............................................................................
hFl_ENSPANP00000006801 .............................................................................
hFl_ENSPANP00000015190 .............................................................................
hFl_ENSPANP00000001081 .............................................................................
hFl_ENSPANP00000006437 skqhpkaitprrlpltlvpgerfrelmdkflrvnfskgcpplfttlkslyyntekvsiiqelvtnyeaslktcdffs
hFl_ENSPANP00000012699 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000009269 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000019581 .............................................................................
hFl_ENSPANP00000020572 .............................................................................
hFl_ENSPANP00000007217 .............................................................................
hFl_ENSPANP00000020685 .............................................................................
hFl_ENSPANP00000020899 .............................................................................
hFl_ENSPANP00000008387 .............................................................................
hFl_ENSPANP00000010352 .............................................................................
hFl_ENSPANP00000009338 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000020864 tiasppnalprrssrlftsdssttkenskklkmkfppkipnrktksktnkggitqpnindsleitkldssiisegki
hFl_ENSPANP00000008387 .............................................................................
hFl_ENSPANP00000009057 iskqhpkaitprrlpltlvpgerfrelmdkflrvnfskgcpplfttlkslyyntekvsiiqelvtnyeaslktcdff
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000007915 .............................................................................
hFl_ENSPANP00000003731 lqtlrdrrlyirc................................................................
hFl_ENSPANP00000015625 .............................................................................
hFl_ENSPANP00000014767 .............................................................................
hFl_ENSPANP00000002080 .............................................................................
hFl_ENSPANP00000007403 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000005487 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000013410 .............................................................................
hFl_ENSPANP00000003097 .............................................................................
hFl_ENSPANP00000020575 .............................................................................
hFl_ENSPANP00000007248 .............................................................................
hFl_ENSPANP00000019375 .............................................................................
hFl_ENSPANP00000003854 .............................................................................
hFl_ENSPANP00000006795 .............................................................................
hFl_ENSPANP00000002479 .............................................................................
hFl_ENSPANP00000017125 .............................................................................
hFl_ENSPANP00000005048 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000019375 .............................................................................
hFl_ENSPANP00000014239 .............................................................................
hFl_ENSPANP00000012835 .............................................................................
hFl_ENSPANP00000001460 .............................................................................
hFl_ENSPANP00000015753 .............................................................................
hFl_ENSPANP00000003968 .............................................................................
hFl_ENSPANP00000006868 .............................................................................
hFl_ENSPANP00000001460 .............................................................................
hFl_ENSPANP00000004313 .............................................................................
hFl_ENSPANP00000001617 .............................................................................
hFl_ENSPANP00000019732 .............................................................................
hFl_ENSPANP00000013913 .............................................................................
hFl_ENSPANP00000004649 .............................................................................
hFl_ENSPANP00000013914 .............................................................................
hFl_ENSPANP00000003176 .............................................................................
hFl_ENSPANP00000003166 .............................................................................
hFl_ENSPANP00000015752 .............................................................................
hFl_ENSPANP00000001460 .............................................................................
hFl_ENSPANP00000004498 .............................................................................
hFl_ENSPANP00000014540 .............................................................................
hFl_ENSPANP00000002479 .............................................................................
hFl_ENSPANP00000017858 .............................................................................
hFl_ENSPANP00000007886 .............................................................................
hFl_ENSPANP00000018968 .............................................................................
hFl_ENSPANP00000015642 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000019484 .............................................................................
hFl_ENSPANP00000019485 .............................................................................
hFl_ENSPANP00000020575 .............................................................................
hFl_ENSPANP00000017457 .............................................................................
hFl_ENSPANP00000020575 .............................................................................
hFl_ENSPANP00000004562 .............................................................................
hFl_ENSPANP00000004438 vhdcgysgtdpldc...............................................................
hFl_ENSPANP00000008640 .............................................................................
hFl_ENSPANP00000020327 .............................................................................
hFl_ENSPANP00000020572 .............................................................................
hFl_ENSPANP00000016643 .............................................................................
hFl_ENSPANP00000006588 .............................................................................
hFl_ENSPANP00000003995 .............................................................................
hFl_ENSPANP00000007718 .............................................................................
hFl_ENSPANP00000004384 .............................................................................
hFl_ENSPANP00000011118 .............................................................................
hFl_ENSPANP00000004252 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000006588 .............................................................................
hFl_ENSPANP00000001745 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000004313 .............................................................................
hFl_ENSPANP00000004562 .............................................................................
hFl_ENSPANP00000001425 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000019118 .............................................................................
hFl_ENSPANP00000015209 .............................................................................
hFl_ENSPANP00000006801 .............................................................................
hFl_ENSPANP00000003551 .............................................................................
hFl_ENSPANP00000004252 .............................................................................
hFl_ENSPANP00000002479 .............................................................................
hFl_ENSPANP00000004798 .............................................................................
hFl_ENSPANP00000000477 .............................................................................
hFl_ENSPANP00000007362 .............................................................................
hFl_ENSPANP00000002485 .............................................................................
hFl_ENSPANP00000014498 .............................................................................
hFl_ENSPANP00000017253 rkphlyegdnlycpkdnieealllllisesmatrdvvlsrvpeq.................................
hFl_ENSPANP00000016353 .............................................................................
hFl_ENSPANP00000016352 .............................................................................
hFl_ENSPANP00000018429 .............................................................................
hFl_ENSPANP00000013579 .............................................................................
hFl_ENSPANP00000000348 .............................................................................
hFl_ENSPANP00000015511 .............................................................................
hFl_ENSPANP00000007718 .............................................................................
hFl_ENSPANP00000011118 .............................................................................
hFl_ENSPANP00000007718 .............................................................................
hFl_ENSPANP00000015642 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000010920 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000003968 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000009443 .............................................................................
hFl_ENSPANP00000011463 .............................................................................
hFl_ENSPANP00000002961 .............................................................................
hFl_ENSPANP00000017623 .............................................................................
hFl_ENSPANP00000011215 .............................................................................
hFl_ENSPANP00000000119 .............................................................................
hFl_ENSPANP00000002418 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000020421 .............................................................................
hFl_ENSPANP00000008387 .............................................................................
hFl_ENSPANP00000005487 .............................................................................
hFl_ENSPANP00000002155 .............................................................................
hFl_ENSPANP00000002567 .............................................................................
hFl_ENSPANP00000019509 .............................................................................
hFl_ENSPANP00000005069 .............................................................................
hFl_ENSPANP00000000052 .............................................................................
hFl_ENSPANP00000005735 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000018982 .............................................................................
hFl_ENSPANP00000018968 ltnnliqvidcsmavqeeakephvssvlpwiilhriiwqeedtfhslchqqqlqnpaeegmsetpmlpsslmllnta
hFl_ENSPANP00000008513 .............................................................................
hFl_ENSPANP00000019509 .............................................................................
hFl_ENSPANP00000006588 .............................................................................
hFl_ENSPANP00000011118 .............................................................................
hFl_ENSPANP00000003166 .............................................................................
hFl_ENSPANP00000004798 .............................................................................
hFl_ENSPANP00000015019 .............................................................................
hFl_ENSPANP00000020573 .............................................................................
hFl_ENSPANP00000004562 .............................................................................
hFl_ENSPANP00000004252 .............................................................................
hFl_ENSPANP00000020003 .............................................................................
hFl_ENSPANP00000006922 .............................................................................
hFl_ENSPANP00000001081 .............................................................................
hFl_ENSPANP00000020426 .............................................................................
hFl_ENSPANP00000014026 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000015639 .............................................................................
hFl_ENSPANP00000004438 .............................................................................
hFl_ENSPANP00000015636 .............................................................................
hFl_ENSPANP00000006186 .............................................................................
hFl_ENSPANP00000015209 .............................................................................
hFl_ENSPANP00000000119 .............................................................................
hFl_ENSPANP00000011874 alrralls.....................................................................
hFl_ENSPANP00000013299 .............................................................................
hFl_ENSPANP00000003968 .............................................................................
hFl_ENSPANP00000005681 .............................................................................
hFl_ENSPANP00000012992 .............................................................................
hFl_ENSPANP00000004384 .............................................................................
hFl_ENSPANP00000020572 .............................................................................
hFl_ENSPANP00000006404 .............................................................................
hFl_ENSPANP00000000870 .............................................................................
hFl_ENSPANP00000001745 .............................................................................
hFl_ENSPANP00000011077 .............................................................................
hFl_ENSPANP00000003398 .............................................................................
hFl_ENSPANP00000008218 .............................................................................
hFl_ENSPANP00000010361 .............................................................................
hFl_ENSPANP00000017310 .............................................................................
hFl_ENSPANP00000004678 .............................................................................
hFl_ENSPANP00000005519 lslfvklhnvredivnditaehisiwpssipnlqsvdfeavaitvkel.............................
hFl_ENSPANP00000008921 .............................................................................
hFl_ENSPANP00000016699 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000015209 .............................................................................
hFl_ENSPANP00000012305 .............................................................................
hFl_ENSPANP00000018202 .............................................................................


                                                                                                    
                                                                                                    
d1kt1a1                .............................................................................
hFl_ENSPANP00000004835 .............................................................................
hFl_ENSPANP00000017500 .............................................................................
hFl_ENSPANP00000011496 .............................................................................
hFl_ENSPANP00000005875 .............................................................................
hFl_ENSPANP00000015319 .............................................................................
hFl_ENSPANP00000019493 .............................................................................
hFl_ENSPANP00000015800 ltaivstwlavsskniditehidfatpiqqpameplcngnlptsmhtldhlhgvsnraslhytgesqltevlqnlgk
hFl_ENSPANP00000017125 .............................................................................
hFl_ENSPANP00000011271 .............................................................................
hFl_ENSPANP00000017151 .............................................................................
hFl_ENSPANP00000007093 .............................................................................
hFl_ENSPANP00000007238 .............................................................................
hFl_ENSPANP00000007093 .............................................................................
hFl_ENSPANP00000015526 .............................................................................
hFl_ENSPANP00000010410 .............................................................................
hFl_ENSPANP00000004737 .............................................................................
hFl_ENSPANP00000020946 .............................................................................
hFl_ENSPANP00000020864 .............................................................................
hFl_ENSPANP00000007952 .............................................................................
hFl_ENSPANP00000016788 .............................................................................
hFl_ENSPANP00000004737 .............................................................................
hFl_ENSPANP00000004737 .............................................................................
hFl_ENSPANP00000000707 .............................................................................
hFl_ENSPANP00000004108 .............................................................................
hFl_ENSPANP00000016788 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000003166 .............................................................................
hFl_ENSPANP00000003324 .............................................................................
hFl_ENSPANP00000005479 .............................................................................
hFl_ENSPANP00000003528 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000010352 .............................................................................
hFl_ENSPANP00000012491 .............................................................................
hFl_ENSPANP00000014791 .............................................................................
hFl_ENSPANP00000005591 .............................................................................
hFl_ENSPANP00000015348 .............................................................................
hFl_ENSPANP00000014791 .............................................................................
hFl_ENSPANP00000013486 .............................................................................
hFl_ENSPANP00000015752 .............................................................................
hFl_ENSPANP00000014239 .............................................................................
hFl_ENSPANP00000001617 .............................................................................
hFl_ENSPANP00000017253 .............................................................................
hFl_ENSPANP00000020687 .............................................................................
hFl_ENSPANP00000014947 .............................................................................
hFl_ENSPANP00000015753 .............................................................................
hFl_ENSPANP00000003528 .............................................................................
hFl_ENSPANP00000008218 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000013297 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000007362 .............................................................................
hFl_ENSPANP00000014947 .............................................................................
hFl_ENSPANP00000008383 .............................................................................
hFl_ENSPANP00000017676 .............................................................................
hFl_ENSPANP00000001814 .............................................................................
hFl_ENSPANP00000001168 .............................................................................
hFl_ENSPANP00000003176 .............................................................................
hFl_ENSPANP00000010724 .............................................................................
hFl_ENSPANP00000013376 .............................................................................
hFl_ENSPANP00000013375 .............................................................................
hFl_ENSPANP00000000707 .............................................................................
hFl_ENSPANP00000012992 .............................................................................
hFl_ENSPANP00000020687 .............................................................................
hFl_ENSPANP00000000643 .............................................................................
hFl_ENSPANP00000007559 .............................................................................
hFl_ENSPANP00000003197 .............................................................................
hFl_ENSPANP00000003945 .............................................................................
hFl_ENSPANP00000012699 .............................................................................
hFl_ENSPANP00000004293 .............................................................................
hFl_ENSPANP00000014070 .............................................................................
hFl_ENSPANP00000008096 .............................................................................
hFl_ENSPANP00000014947 .............................................................................
hFl_ENSPANP00000020577 .............................................................................
hFl_ENSPANP00000020573 .............................................................................
hFl_ENSPANP00000015642 .............................................................................
hFl_ENSPANP00000019972 .............................................................................
hFl_ENSPANP00000002155 .............................................................................
hFl_ENSPANP00000003197 .............................................................................
hFl_ENSPANP00000010388 .............................................................................
hFl_ENSPANP00000009536 .............................................................................
hFl_ENSPANP00000013401 .............................................................................
hFl_ENSPANP00000007559 .............................................................................
hFl_ENSPANP00000020038 .............................................................................
hFl_ENSPANP00000020312 .............................................................................
hFl_ENSPANP00000000258 .............................................................................
hFl_ENSPANP00000017676 .............................................................................
hFl_ENSPANP00000006518 .............................................................................
hFl_ENSPANP00000013297 .............................................................................
hFl_ENSPANP00000003504 .............................................................................
hFl_ENSPANP00000017184 .............................................................................
hFl_ENSPANP00000006801 .............................................................................
hFl_ENSPANP00000015190 .............................................................................
hFl_ENSPANP00000001081 .............................................................................
hFl_ENSPANP00000006437 py...........................................................................
hFl_ENSPANP00000012699 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000009269 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000019581 .............................................................................
hFl_ENSPANP00000020572 .............................................................................
hFl_ENSPANP00000007217 .............................................................................
hFl_ENSPANP00000020685 .............................................................................
hFl_ENSPANP00000020899 .............................................................................
hFl_ENSPANP00000008387 .............................................................................
hFl_ENSPANP00000010352 .............................................................................
hFl_ENSPANP00000009338 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000020864 stitpqiqa....................................................................
hFl_ENSPANP00000008387 .............................................................................
hFl_ENSPANP00000009057 spy..........................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000007915 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000015625 .............................................................................
hFl_ENSPANP00000014767 .............................................................................
hFl_ENSPANP00000002080 .............................................................................
hFl_ENSPANP00000007403 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000005487 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000013410 .............................................................................
hFl_ENSPANP00000003097 .............................................................................
hFl_ENSPANP00000020575 .............................................................................
hFl_ENSPANP00000007248 .............................................................................
hFl_ENSPANP00000019375 .............................................................................
hFl_ENSPANP00000003854 .............................................................................
hFl_ENSPANP00000006795 .............................................................................
hFl_ENSPANP00000002479 .............................................................................
hFl_ENSPANP00000017125 .............................................................................
hFl_ENSPANP00000005048 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000019375 .............................................................................
hFl_ENSPANP00000014239 .............................................................................
hFl_ENSPANP00000012835 .............................................................................
hFl_ENSPANP00000001460 .............................................................................
hFl_ENSPANP00000015753 .............................................................................
hFl_ENSPANP00000003968 .............................................................................
hFl_ENSPANP00000006868 .............................................................................
hFl_ENSPANP00000001460 .............................................................................
hFl_ENSPANP00000004313 .............................................................................
hFl_ENSPANP00000001617 .............................................................................
hFl_ENSPANP00000019732 .............................................................................
hFl_ENSPANP00000013913 .............................................................................
hFl_ENSPANP00000004649 .............................................................................
hFl_ENSPANP00000013914 .............................................................................
hFl_ENSPANP00000003176 .............................................................................
hFl_ENSPANP00000003166 .............................................................................
hFl_ENSPANP00000015752 .............................................................................
hFl_ENSPANP00000001460 .............................................................................
hFl_ENSPANP00000004498 .............................................................................
hFl_ENSPANP00000014540 .............................................................................
hFl_ENSPANP00000002479 .............................................................................
hFl_ENSPANP00000017858 .............................................................................
hFl_ENSPANP00000007886 .............................................................................
hFl_ENSPANP00000018968 .............................................................................
hFl_ENSPANP00000015642 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000019484 .............................................................................
hFl_ENSPANP00000019485 .............................................................................
hFl_ENSPANP00000020575 .............................................................................
hFl_ENSPANP00000017457 .............................................................................
hFl_ENSPANP00000020575 .............................................................................
hFl_ENSPANP00000004562 .............................................................................
hFl_ENSPANP00000004438 .............................................................................
hFl_ENSPANP00000008640 .............................................................................
hFl_ENSPANP00000020327 .............................................................................
hFl_ENSPANP00000020572 .............................................................................
hFl_ENSPANP00000016643 .............................................................................
hFl_ENSPANP00000006588 .............................................................................
hFl_ENSPANP00000003995 .............................................................................
hFl_ENSPANP00000007718 .............................................................................
hFl_ENSPANP00000004384 .............................................................................
hFl_ENSPANP00000011118 .............................................................................
hFl_ENSPANP00000004252 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000006588 .............................................................................
hFl_ENSPANP00000001745 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000004313 .............................................................................
hFl_ENSPANP00000004562 .............................................................................
hFl_ENSPANP00000001425 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000019118 .............................................................................
hFl_ENSPANP00000015209 .............................................................................
hFl_ENSPANP00000006801 .............................................................................
hFl_ENSPANP00000003551 .............................................................................
hFl_ENSPANP00000004252 .............................................................................
hFl_ENSPANP00000002479 .............................................................................
hFl_ENSPANP00000004798 .............................................................................
hFl_ENSPANP00000000477 .............................................................................
hFl_ENSPANP00000007362 .............................................................................
hFl_ENSPANP00000002485 .............................................................................
hFl_ENSPANP00000014498 .............................................................................
hFl_ENSPANP00000017253 .............................................................................
hFl_ENSPANP00000016353 .............................................................................
hFl_ENSPANP00000016352 .............................................................................
hFl_ENSPANP00000018429 .............................................................................
hFl_ENSPANP00000013579 .............................................................................
hFl_ENSPANP00000000348 .............................................................................
hFl_ENSPANP00000015511 .............................................................................
hFl_ENSPANP00000007718 .............................................................................
hFl_ENSPANP00000011118 .............................................................................
hFl_ENSPANP00000007718 .............................................................................
hFl_ENSPANP00000015642 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000010920 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000003968 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000009443 .............................................................................
hFl_ENSPANP00000011463 .............................................................................
hFl_ENSPANP00000002961 .............................................................................
hFl_ENSPANP00000017623 .............................................................................
hFl_ENSPANP00000011215 .............................................................................
hFl_ENSPANP00000000119 .............................................................................
hFl_ENSPANP00000002418 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000020421 .............................................................................
hFl_ENSPANP00000008387 .............................................................................
hFl_ENSPANP00000005487 .............................................................................
hFl_ENSPANP00000002155 .............................................................................
hFl_ENSPANP00000002567 .............................................................................
hFl_ENSPANP00000019509 .............................................................................
hFl_ENSPANP00000005069 .............................................................................
hFl_ENSPANP00000000052 .............................................................................
hFl_ENSPANP00000005735 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000018982 .............................................................................
hFl_ENSPANP00000018968 heylgrrswccnsdgallrfyvrvlqkelaastsedthpykeeletaleqcfyclysfpskkskaryleehsvqqvd
hFl_ENSPANP00000008513 .............................................................................
hFl_ENSPANP00000019509 .............................................................................
hFl_ENSPANP00000006588 .............................................................................
hFl_ENSPANP00000011118 .............................................................................
hFl_ENSPANP00000003166 .............................................................................
hFl_ENSPANP00000004798 .............................................................................
hFl_ENSPANP00000015019 .............................................................................
hFl_ENSPANP00000020573 .............................................................................
hFl_ENSPANP00000004562 .............................................................................
hFl_ENSPANP00000004252 .............................................................................
hFl_ENSPANP00000020003 .............................................................................
hFl_ENSPANP00000006922 .............................................................................
hFl_ENSPANP00000001081 .............................................................................
hFl_ENSPANP00000020426 .............................................................................
hFl_ENSPANP00000014026 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000015639 .............................................................................
hFl_ENSPANP00000004438 .............................................................................
hFl_ENSPANP00000015636 .............................................................................
hFl_ENSPANP00000006186 .............................................................................
hFl_ENSPANP00000015209 .............................................................................
hFl_ENSPANP00000000119 .............................................................................
hFl_ENSPANP00000011874 .............................................................................
hFl_ENSPANP00000013299 .............................................................................
hFl_ENSPANP00000003968 .............................................................................
hFl_ENSPANP00000005681 .............................................................................
hFl_ENSPANP00000012992 .............................................................................
hFl_ENSPANP00000004384 .............................................................................
hFl_ENSPANP00000020572 .............................................................................
hFl_ENSPANP00000006404 .............................................................................
hFl_ENSPANP00000000870 .............................................................................
hFl_ENSPANP00000001745 .............................................................................
hFl_ENSPANP00000011077 .............................................................................
hFl_ENSPANP00000003398 .............................................................................
hFl_ENSPANP00000008218 .............................................................................
hFl_ENSPANP00000010361 .............................................................................
hFl_ENSPANP00000017310 .............................................................................
hFl_ENSPANP00000004678 .............................................................................
hFl_ENSPANP00000005519 .............................................................................
hFl_ENSPANP00000008921 .............................................................................
hFl_ENSPANP00000016699 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000015209 .............................................................................
hFl_ENSPANP00000012305 .............................................................................
hFl_ENSPANP00000018202 .............................................................................


                                                                                                    
                                                                                                    
d1kt1a1                .......................................................................EKESKA
hFl_ENSPANP00000004835 .......................................................................-----T
hFl_ENSPANP00000017500 .......................................................................------
hFl_ENSPANP00000011496 .......................................................................FLAAVR
hFl_ENSPANP00000005875 .......................................................................------
hFl_ENSPANP00000015319 .......................................................................YLEAAH
hFl_ENSPANP00000019493 .......................................................................------
hFl_ENSPANP00000015800 .........................................................dqypqqsleqigtrIAKVLE
hFl_ENSPANP00000017125 .......................................................................-----D
hFl_ENSPANP00000011271 .......................................................................-----Q
hFl_ENSPANP00000017151 .......................................................................-----Q
hFl_ENSPANP00000007093 .......................................................................-----R
hFl_ENSPANP00000007238 .......................................................................FNE---
hFl_ENSPANP00000007093 .......................................................................FEKAVT
hFl_ENSPANP00000015526 .......................................................................------
hFl_ENSPANP00000010410 .......................................................................------
hFl_ENSPANP00000004737 .......................................................................-----E
hFl_ENSPANP00000020946 .......................................................................-----K
hFl_ENSPANP00000020864 .......................................................................-----R
hFl_ENSPANP00000007952 .......................................................................-----R
hFl_ENSPANP00000016788 .......................................................................-----E
hFl_ENSPANP00000004737 .......................................................................-----K
hFl_ENSPANP00000004737 .......................................................................-----K
hFl_ENSPANP00000000707 .......................................................................LKDSIK
hFl_ENSPANP00000004108 .......................................................................-----E
hFl_ENSPANP00000016788 .......................................................................-----E
hFl_ENSPANP00000015646 .......................................................................-----N
hFl_ENSPANP00000015647 .......................................................................-----N
hFl_ENSPANP00000003166 .......................................................................EH---Y
hFl_ENSPANP00000003324 .......................................................................-----E
hFl_ENSPANP00000005479 .......................................................................SEEAQK
hFl_ENSPANP00000003528 .......................................................................-----D
hFl_ENSPANP00000015647 .......................................................................-----S
hFl_ENSPANP00000014391 .......................................................................-----K
hFl_ENSPANP00000015646 .......................................................................-----S
hFl_ENSPANP00000015646 .......................................................................-----K
hFl_ENSPANP00000015647 .......................................................................-----K
hFl_ENSPANP00000010352 .......................................................................KKYAAR
hFl_ENSPANP00000012491 .......................................................................EKESKA
hFl_ENSPANP00000014791 .......................................................................FLKAIE
hFl_ENSPANP00000005591 .......................................................................-----E
hFl_ENSPANP00000015348 .......................................................................-----R
hFl_ENSPANP00000014791 .......................................................................-----Y
hFl_ENSPANP00000013486 .......................................................................-----T
hFl_ENSPANP00000015752 .......................................................................-----G
hFl_ENSPANP00000014239 .......................................................................YRVVAC
hFl_ENSPANP00000001617 .......................................................................-----G
hFl_ENSPANP00000017253 .......................................................................IQEAAG
hFl_ENSPANP00000020687 .......................................................................MDRALE
hFl_ENSPANP00000014947 .......................................................................-----S
hFl_ENSPANP00000015753 .......................................................................-----G
hFl_ENSPANP00000003528 .......................................................................-----A
hFl_ENSPANP00000008218 .......................................................................YRRLLQ
hFl_ENSPANP00000015646 .......................................................................-----G
hFl_ENSPANP00000013297 .......................................................................-----K
hFl_ENSPANP00000015647 .......................................................................-----G
hFl_ENSPANP00000007362 .......................................................................-----K
hFl_ENSPANP00000014947 .......................................................................-----K
hFl_ENSPANP00000008383 .......................................................................TADRAK
hFl_ENSPANP00000017676 .......................................................................-----L
hFl_ENSPANP00000001814 .......................................................................-----C
hFl_ENSPANP00000001168 .......................................................................-----K
hFl_ENSPANP00000003176 .......................................................................-----P
hFl_ENSPANP00000010724 .......................................................................-----P
hFl_ENSPANP00000013376 .......................................................................-----A
hFl_ENSPANP00000013375 .......................................................................-----A
hFl_ENSPANP00000000707 .......................................................................TNHIVS
hFl_ENSPANP00000012992 .......................................................................-----E
hFl_ENSPANP00000020687 .......................................................................-----N
hFl_ENSPANP00000000643 .......................................................................-----E
hFl_ENSPANP00000007559 .......................................................................-----K
hFl_ENSPANP00000003197 .......................................................................-----E
hFl_ENSPANP00000003945 .......................................................................-----P
hFl_ENSPANP00000012699 .......................................................................-----T
hFl_ENSPANP00000004293 .......................................................................GCRLFN
hFl_ENSPANP00000014070 .......................................................................-----R
hFl_ENSPANP00000008096 .......................................................................MKTEPS
hFl_ENSPANP00000014947 .......................................................................-----E
hFl_ENSPANP00000020577 .......................................................................FKAAME
hFl_ENSPANP00000020573 .......................................................................LKQAIE
hFl_ENSPANP00000015642 .......................................................................-----N
hFl_ENSPANP00000019972 .......................................................................------
hFl_ENSPANP00000002155 .......................................................................LVDCNP
hFl_ENSPANP00000003197 .......................................................................FEEVIK
hFl_ENSPANP00000010388 .......................................................................-----K
hFl_ENSPANP00000009536 .......................................................................-----A
hFl_ENSPANP00000013401 .......................................................................-----K
hFl_ENSPANP00000007559 .......................................................................-----H
hFl_ENSPANP00000020038 .......................................................................-----K
hFl_ENSPANP00000020312 .......................................................................-----V
hFl_ENSPANP00000000258 .......................................................................-----K
hFl_ENSPANP00000017676 .......................................................................-----S
hFl_ENSPANP00000006518 .......................................................................-----Q
hFl_ENSPANP00000013297 .......................................................................-----H
hFl_ENSPANP00000003504 .......................................................................FEEEAQ
hFl_ENSPANP00000017184 .......................................................................EEQSKT
hFl_ENSPANP00000006801 .......................................................................-----D
hFl_ENSPANP00000015190 .......................................................................ESPGSK
hFl_ENSPANP00000001081 .......................................................................-----E
hFl_ENSPANP00000006437 .......................................................................EDGEKE
hFl_ENSPANP00000012699 .......................................................................-----R
hFl_ENSPANP00000007476 .......................................................................-----K
hFl_ENSPANP00000009269 .......................................................................DMR--P
hFl_ENSPANP00000014391 .......................................................................-----Q
hFl_ENSPANP00000019581 .......................................................................EVQWLK
hFl_ENSPANP00000020572 .......................................................................VQEALE
hFl_ENSPANP00000007217 .......................................................................EEQRRL
hFl_ENSPANP00000020685 .......................................................................-----Y
hFl_ENSPANP00000020899 .......................................................................DLK--T
hFl_ENSPANP00000008387 .......................................................................LTTLVE
hFl_ENSPANP00000010352 .......................................................................-----K
hFl_ENSPANP00000009338 .......................................................................EEQRRL
hFl_ENSPANP00000018160 .......................................................................-----N
hFl_ENSPANP00000020864 .......................................................................FNLQKA
hFl_ENSPANP00000008387 .......................................................................-----R
hFl_ENSPANP00000009057 .......................................................................EDGEKE
hFl_ENSPANP00000018160 .......................................................................-----V
hFl_ENSPANP00000007915 .......................................................................-----S
hFl_ENSPANP00000003731 .......................................................................YRELCE
hFl_ENSPANP00000015625 .......................................................................EAQH-L
hFl_ENSPANP00000014767 .......................................................................-----Q
hFl_ENSPANP00000002080 .......................................................................-----K
hFl_ENSPANP00000007403 .......................................................................-----E
hFl_ENSPANP00000007476 .......................................................................------
hFl_ENSPANP00000005487 .......................................................................-----R
hFl_ENSPANP00000003731 .......................................................................-----S
hFl_ENSPANP00000013410 .......................................................................VA---L
hFl_ENSPANP00000003097 .......................................................................-----G
hFl_ENSPANP00000020575 .......................................................................-----A
hFl_ENSPANP00000007248 .......................................................................------
hFl_ENSPANP00000019375 .......................................................................-----H
hFl_ENSPANP00000003854 .......................................................................SPEWIQ
hFl_ENSPANP00000006795 .......................................................................-----E
hFl_ENSPANP00000002479 .......................................................................-----G
hFl_ENSPANP00000017125 .......................................................................------
hFl_ENSPANP00000005048 .......................................................................LNEYLE
hFl_ENSPANP00000003731 .......................................................................-----K
hFl_ENSPANP00000018160 .......................................................................-----K
hFl_ENSPANP00000019375 .......................................................................-----R
hFl_ENSPANP00000014239 .......................................................................-----K
hFl_ENSPANP00000012835 .......................................................................STKKQT
hFl_ENSPANP00000001460 .......................................................................LKRAVR
hFl_ENSPANP00000015753 .......................................................................-----E
hFl_ENSPANP00000003968 .......................................................................VPENLG
hFl_ENSPANP00000006868 .......................................................................-----R
hFl_ENSPANP00000001460 .......................................................................FEKTIM
hFl_ENSPANP00000004313 .......................................................................-----R
hFl_ENSPANP00000001617 .......................................................................-----G
hFl_ENSPANP00000019732 .......................................................................-----E
hFl_ENSPANP00000013913 .......................................................................ILIPKE
hFl_ENSPANP00000004649 .......................................................................-----C
hFl_ENSPANP00000013914 .......................................................................ILIPKE
hFl_ENSPANP00000003176 .......................................................................-----P
hFl_ENSPANP00000003166 .......................................................................-----E
hFl_ENSPANP00000015752 .......................................................................-----E
hFl_ENSPANP00000001460 .......................................................................-----Q
hFl_ENSPANP00000004498 .......................................................................-----D
hFl_ENSPANP00000014540 .......................................................................AKLAVQ
hFl_ENSPANP00000002479 .......................................................................-----Q
hFl_ENSPANP00000017858 .......................................................................-----K
hFl_ENSPANP00000007886 .......................................................................-----K
hFl_ENSPANP00000018968 .......................................................................DEKEGL
hFl_ENSPANP00000015642 .......................................................................-----S
hFl_ENSPANP00000003731 .......................................................................-----S
hFl_ENSPANP00000019484 .......................................................................-----P
hFl_ENSPANP00000019485 .......................................................................-----P
hFl_ENSPANP00000020575 .......................................................................-----Q
hFl_ENSPANP00000017457 .......................................................................-----T
hFl_ENSPANP00000020575 .......................................................................-----E
hFl_ENSPANP00000004562 .......................................................................-----Q
hFl_ENSPANP00000004438 .......................................................................FGKAIE
hFl_ENSPANP00000008640 .......................................................................-----K
hFl_ENSPANP00000020327 .......................................................................-----E
hFl_ENSPANP00000020572 .......................................................................-----Q
hFl_ENSPANP00000016643 .......................................................................------
hFl_ENSPANP00000006588 .......................................................................-----K
hFl_ENSPANP00000003995 .......................................................................-----N
hFl_ENSPANP00000007718 .......................................................................LAQG-E
hFl_ENSPANP00000004384 .......................................................................LTVEER
hFl_ENSPANP00000011118 .......................................................................LAQG-E
hFl_ENSPANP00000004252 .......................................................................-----Q
hFl_ENSPANP00000007476 .......................................................................-----V
hFl_ENSPANP00000006588 .......................................................................-----L
hFl_ENSPANP00000001745 .......................................................................-----K
hFl_ENSPANP00000014391 .......................................................................------
hFl_ENSPANP00000004313 .......................................................................DDGKEE
hFl_ENSPANP00000004562 .......................................................................-----Q
hFl_ENSPANP00000001425 .......................................................................-----G
hFl_ENSPANP00000015647 .......................................................................LKIGTC
hFl_ENSPANP00000019118 .......................................................................TKEL-P
hFl_ENSPANP00000015209 .......................................................................--FMKT
hFl_ENSPANP00000006801 .......................................................................TARELE
hFl_ENSPANP00000003551 .......................................................................-----E
hFl_ENSPANP00000004252 .......................................................................-----Q
hFl_ENSPANP00000002479 .......................................................................-----G
hFl_ENSPANP00000004798 .......................................................................-----N
hFl_ENSPANP00000000477 .......................................................................-----E
hFl_ENSPANP00000007362 .......................................................................-----V
hFl_ENSPANP00000002485 .......................................................................------
hFl_ENSPANP00000014498 .......................................................................RIIKEE
hFl_ENSPANP00000017253 .......................................................................EEDRAV
hFl_ENSPANP00000016353 .......................................................................------
hFl_ENSPANP00000016352 .......................................................................------
hFl_ENSPANP00000018429 .......................................................................-----G
hFl_ENSPANP00000013579 .......................................................................YPFWTP
hFl_ENSPANP00000000348 .......................................................................-----D
hFl_ENSPANP00000015511 .......................................................................-----E
hFl_ENSPANP00000007718 .......................................................................-----R
hFl_ENSPANP00000011118 .......................................................................-----R
hFl_ENSPANP00000007718 .......................................................................-----D
hFl_ENSPANP00000015642 .......................................................................-----R
hFl_ENSPANP00000001022 .......................................................................-----G
hFl_ENSPANP00000010920 .......................................................................DASAED
hFl_ENSPANP00000007476 .......................................................................------
hFl_ENSPANP00000003968 .......................................................................ILRSIE
hFl_ENSPANP00000001022 .......................................................................------
hFl_ENSPANP00000009443 .......................................................................-----E
hFl_ENSPANP00000011463 .......................................................................-----K
hFl_ENSPANP00000002961 .......................................................................------
hFl_ENSPANP00000017623 .......................................................................-----D
hFl_ENSPANP00000011215 .......................................................................------
hFl_ENSPANP00000000119 .......................................................................-----L
hFl_ENSPANP00000002418 .......................................................................DLWRCY
hFl_ENSPANP00000014391 .......................................................................------
hFl_ENSPANP00000020421 .......................................................................KLSKHG
hFl_ENSPANP00000008387 .......................................................................-----R
hFl_ENSPANP00000005487 .......................................................................-----L
hFl_ENSPANP00000002155 .......................................................................------
hFl_ENSPANP00000002567 .......................................................................-----D
hFl_ENSPANP00000019509 .......................................................................-----E
hFl_ENSPANP00000005069 .......................................................................-----D
hFl_ENSPANP00000000052 .......................................................................EGSVCE
hFl_ENSPANP00000005735 .......................................................................KT---E
hFl_ENSPANP00000001022 .......................................................................-----R
hFl_ENSPANP00000018160 .......................................................................-----A
hFl_ENSPANP00000018982 .......................................................................-----G
hFl_ENSPANP00000018968 liwedalfmfeyfkpktlpefdsyktstvsadlanllkriativprterpalsldkvsayiegtstevpclPEGADP
hFl_ENSPANP00000008513 .......................................................................ALQLVD
hFl_ENSPANP00000019509 .......................................................................-----A
hFl_ENSPANP00000006588 .......................................................................------
hFl_ENSPANP00000011118 .......................................................................-----D
hFl_ENSPANP00000003166 .......................................................................-----K
hFl_ENSPANP00000004798 .......................................................................-----Q
hFl_ENSPANP00000015019 .......................................................................------
hFl_ENSPANP00000020573 .......................................................................-----Q
hFl_ENSPANP00000004562 .......................................................................-----E
hFl_ENSPANP00000004252 .......................................................................-----E
hFl_ENSPANP00000020003 .......................................................................-----D
hFl_ENSPANP00000006922 .......................................................................-----N
hFl_ENSPANP00000001081 .......................................................................LNLA--
hFl_ENSPANP00000020426 .......................................................................QERSKR
hFl_ENSPANP00000014026 .......................................................................-----K
hFl_ENSPANP00000015646 .......................................................................------
hFl_ENSPANP00000015647 .......................................................................------
hFl_ENSPANP00000015639 .......................................................................------
hFl_ENSPANP00000004438 .......................................................................LEEVVR
hFl_ENSPANP00000015636 .......................................................................------
hFl_ENSPANP00000006186 .......................................................................-----G
hFl_ENSPANP00000015209 .......................................................................PLRKQE
hFl_ENSPANP00000000119 .......................................................................------
hFl_ENSPANP00000011874 .......................................................................LNKRPD
hFl_ENSPANP00000013299 .......................................................................------
hFl_ENSPANP00000003968 .......................................................................-----Q
hFl_ENSPANP00000005681 .......................................................................L----D
hFl_ENSPANP00000012992 .......................................................................LNLA--
hFl_ENSPANP00000004384 .......................................................................-----Q
hFl_ENSPANP00000020572 .......................................................................-----E
hFl_ENSPANP00000006404 .......................................................................------
hFl_ENSPANP00000000870 .......................................................................------
hFl_ENSPANP00000001745 .......................................................................LHWKHS
hFl_ENSPANP00000011077 .......................................................................-----G
hFl_ENSPANP00000003398 .......................................................................-----S
hFl_ENSPANP00000008218 .......................................................................LFEYIF
hFl_ENSPANP00000010361 .......................................................................------
hFl_ENSPANP00000017310 .......................................................................------
hFl_ENSPANP00000004678 .......................................................................ERILGP
hFl_ENSPANP00000005519 .......................................................................VRYTLS
hFl_ENSPANP00000008921 .......................................................................PS----
hFl_ENSPANP00000016699 .......................................................................---LLQ
hFl_ENSPANP00000001022 .......................................................................-----E
hFl_ENSPANP00000015209 .......................................................................EEMDGL
hFl_ENSPANP00000012305 .......................................................................---LLQ
hFl_ENSPANP00000018202 .......................................................................------


                       60           70                  80                90                        
                        |            |                   |                 |                        
d1kt1a1                SESFL...LAAFLNL.AMCYL.KLR........EY........TKAVECCDKALGL.....................
hFl_ENSPANP00000004835 LLKKN...MLLYFAY.ADYEE.SRM........KY........EKVHSIYNRLLAIedidptlvyiqymkfarraeg
hFl_ENSPANP00000017500 ----C...QHCLVHL.GDIAR.YRN........QT........SQAESYYRHAAQL.....................
hFl_ENSPANP00000011496 LDPTSid.PDVQCGL.GVLFN.LSG........EY........DKAVDCFTAALSV.....................
hFl_ENSPANP00000005875 -----...-------.-----.---........--........-LAERFYYQALSV.....................
hFl_ENSPANP00000015319 QNGDMid.PDLQTGL.GVLFH.LSG........EF........NRAIDAFNAALTV.....................
hFl_ENSPANP00000019493 -----...-------.-----.--A........NY........GKARSWYLKAQHI.....................
hFl_ENSPANP00000015800 KNQTS...WVLSSMA.ALYWR.VKG........QG........KKAIDCLRQALHY.....................
hFl_ENSPANP00000017125 VDYRN...ITLWLKY.AEMEM.KNR........QV........NHARNIWDRAITT.....................
hFl_ENSPANP00000011271 SKHDA...ATCFVDA.GNAF-.KKA........DP........QEAINCLMRAIEI.....................
hFl_ENSPANP00000017151 SKHDS...ATSFVDA.GNAYK.KA-........DP........QEAINCLNAAIDI.....................
hFl_ENSPANP00000007093 ISPTF...ADAYSNM.GNTLK.EMQ........DV........QGALQCYTRAIQI.....................
hFl_ENSPANP00000007238 SGDPS...CVIMQNW.ARIEA.RLCn.......NM........QKARELWDSIMTRg....................
hFl_ENSPANP00000007093 LDPNF...LDAYINL.GNVLK.EAR........IF........DRAVAAYLRALSL.....................
hFl_ENSPANP00000015526 -----...-------.-----.---........DI........RKGIVLLEELLPK.....................
hFl_ENSPANP00000010410 -----...----GKA.AVAFK.NAK........QF........EQAKDACLREAVA.....................
hFl_ENSPANP00000004737 LDPTN...MTYITNQ.AAVYF.EKG........DY........NKCRELCEKAIDV.....................
hFl_ENSPANP00000020946 RFRQE...KAVWIKY.GAFLL.RRS........QA........EASHRVLQRALEC.....................
hFl_ENSPANP00000020864 VNPRH...YNAWYGL.GMIYY.KQE........KF........SLAEMHFQKALDI.....................
hFl_ENSPANP00000007952 LNPKY...VHAMNNL.GNILK.ERN........EL........QEAEELLSLAVRI.....................
hFl_ENSPANP00000016788 CVLGL...AMVRLRR.VSLER.RHG........NL........EEAEHLLQDAIKN.....................
hFl_ENSPANP00000004737 RNPKD...AKLYSNR.AACYT.KLL........EF........QLALKDCEECIQL.....................
hFl_ENSPANP00000004737 LDPHN...HVLYSNR.SAAYA.KKG........DY........QKAYEDGCKTVDL.....................
hFl_ENSPANP00000000707 YGPEF...ADAYSSL.ASLLA.EQE........RF........KEAEEIYQAGIKN.....................
hFl_ENSPANP00000004108 LDSNN...AVYYCNR.AAAQS.KLG........HY........TDAIKDCEKAIAI.....................
hFl_ENSPANP00000016788 NNPQD...FTGWVYL.LQYVE.QEN........HL........MAARKAFDRFFIH.....................
hFl_ENSPANP00000015646 DRASQ...ASTHGNL.AVAYQ.ALG........AH........DRALQHYQNHLNI.....................
hFl_ENSPANP00000015647 DRASQ...ASTHGNL.AVAYQ.ALG........AH........DRALQHYQNHLNI.....................
hFl_ENSPANP00000003166 YNAIS...VTTSYNL.ARLYE.AMC........EF........HEAEKLYKNILRE.....................
hFl_ENSPANP00000003324 LNPAN...AVYFCNR.AAAYS.KLG........NY........AGAVQDCERAICI.....................
hFl_ENSPANP00000005479 AQALR...LASHLNL.AMCHL.KLQ........AF........SAAIESCNKALEL.....................
hFl_ENSPANP00000003528 ADPYN...PVLPTNR.ASAYF.RLK........KF........AVAESDCNLAIAL.....................
hFl_ENSPANP00000015647 DLPGE...CRAHGHL.AAVYM.ALG........KY........TMAFKCYEEQLDL.....................
hFl_ENSPANP00000014391 KCPHS...TPLWLLL.SRLEE.KVG........QL........TRARAILEKSRLK.....................
hFl_ENSPANP00000015646 DLPGE...CRAHGHL.AAVYM.ALG........KY........TMAFKCYEEQLDL.....................
hFl_ENSPANP00000015646 DRALE...SDAACGL.GGVYQ.QMG........EY........DTALQYHQLDLQI.....................
hFl_ENSPANP00000015647 DRALE...SDAACGL.GGVYQ.QMG........EY........DTALQYHQLDLQI.....................
hFl_ENSPANP00000010352 IAPNH...LNVYINL.ANLIR.ANEs.......RL........EEADQLYRQAISM.....................
hFl_ENSPANP00000012491 SESFL...LAAFLNL.AMCYL.KLR........EY........TKAVECCDKALGL.....................
hFl_ENSPANP00000014791 LDPTK...GNCYMHY.GQFLL.EEA........RL........IEAAEMAKKAAEL.....................
hFl_ENSPANP00000005591 LNPSN...AIYYGNR.SLAYL.RTE........CY........GYALGDATRAIEL.....................
hFl_ENSPANP00000015348 NDSSC...TEALYNIeGLTYE.KLN........RL........DEALDCFLKLHAI.....................
hFl_ENSPANP00000014791 YRSNM...ADMLYNL.GLLLQ.ENS........RF........SEALHYYKLAIGS.....................
hFl_ENSPANP00000013486 RNPLV...AVYYTNR.ALCYL.KMQ........QH........EQALADCRRALEL.....................
hFl_ENSPANP00000015752 DKAAE...RRAYSNL.GNAHV.FLG........RF........DVAAEYYKKTLQL.....................
hFl_ENSPANP00000014239 AVPES...PPLWNNI.GMCFF.GKK........KY........VAAISCLKRANYL.....................
hFl_ENSPANP00000001617 DKAAE...RRAYSNL.GNAYI.FLG........EF........ETASEYYKKTLLL.....................
hFl_ENSPANP00000017253 LFPTS...HSVLYMR.GRLAE.VKG........SL........EEAKQLYKEALTV.....................
hFl_ENSPANP00000020687 FAPAC...HRFKILK.AECLA.MLG........RY........PEAQSVASDILRM.....................
hFl_ENSPANP00000014947 ALP-T...VVAYNNR.AQAQI.KLQ........NW........NSAFQDCEKVLEL.....................
hFl_ENSPANP00000015753 DKAAE...RRAYSNL.GNAHV.FLG........RF........DVAAEYYKKTLQL.....................
hFl_ENSPANP00000003528 ADGAN...ALLPANR.AMAYL.KIQ........KY........EEAEKDCTQAILL.....................
hFl_ENSPANP00000008218 MGIYN...GQLFNNL.GLCCF.YAQ........QY........DMTLTSFERALSL.....................
hFl_ENSPANP00000015646 NKREE...ARAYSNL.GSAYH.YRR........NF........DKAMSYHNYVLEL.....................
hFl_ENSPANP00000013297 DHPDV...AKQLNNL.ALLCQ.NQG........KY........EEVEYYYQRALEIyqtklgpd.............
hFl_ENSPANP00000015647 NKREE...ARAYSNL.GSAYH.YRR........NF........DKAMSYHNYVLEL.....................
hFl_ENSPANP00000007362 LNPRY...LGAWTLM.GHEYM.EMK........NT........SAAIQAYRHAIEV.....................
hFl_ENSPANP00000014947 INNKE...CAIYTNR.ALCYL.KLC........QF........EEAKQDCDQALQL.....................
hFl_ENSPANP00000008383 LQPIA...LNCVLNI.GACKL.KMS........NW........QGAIDSCLEALEI.....................
hFl_ENSPANP00000017676 CSNLE...SATYSNR.ALCYL.VLK........QY........TEAVKDCTEAIKL.....................
hFl_ENSPANP00000001814 FQKER...SILFSNR.AAARM.KQD........KK........EMAINDCSKAIQL.....................
hFl_ENSPANP00000001168 INPMQ...LGVWFSL.GCAYL.ALE........DY........QGSAKAFQRCVTL.....................
hFl_ENSPANP00000003176 DHPDC...AQSLNNL.AALCN.EKK........QY........DKAEELYERALDIrrralapdhpslaytvkhlai
hFl_ENSPANP00000010724 GPPER...TVLHANL.AACQL.LLG........QP........QLAAQSCDRVLER.....................
hFl_ENSPANP00000013376 TPQDQ...AILHRNR.AACHL.KLE........DY........DKAETEASKAIEK.....................
hFl_ENSPANP00000013375 TPQDQ...AILHRNR.AACHL.KLE........DY........DKAETEASKAIEK.....................
hFl_ENSPANP00000000707 EETGC...LECYRLL.SAIYS.KQE........NH........DKALDVIDKALQL.....................
hFl_ENSPANP00000012992 YRPEN...HLLYGNR.ALCFL.RTG........QF........RNALGDGKRATIL.....................
hFl_ENSPANP00000020687 NIKTN...AKLYCNR.GTVNS.KLR........KL........DDAIEDCTNAVKL.....................
hFl_ENSPANP00000000643 KLKDV...KVLYTNR.AQAYM.KLK........NY........EKTLVDCEWALKC.....................
hFl_ENSPANP00000007559 FHPDV...AKQLSNL.ALLCQ.NQG........KA........EEVEYYYRRALEIyatrlgpd.............
hFl_ENSPANP00000003197 KNVDL...STFYQNR.AAAFE.QLQ........KW........KEVAQDCTKAVEL.....................
hFl_ENSPANP00000003945 EHPAV...AATLNNL.AVLYG.KRG........RY........REAEPLCQRALEIrekvlgad.............
hFl_ENSPANP00000012699 NHPDV...AKQLNNL.ALLCQ.NQG........KY........EAVERYYQRALAIyegqlgpd.............
hFl_ENSPANP00000004293 ISDQH...AEPWVVS.GCHSF.YSK........RY........SRALYLGAKAIQL.....................
hFl_ENSPANP00000014070 LNNKM...PLLYLNR.AACHL.KLK........NL........HKAIEDSSKALELlmppvt...............
hFl_ENSPANP00000008096 IAEYT...IRSKERI.CHCFS.KDE........KP........VEAIRVCSEVLQM.....................
hFl_ENSPANP00000014947 IADDL...SILYSNR.AACYL.KEG........NC........SGCIQDCNRALEL.....................
hFl_ENSPANP00000020577 RDSMF...AFAYTDL.ANMYA.EGG........QY........SNAEDIFWKALRLenitddhkhqihyhygrfqef
hFl_ENSPANP00000020573 LSPDN...QYVKVLL.GLKLQ.KMN........KE........AEGEQLVEEALEK.....................
hFl_ENSPANP00000015642 LFPMS...HNVLYMR.GQIAE.LRG........SM........DEARRWYEEALAI.....................
hFl_ENSPANP00000019972 -----...-------.-----.---........--........-SARQLFLRALRF.....................
hFl_ENSPANP00000002155 CTLSN...AEIQFHI.AHLYE.TQR........KY........HSAKEAYEQLLQTenlsaqvkatvlqqlgwmhht
hFl_ENSPANP00000003197 KFPRC...AEGYALY.AQALT.DQQ........QF........GKADEMYDKCIDL.....................
hFl_ENSPANP00000010388 LAPND...HLLYSNR.SQIYF.TLE........SH........ENALHDAEIACKL.....................
hFl_ENSPANP00000009536 DPDLN...AVLYTNR.AAAQY.YLG........NF........RSALNDVTAARKL.....................
hFl_ENSPANP00000013401 LNPRL...AILYAKR.ASVFV.KLQ........KP........NAAIRDCDRAIEI.....................
hFl_ENSPANP00000007559 DHPDV...ATMLNIL.ALVYR.DQN........KY........KEAAHLLNDALAIrektlgkd.............
hFl_ENSPANP00000020038 DKALL...ATLYRNR.AACGL.KTE........SY........VQAASDASRAIDI.....................
hFl_ENSPANP00000020312 DASEM...HFIFLRL.GLIYL.EEK........EY........EQAKKIYMQACKR.....................
hFl_ENSPANP00000000258 LAPND...HLLYSNR.SQIYF.TLE........SH........ENALHDAEIACKL.....................
hFl_ENSPANP00000017676 DPEEE...SVLFSNR.AACHL.KDG........NC........RDCIKDCTSALAL.....................
hFl_ENSPANP00000006518 RAPHN...AMLYGNR.AAAYM.KRKwdg.....DH........YDALRDCLKAISL.....................
hFl_ENSPANP00000013297 DHPDV...ATMLNIL.ALVYR.DQN........KY........KDAANLLNDALAIrektlgkd.............
hFl_ENSPANP00000003504 LLQLK...VKCLNNL.AASQL.KLD........HY........RAALRSCSLVLEH.....................
hFl_ENSPANP00000017184 VEAIE...IDCYNSL.AACLL.QAElv......NY........ERVKEYCLKVLKK.....................
hFl_ENSPANP00000006801 DAMLE...CRVCCSL.GSFYA.QVK........DY........EKALFFPCKAAEL.....................
hFl_ENSPANP00000015190 CSPEDl..ATAYNNR.GQIKY.FRV........DF........YEAMDDYTSAIEV.....................
hFl_ENSPANP00000001081 YRPEN...HLLYGNR.-LCFL.RTG........QF........RNALGDGKRATIL.....................
hFl_ENSPANP00000006437 PPTTL...LWVQYFL.AQHFD.KLG........QY........SLALDYINAAIAS.....................
hFl_ENSPANP00000012699 GHPDV...ATMLNIL.ALVYR.DQN........KY........KEAAHLLNDALSIrestlgpd.............
hFl_ENSPANP00000007476 QVDDL...ASVWCQC.GELEL.RHE........NY........DEALRLLRKATALparraeyfdgsepvqnr....
hFl_ENSPANP00000009269 FNELR...VSLYLNL.SRCRR.KTN........DF........GMAEEFASKALEM.....................
hFl_ENSPANP00000014391 VFPSK...KSVWLRA.AYFEK.NHG........TR........ESLEALLQRAVAH.....................
hFl_ENSPANP00000019581 LEKMI...NTLTLNY.CQCLL.KKE........EY........YEVLEHTSDILRH.....................
hFl_ENSPANP00000020572 KAPGV...TDVLRSA.AKFYR.RKD........EP........DKAIELLKKALEY.....................
hFl_ENSPANP00000007217 VESTE...VECYDSL.TACLL.QSElv......NY........ERVREYCLKVLEK.....................
hFl_ENSPANP00000020685 LQDGD...KNCLVAR.SKCFL.KMG........DL........ERSLEDAEASLQS.....................
hFl_ENSPANP00000020899 FRELK...VSLLLNL.SRCRR.KMN........DF........GMAEEFATKALEL.....................
hFl_ENSPANP00000008387 QNPEDm..GDLYLDV.AEAFL.DVG........EY........NSALPLLSALVCS.....................
hFl_ENSPANP00000010352 LQADF...RSALFNL.ALLYS.QTS........KE........LKALPILEELLRY.....................
hFl_ENSPANP00000009338 VESTE...VECYDSL.TACLL.QSElv......NY........ERVREYCLKVLEK.....................
hFl_ENSPANP00000018160 QNPKD...GTLASKM.GKALI.KTH........NY........SMAITYYETALKS.....................
hFl_ENSPANP00000020864 AAEGL...MSLLREM.GKGYL.ALCsy......NC........KEAINILSHLPSH.....................
hFl_ENSPANP00000008387 QAPLA...YEPFSTL.AMIYE.DQG........DM........EKSLQFELIAAHL.....................
hFl_ENSPANP00000009057 PPTTL...LWVQYFL.AQHFD.KLG........QY........SLALDYINAAIAS.....................
hFl_ENSPANP00000018160 HCETD...IKIMLEL.ARLYL.AQD........DP........DSCLRQCALLLQS.....................
hFl_ENSPANP00000007915 DKKME...GEASYYL.GLAHL.AAE........EY........ETALTVLDTYCKI.....................
hFl_ENSPANP00000003731 HLP-G...PHTSLLL.GDALM.SIL........EP........EKALEVYDEAYRQ.....................
hFl_ENSPANP00000015625 VEAAK...LPVLLNL.SFTYL.KLD........RP........TIALRYGEQALII.....................
hFl_ENSPANP00000014767 LTPND...ATLYEMK.SQVLM.SLH........EM........FPAVHAAEMAVQR.....................
hFl_ENSPANP00000002080 LNPQD...HRLFGNR.SFCHE.RLG........QP........VWALADAQVALTL.....................
hFl_ENSPANP00000007403 EKPDD...AQYYCQR.AYCHI.LLG........NY........CVAVADAKKSLKL.....................
hFl_ENSPANP00000007476 ---PKya.KTLYLLY.AQLEE.EWG........LA........RHAMAVYERATRAvepaqqydmfniyikraaeiy
hFl_ENSPANP00000005487 AEPEN...VQALCGR.ALVHL.ALD........QL........QEAVDDILSALKLgpgtvvpelrslkpeaqalit
hFl_ENSPANP00000003731 YLPTD...NKVMLEL.AQLYL.LQG........HL........DLCEQHCAILLQT.....................
hFl_ENSPANP00000013410 PRELL...CKLHVNR.AACYF.TMG........LY........EKALEDSEKALGL.....................
hFl_ENSPANP00000003097 VPPRDl..AVLLCNK.SNAFF.SLG........KW........NEAFVAAKECLQW.....................
hFl_ENSPANP00000020575 NMSSQ...TYVFRYA.AKFYR.RKG........SV........DKALELLKKALQE.....................
hFl_ENSPANP00000007248 --DPH...SRICFNI.GCMHT.ILK........NM........TEAEKAFTKSINR.....................
hFl_ENSPANP00000019375 LDPQL...VDFYALR.AEAYL.QLC........DF........SSAAQNLRRAYSL.....................
hFl_ENSPANP00000003854 LDQQI...TPLLLNY.CQCKL.VAE........EY........YEVLDHCSSILNK.....................
hFl_ENSPANP00000006795 IDKQN...VEALVAR.GALYA.TKG........SL........NKAIEDFELALEN.....................
hFl_ENSPANP00000002479 QRWEQ...GRSFGSL.AFALS.QLG........DH........KAARDNYLHALQA.....................
hFl_ENSPANP00000017125 -----...-------.-----.---........--........----NLYRRLLQR.....................
hFl_ENSPANP00000005048 QFVGD...QEAWHEL.AELYI.NEH........DY........AKAAFCLEELMMT.....................
hFl_ENSPANP00000003731 ISRGF...REAYVLR.GWVDL.TSD........KPhta.....KKAIEYLEQGIQD.....................
hFl_ENSPANP00000018160 MSDGS...KQGHVLK.AWLDI.TRGkdp.....YT........KKALKYFEEGLQ-.....................
hFl_ENSPANP00000019375 DEQQE...KGLYINR.GDCFF.QLG........YL........AFAEADYQQALAL.....................
hFl_ENSPANP00000014239 LNQKD...WEISHNL.GVCYI.YLK........QF........NKAQDQLHNALNL.....................
hFl_ENSPANP00000012835 LIESN...MLIILKI.AFLHL.GQN........NF........AEAHRFFTEILRM.....................
hFl_ENSPANP00000001460 LNPDD...VYIRVLL.ALKLQ.DGG........QE........AEGEKYIEEALTS.....................
hFl_ENSPANP00000015753 DLKTL...SAIYSQL.GNAYF.YLK........EH........GRALEYHKHDLLL.....................
hFl_ENSPANP00000003968 LQEGT...HELCYNT.ACALI.GQG........QL........NQAMKILQKAEDLcrrslsedtdgteedp.....
hFl_ENSPANP00000006868 AEPSD...LIVKIYR.AESYA.GLQ........EF........KAAIEDLNAVLFQ.....................
hFl_ENSPANP00000001460 LKPTF...EMAYVDL.AEMYA.EIG........HH........RKAEEHFQKVLRMkifedqlkqeihyrygsfqeh
hFl_ENSPANP00000004313 NDLKS...HVCWHVY.GLLQR.SDK........KY........DEAIKCYRNALKW.....................
hFl_ENSPANP00000001617 DQLGE...AKASGNL.GNTLK.VLG........NF........DEAIVCCQRHLDI.....................
hFl_ENSPANP00000019732 RHPQT...IVLMSDL.ATTLD.AQG........RF........DEAYIYMQRASDLarqin................
hFl_ENSPANP00000013913 I---I...EKLYINR.IACYS.NMG........FH........DKVLEDCNIVLSF.....................
hFl_ENSPANP00000004649 LLPER...ASAYNNR.AQARR.LQG........DV........AGALEDLERAVEL.....................
hFl_ENSPANP00000013914 I---I...EKLYINR.IACYS.NMG........FH........DKVLEDCNIVLSF.....................
hFl_ENSPANP00000003176 DHPRV...AQSLHQL.ASVYV.QWK........KF........GNAEQLYKQALEIsenaygad.............
hFl_ENSPANP00000003166 ATADI...SDVWLNL.AHIYV.EQK........QY........ISAVQMYENCLRK.....................
hFl_ENSPANP00000015752 DLKTL...SAIYSQL.GNAYF.YLK........EH........GRALEYHKHDLLL.....................
hFl_ENSPANP00000001460 ADMRS...LVTWGNF.AWVYY.HMG........RL........AEAQTYLDKVENT.....................
hFl_ENSPANP00000004498 LAPDD...NSLLLLR.AELYL.TMK........NY........EQAFQDASAVCQN.....................
hFl_ENSPANP00000014540 MDVHD...GRSWYIL.GNSYL.SLYfstgqnpkIS........QQALSAYAQAEKV.....................
hFl_ENSPANP00000002479 PQGDQ...GEAWAKM.GACYQ.ALG........QP........ELAAHCLQEASRAyvqerqlqaaalalgaaagcm
hFl_ENSPANP00000017858 KHKDL...HCAKVLK.AIGLQ.RTG........KQ........EEAFTLAQEVAAL.....................
hFl_ENSPANP00000007886 LNLHL...AILYAKR.VSVFV.KLK........KP........NAAIRDCDTGIEI.....................
hFl_ENSPANP00000018968 KHPGLilkYSTYKNL.AQLAA.QRE........DL........ETAMEFYLEAVML.....................
hFl_ENSPANP00000015642 LSPTD...HQAAFYL.ALQLA.ISR........QI........PEALGYVRQALQL.....................
hFl_ENSPANP00000003731 EAEDL...EKSWLLL.ADIYC.QGS........KF........DLALELLRRCVQY.....................
hFl_ENSPANP00000019484 NTEDM...SLCYANR.SAALF.HLG........QY........ETCLKDISRAQTHg....................
hFl_ENSPANP00000019485 NTEDM...SLCYANR.SAALF.HLG........QY........ETCLKDISRAQTHg....................
hFl_ENSPANP00000020575 ASVRS...LVTWSNF.AWVYY.HMG........RL........AEAQAYLDKVENI.....................
hFl_ENSPANP00000017457 KDTCM...AVGFFQR.GVANF.QLA........RF........QEALSDFRLALAQ.....................
hFl_ENSPANP00000020575 KKPTF...EVAHLDL.ARMYI.EAG........NH........RKAEETFQKLLCMkpvveetmqdihlqyarfqef
hFl_ENSPANP00000004562 LHPEL...EQYRLYQ.AQALY.KAC........LY........PEATRVAFLLLDNpayhsrvlrlqaaikysegdl
hFl_ENSPANP00000004438 IAKNQ...PPILNRL.AKIFY.FLG........KQ........DMAIGTCNMALDVlqdpelnwqayctrakihira
hFl_ENSPANP00000008640 KHKDL...HCAKVLK.AIGLQ.RTG........KQ........EEAFTLAQEVAAL.....................
hFl_ENSPANP00000020327 ISTIDk..VSVLDYL.SYAVY.QQG........DL........DKALVLTKKLLEL.....................
hFl_ENSPANP00000020572 AEIRS...LVTWGNY.AWVYY.HMG........RL........SDAQIYVDKVKHI.....................
hFl_ENSPANP00000016643 -----...-------.AKLYY.EAK........EY........DLAKKYICTYINV.....................
hFl_ENSPANP00000006588 EENCN...SEVWVNL.ACTYF.FLG........MY........KQAEAAGFKAASKsrlqnrllfhlahkfndekkl
hFl_ENSPANP00000003995 VKETF...QYTLFRW.AEELD.ALN........RI........QDLLGCYEQALEL.....................
hFl_ENSPANP00000007718 LNEMR...TRLYLNL.GLTFE.SLQ........QT........ALCNDYFRKSIFL.....................
hFl_ENSPANP00000004384 IEACL...PLYTNMI.ALHQL.LER........RY........EAAMELCKSLLES.....................
hFl_ENSPANP00000011118 LNEMR...TRLYLNL.GLTFE.SLQ........QT........ALCNDYFRKSIFL.....................
hFl_ENSPANP00000004252 LHPEL...EQYRLYQ.AQALY.KAC........LY........PEATRVAFLLLDNpayhsrvlrlqaaikysegdl
hFl_ENSPANP00000007476 FMHKM...PRLWLDY.CQFLM.DQG........RV........THTRRTFDRALRA.....................
hFl_ENSPANP00000006588 DNREY...LALNVYV.ALCYY.KLD........YY........DVSQEVLAVYLQQ.....................
hFl_ENSPANP00000001745 NTEMV...ISVLLSV.AELYW.RSS........SP........TIALPMLLQALAL.....................
hFl_ENSPANP00000014391 -----...-------.-----.ELE........EP........EDARIMLSRAVEC.....................
hFl_ENSPANP00000004313 PPTTL...LWVQYYL.AQHYD.KIG........QP........AIALEYINTAIES.....................
hFl_ENSPANP00000004562 ASGYQ...PDLSYNL.ALAYY.SSR........QY........ASALKHIAEIIERgirqhpelgvgmttegfdvrs
hFl_ENSPANP00000001425 QPAAA...AALCLEL.AAALR.DLG........QP........AAAAGHFQRAAQL.....................
hFl_ENSPANP00000015647 SLKLR...GSVFSAL.SSAYW.SLG........NT........EKSTGYMQQDLDV.....................
hFl_ENSPANP00000019118 YCPLWv..SATHLLQ.GQAWV.QLG........AQ........KVAISEFSRCLELlfrttpeekeqgaasngeqgc
hFl_ENSPANP00000015209 GECLR...CMFWNNL.GCIHF.AMS........KH........NLGIFYFKKALQEndnvcaqlsagsadpgkkfsg
hFl_ENSPANP00000006801 DADFL...LESYLNL.ARSNE.KLC........EF........HKTISYCKTCLGL.....................
hFl_ENSPANP00000003551 ATTTK...SQVLDYL.SYAVF.QLG........DL........HRALELTRRLLSL.....................
hFl_ENSPANP00000004252 ASGYQ...PDLSYNL.ALAYY.SSR........QY........ASALKHIAEIIERgirqhpelgvgmttegfdvrs
hFl_ENSPANP00000002479 DTLVL...RACAFNL.GAAYV.ETG........DP........ARGLELLLRAHPE.....................
hFl_ENSPANP00000004798 HQELW...AFIVTNL.ASVYI.REGn.......RH........QEVLYSLLE--RI.....................
hFl_ENSPANP00000000477 ATTTK...SQVLDYL.SYAVF.QLG........DL........HRALELTRRLLSL.....................
hFl_ENSPANP00000007362 GFSKS...SYIVSQI.AVAYH.NIR........DI........DKALSIFNELRKQdpyrienmdtfsnllyvrsmk
hFl_ENSPANP00000002485 ---YA...AQAHLKL.GEVSV.ESE........NY........VQAVEEFQSCLNL.....................
hFl_ENSPANP00000014498 WIEIE...ARIRLSF.AQVCQ.GQK........KS........KEALSHYQAALEYveiskgekshecvpilrelag
hFl_ENSPANP00000017253 SLQNA...AAIYDLL.SITLG.RRG........QY........VMLSECLERAMKF.....................
hFl_ENSPANP00000016353 -----...-------.-----.---........--........----EHVDKAIAL.....................
hFl_ENSPANP00000016352 -----...-------.-----.---........--........----EHVDKAIAL.....................
hFl_ENSPANP00000018429 DLFLV...VAVYANL.ASIYR.KQK........NR........EKCTQVVPKAMALllgtpghicsteaegellqla
hFl_ENSPANP00000013579 DIPLS...SYVKGIY.SFGLM.ETN........FY........DRAEKLAKEALSI.....................
hFl_ENSPANP00000000348 LDEDA...TLTQLAT.AWVSL.ATGge......KL........QDAYYIFQEMADK.....................
hFl_ENSPANP00000015511 LCPGYs..NPNYMYL.AKCYA.DLE........EN........QNALKFC------.....................
hFl_ENSPANP00000007718 PGAER...AIIHVSL.AATLG.DMK........DH........RGAVRHYEEELRL.....................
hFl_ENSPANP00000011118 PGAER...AIIHVSL.AATLG.DMK........DH........RGAVRHYEEELRL.....................
hFl_ENSPANP00000007718 DPLGC...AVAHRKI.GERLA.EME........DY........PTALQHQHHYLEL.....................
hFl_ENSPANP00000015642 LKPDD...ATIPLLA.AKLCMgSLH........WL........EEAEKFAKTVVDV.....................
hFl_ENSPANP00000001022 DRRQE...LVAFHRL.ATVYY.SLH........MY........EMAEDCYLKTLSL.....................
hFl_ENSPANP00000010920 IASVA...SFIETKL.VTCYL.RMR........KP........DLALNHAHRSIVL.....................
hFl_ENSPANP00000007476 -----...-------.-----.---........--........----QLYERALKL.....................
hFl_ENSPANP00000003968 ELKHK...PGMVSAL.VTMYS.HEE........DI........DSAIEVFALAIQW.....................
hFl_ENSPANP00000001022 -----...-ALCLIL.SKVYL.QHR........SP........DGAIHYLSQALVLgqllg................
hFl_ENSPANP00000009443 MDLDF...AKLQRNM.ACCYL.NLQ........QL........DKAKEAVAEAERH.....................
hFl_ENSPANP00000011463 LDKLY...EACRYLA.ARCHY.AAK........EH........QQALDILDMEEP-.....................
hFl_ENSPANP00000002961 -----...--AALNQ.ALEMK.RQG........KR........EKAQKLFMHALKM.....................
hFl_ENSPANP00000017623 LQDFF...VLPELRR.AQSLT.CTG........LY........REALALWATAWQL.....................
hFl_ENSPANP00000011215 KLPRL...AILHAKR.ASVFI.KLQ........KP........NAVIR-NDRAIEI.....................
hFl_ENSPANP00000000119 SSVEL...VPAYLLL.AEASL.GLG........RI........VQAEEYLFQAQWTvlkstdcs.............
hFl_ENSPANP00000002418 TFAEM...PWYQRRI.AEMLF.ATPpss.....TY........EKALGYFHRAEQV.....................
hFl_ENSPANP00000014391 -----...-------.-----.--N........DI........KKARLLLKSVRET.....................
hFl_ENSPANP00000020421 QQANK...AALYGEL.CALLF.AKS........HY........DEAYKWCIEAMKEitaglpvkvvvdvlrqaskac
hFl_ENSPANP00000008387 THPDE...PLYSLCI.GLTFI.HMAsq......KYvlrrhaliVQGFSFLNRYLSL.....................
hFl_ENSPANP00000005487 AGGSS...ACHLRLR.ATCLA.ELQ........EF........GRALRDLDHVLQEtlgdsd...............
hFl_ENSPANP00000002155 -----...-------.-----.---........--........-------------.....................
hFl_ENSPANP00000002567 QREIQ...HVCLYEI.GWCSM.IEL........NF........KDAFDSFERLKNE.....................
hFl_ENSPANP00000019509 DHPEM...ALLDNNI.GLVLH.GVM........EY........DLSLRFLENALAV.....................
hFl_ENSPANP00000005069 QREIQ...HVCLYEI.GWCSM.IEL........NF........KDAFDSFERLKNE.....................
hFl_ENSPANP00000000052 LQVSE...KDLTLAL.GRASL.AIH........RL........NLALTYFEKAIGDviaakgdr.............
hFl_ENSPANP00000005735 DEASL...EDALDHL.AFAYF.QAG........NV........SCALSLSREFLLY.....................
hFl_ENSPANP00000001022 DREME...GRLLESL.GQLYR.NLNtar.....SL........RRSLTCIKESLRI.....................
hFl_ENSPANP00000018160 EQPYF...IEAREKM.ADIYL.KHR........KD........KMLYITCFREIAE.....................
hFl_ENSPANP00000018982 DLLLV...VAVYTNL.ASIYW.KQK........NR........EKCTQVVPKAVALllgtpghicstevegelqlal
hFl_ENSPANP00000018968 SPPVV...NELYYLL.ADYHF.KNK........EQ........SKAIKFYMHDICI.....................
hFl_ENSPANP00000008513 REAKP...HLESYSA.GVKHY.EAD........DF........ELAIRHFEQALREyfvediecrtlcegpqrfeey
hFl_ENSPANP00000019509 MHVET...CACLRLL.ARLHY.IMG........DY........AEALSNQQKAV--.....................
hFl_ENSPANP00000006588 -----...-------.-----.---........--........-----------SY.....................
hFl_ENSPANP00000011118 DPLGC...AVAHRKI.GERLA.EME........DY........PTALQTQHQHHYLelahslrn.............
hFl_ENSPANP00000003166 IIMYD...QNHLLGR.ACFCL.LEGd.......KM........DQADAQFHFVLNQ.....................
hFl_ENSPANP00000004798 FEDVK...FEAASLL.SELYC.QEN........SV........DAAKPLLRKAIQI.....................
hFl_ENSPANP00000015019 -----...--YYDKA.ASVYI.RSK........NW........AKVGDLLPHVSS-.....................
hFl_ENSPANP00000020573 AEIRS...LVTWGNY.AWVYY.HLG........RL........SDAQIYVDKVKQT.....................
hFl_ENSPANP00000004562 FCNDH...DVWKLNV.AHVLF.MQEn.......KY........KEAIGFYEPIVKK.....................
hFl_ENSPANP00000004252 FCNDH...DVWKLNV.AHVLF.MQEn.......KY........KEAIGFYEPIVKK.....................
hFl_ENSPANP00000020003 DKALL...VEVQLLE.SKTYH.ALS........NL........PKARAALTSARTTanaiycppklqatldmqsgii
hFl_ENSPANP00000006922 TDH-L...TTVLYLQ.LAIFS.SLQ........NL........EKTIFCLQKLISL.....................
hFl_ENSPANP00000001081 -MINY...VLVVYGL.AISLL.GIGqpe.....EL........SEAENQFKRIIEH.....................
hFl_ENSPANP00000020426 FEKVY...THNLYYL.AQVYQ.HLE........MF........EKAAHYCHSTLK-.....................
hFl_ENSPANP00000014026 KGTQL...LEIYALE.IQMYT.AQK........NN........KKLKALYEQSLHI.....................
hFl_ENSPANP00000015646 -----...---YSSL.GRTHH.ALQ........NY........SQAVMYLQEGLRL.....................
hFl_ENSPANP00000015647 -----...---YSSL.GRTHH.ALQ........NY........SQAVMYLQEGLRL.....................
hFl_ENSPANP00000015639 -----...-------.-----.---........--........-------------.....................
hFl_ENSPANP00000004438 VCP-G...FKAYLDI.GQVYY.YMGvdavqellA-........------------Vdeaalnqalvflakagesel.
hFl_ENSPANP00000015636 -----...-------.-----.---........--........-------------.....................
hFl_ENSPANP00000006186 WSLAE...DHINFTI.GRQSY.TLR........QL........DNAVSAFRHI---.....................
hFl_ENSPANP00000015209 LENLK...CSILACS.AYVAL.ALG........DN........LMALNHADKLLQQpklsgslkflghlyaaealis
hFl_ENSPANP00000000119 ----H...SLLHRNL.GLLYI.AKK........NY........EEARYHLANDIYF.....................
hFl_ENSPANP00000011874 YDEMV...GECWLQS.ARVAR.KAG........HH........QTAYNALLNAGE-.....................
hFl_ENSPANP00000013299 -----...-------.-RLHS.LLG........DY........YQAIKVLENI-EL.....................
hFl_ENSPANP00000003968 QTD--...-KLKELY.GQVLY.RLE........RY........DECLAVYRDLVRNsqddydeerktnlsavvaaqs
hFl_ENSPANP00000005681 TVDNY...AVLQLDI.VWCYF.RLE........QL........-ECLDDAEKKLNL.....................
hFl_ENSPANP00000012992 -MINY...VLVVYGL.AISLL.GIGqpe.....EL........SEAENQFKRIIEH.....................
hFl_ENSPANP00000004384 KLPLC...A------.-----.---........--........-------------.....................
hFl_ENSPANP00000020572 ANDNL...FRVCSIL.ASLHA.LAD........QY........EEAEYYFQKEFSKeltpvakqllhlrygnfqlyq
hFl_ENSPANP00000006404 -----...-------.-----.DSG........NS........GLAEKCWMKAAELsikflppqrnmevvlav....
hFl_ENSPANP00000000870 -----...-------.--VCL.YMQ........DW........EGALQYGQKIIKP.....................
hFl_ENSPANP00000001745 LSELI...DISIAQK.TAIWR.LYG........RS........TMALQQAQMLLSMnsleavnagvqqnn.......
hFl_ENSPANP00000011077 HRLDI...VFYLLRI.GLFYM.DNDlitr....NT........EKAKSLIEEGGDW.....................
hFl_ENSPANP00000003398 MTDML...LKVQNAI.GELYL.EAG........MT........QEGFQYFQKAWSSmlhlslsdledsrdlvkqkvr
hFl_ENSPANP00000008218 HHEND...VKTALDL.AALST.EHS........QY........K------------.....................
hFl_ENSPANP00000010361 ----A...LYYFLEI.ASAYL.ILH........DN........YMAYMYLNEGEKLlktlek...............
hFl_ENSPANP00000017310 -----...-------.-----.AIQ........EP........DDARDYFQMARAN.....................
hFl_ENSPANP00000004678 SHPDT...SYYIRYR.GAVYA.DSG........NF........ERCIRLWKYALDM.....................
hFl_ENSPANP00000005519 INPNN...HSWLIIQ.ADIYF.ATN........QY........SAALHYYLQAGAV.....................
hFl_ENSPANP00000008921 -----...-------.-----.---........--........-------------.....................
hFl_ENSPANP00000016699 TSPYH...VDSLLQL.SDACR.FQE........DQ........EMARDLVERALYSmecafhplfsltsgacrldyr
hFl_ENSPANP00000001022 DLCLV...AALYINL.AAIYL.KQR........LR........HKGSTLLEKAGALlaclpdressakhelevvayv
hFl_ENSPANP00000015209 DDVEN...SMLYYNQ.AVILY.HLR........QY........TEAISVGEKLYQFiepfeekfaqavcfllvdlyi
hFl_ENSPANP00000012305 TSPYH...VDSLLQL.SDACR.FQE........DQ........EMARDLVERALYSmecafhplfsltsgacrldyr
hFl_ENSPANP00000018202 -----...-------.-----.DSG........NS........GLAEKCWMKAAELsikflppqrnmevvlav....


                                                                                                    
                                                                                                    
d1kt1a1                .............................................................................
hFl_ENSPANP00000004835 iksgrmifkkared...............................................................
hFl_ENSPANP00000017500 .............................................................................
hFl_ENSPANP00000011496 .............................................................................
hFl_ENSPANP00000005875 .............................................................................
hFl_ENSPANP00000015319 .............................................................................
hFl_ENSPANP00000019493 .............................................................................
hFl_ENSPANP00000015800 .............................................................................
hFl_ENSPANP00000017125 .............................................................................
hFl_ENSPANP00000011271 .............................................................................
hFl_ENSPANP00000017151 .............................................................................
hFl_ENSPANP00000007093 .............................................................................
hFl_ENSPANP00000007238 .............................................................................
hFl_ENSPANP00000007093 .............................................................................
hFl_ENSPANP00000015526 .............................................................................
hFl_ENSPANP00000010410 .............................................................................
hFl_ENSPANP00000004737 .............................................................................
hFl_ENSPANP00000020946 .............................................................................
hFl_ENSPANP00000020864 .............................................................................
hFl_ENSPANP00000007952 .............................................................................
hFl_ENSPANP00000016788 .............................................................................
hFl_ENSPANP00000004737 .............................................................................
hFl_ENSPANP00000004737 .............................................................................
hFl_ENSPANP00000000707 .............................................................................
hFl_ENSPANP00000004108 .............................................................................
hFl_ENSPANP00000016788 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000003166 .............................................................................
hFl_ENSPANP00000003324 .............................................................................
hFl_ENSPANP00000005479 .............................................................................
hFl_ENSPANP00000003528 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000010352 .............................................................................
hFl_ENSPANP00000012491 .............................................................................
hFl_ENSPANP00000014791 .............................................................................
hFl_ENSPANP00000005591 .............................................................................
hFl_ENSPANP00000015348 .............................................................................
hFl_ENSPANP00000014791 .............................................................................
hFl_ENSPANP00000013486 .............................................................................
hFl_ENSPANP00000015752 .............................................................................
hFl_ENSPANP00000014239 .............................................................................
hFl_ENSPANP00000001617 .............................................................................
hFl_ENSPANP00000017253 .............................................................................
hFl_ENSPANP00000020687 .............................................................................
hFl_ENSPANP00000014947 .............................................................................
hFl_ENSPANP00000015753 .............................................................................
hFl_ENSPANP00000003528 .............................................................................
hFl_ENSPANP00000008218 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000013297 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000007362 .............................................................................
hFl_ENSPANP00000014947 .............................................................................
hFl_ENSPANP00000008383 .............................................................................
hFl_ENSPANP00000017676 .............................................................................
hFl_ENSPANP00000001814 .............................................................................
hFl_ENSPANP00000001168 .............................................................................
hFl_ENSPANP00000003176 lykkmgkldkavplyelaveirqksfgpk................................................
hFl_ENSPANP00000010724 .............................................................................
hFl_ENSPANP00000013376 .............................................................................
hFl_ENSPANP00000013375 .............................................................................
hFl_ENSPANP00000000707 .............................................................................
hFl_ENSPANP00000012992 .............................................................................
hFl_ENSPANP00000020687 .............................................................................
hFl_ENSPANP00000000643 .............................................................................
hFl_ENSPANP00000007559 .............................................................................
hFl_ENSPANP00000003197 .............................................................................
hFl_ENSPANP00000003945 .............................................................................
hFl_ENSPANP00000012699 .............................................................................
hFl_ENSPANP00000004293 .............................................................................
hFl_ENSPANP00000014070 .............................................................................
hFl_ENSPANP00000008096 .............................................................................
hFl_ENSPANP00000014947 .............................................................................
hFl_ENSPANP00000020577 hrksentaihhylealkvkdrsplrtkltsalkklatkrlch...................................
hFl_ENSPANP00000020573 .............................................................................
hFl_ENSPANP00000015642 .............................................................................
hFl_ENSPANP00000019972 .............................................................................
hFl_ENSPANP00000002155 vdllgdkatkesyaiqylqkslea.....................................................
hFl_ENSPANP00000003197 .............................................................................
hFl_ENSPANP00000010388 .............................................................................
hFl_ENSPANP00000009536 .............................................................................
hFl_ENSPANP00000013401 .............................................................................
hFl_ENSPANP00000007559 .............................................................................
hFl_ENSPANP00000020038 .............................................................................
hFl_ENSPANP00000020312 .............................................................................
hFl_ENSPANP00000000258 .............................................................................
hFl_ENSPANP00000017676 .............................................................................
hFl_ENSPANP00000006518 .............................................................................
hFl_ENSPANP00000013297 .............................................................................
hFl_ENSPANP00000003504 .............................................................................
hFl_ENSPANP00000017184 .............................................................................
hFl_ENSPANP00000006801 .............................................................................
hFl_ENSPANP00000015190 .............................................................................
hFl_ENSPANP00000001081 .............................................................................
hFl_ENSPANP00000006437 .............................................................................
hFl_ENSPANP00000012699 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000009269 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000019581 .............................................................................
hFl_ENSPANP00000020572 .............................................................................
hFl_ENSPANP00000007217 .............................................................................
hFl_ENSPANP00000020685 .............................................................................
hFl_ENSPANP00000020899 .............................................................................
hFl_ENSPANP00000008387 .............................................................................
hFl_ENSPANP00000010352 .............................................................................
hFl_ENSPANP00000009338 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000020864 .............................................................................
hFl_ENSPANP00000008387 .............................................................................
hFl_ENSPANP00000009057 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000007915 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000015625 .............................................................................
hFl_ENSPANP00000014767 .............................................................................
hFl_ENSPANP00000002080 .............................................................................
hFl_ENSPANP00000007403 .............................................................................
hFl_ENSPANP00000007476 gvthtrgiyqkaievls............................................................
hFl_ENSPANP00000005487 qglysrcrallsqlldtgaplededtqgllavgqaliki......................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000013410 .............................................................................
hFl_ENSPANP00000003097 .............................................................................
hFl_ENSPANP00000020575 .............................................................................
hFl_ENSPANP00000007248 .............................................................................
hFl_ENSPANP00000019375 .............................................................................
hFl_ENSPANP00000003854 .............................................................................
hFl_ENSPANP00000006795 .............................................................................
hFl_ENSPANP00000002479 .............................................................................
hFl_ENSPANP00000017125 .............................................................................
hFl_ENSPANP00000005048 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000019375 .............................................................................
hFl_ENSPANP00000014239 .............................................................................
hFl_ENSPANP00000012835 .............................................................................
hFl_ENSPANP00000001460 .............................................................................
hFl_ENSPANP00000015753 .............................................................................
hFl_ENSPANP00000003968 .............................................................................
hFl_ENSPANP00000006868 .............................................................................
hFl_ENSPANP00000001460 hgksedkaithylkglkiekmsrsrekllnaleklakrcvhr...................................
hFl_ENSPANP00000004313 .............................................................................
hFl_ENSPANP00000001617 .............................................................................
hFl_ENSPANP00000019732 .............................................................................
hFl_ENSPANP00000013913 .............................................................................
hFl_ENSPANP00000004649 .............................................................................
hFl_ENSPANP00000013914 .............................................................................
hFl_ENSPANP00000003176 .............................................................................
hFl_ENSPANP00000003166 .............................................................................
hFl_ENSPANP00000015752 .............................................................................
hFl_ENSPANP00000001460 .............................................................................
hFl_ENSPANP00000004498 .............................................................................
hFl_ENSPANP00000014540 .............................................................................
hFl_ENSPANP00000002479 lksgrhrvgevvqvleksqrlaerste..................................................
hFl_ENSPANP00000017858 .............................................................................
hFl_ENSPANP00000007886 .............................................................................
hFl_ENSPANP00000018968 .............................................................................
hFl_ENSPANP00000015642 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000019484 .............................................................................
hFl_ENSPANP00000019485 .............................................................................
hFl_ENSPANP00000020575 .............................................................................
hFl_ENSPANP00000017457 .............................................................................
hFl_ENSPANP00000020575 qkkseinaiihylkaikieqasfirdksinslkklvlkklqr...................................
hFl_ENSPANP00000004562 pgsrslveqllsgeggeesg.........................................................
hFl_ENSPANP00000004438 ylhdlerakmglggmpdrnhlacakadleevvrvcpgfkayldigqvyyymg.........................
hFl_ENSPANP00000008640 .............................................................................
hFl_ENSPANP00000020327 .............................................................................
hFl_ENSPANP00000020572 .............................................................................
hFl_ENSPANP00000016643 .............................................................................
hFl_ENSPANP00000006588 msfhqn.......................................................................
hFl_ENSPANP00000003995 .............................................................................
hFl_ENSPANP00000007718 .............................................................................
hFl_ENSPANP00000004384 .............................................................................
hFl_ENSPANP00000011118 .............................................................................
hFl_ENSPANP00000004252 pgsrslveqllsgeegeesg.........................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000006588 .............................................................................
hFl_ENSPANP00000001745 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000004313 .............................................................................
hFl_ENSPANP00000004562 vgntlvlh.....................................................................
hFl_ENSPANP00000001425 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000019118 ksdval.......................................................................
hFl_ENSPANP00000015209 rpmctll......................................................................
hFl_ENSPANP00000006801 .............................................................................
hFl_ENSPANP00000003551 .............................................................................
hFl_ENSPANP00000004252 vgntlvlh.....................................................................
hFl_ENSPANP00000002479 .............................................................................
hFl_ENSPANP00000004798 .............................................................................
hFl_ENSPANP00000000477 .............................................................................
hFl_ENSPANP00000007362 selsylahnlcei................................................................
hFl_ENSPANP00000002485 .............................................................................
hFl_ENSPANP00000014498 veqalglhdvsinhflqahliilsrspskveaadsahivahaavasgrhehhdvaeqyfqesmahlkdsegmgrtkf
hFl_ENSPANP00000017253 .............................................................................
hFl_ENSPANP00000016353 .............................................................................
hFl_ENSPANP00000016352 .............................................................................
hFl_ENSPANP00000018429 lrwavggqs....................................................................
hFl_ENSPANP00000013579 .............................................................................
hFl_ENSPANP00000000348 .............................................................................
hFl_ENSPANP00000015511 .............................................................................
hFl_ENSPANP00000007718 .............................................................................
hFl_ENSPANP00000011118 .............................................................................
hFl_ENSPANP00000007718 .............................................................................
hFl_ENSPANP00000015642 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000010920 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000003968 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000009443 .............................................................................
hFl_ENSPANP00000011463 .............................................................................
hFl_ENSPANP00000002961 .............................................................................
hFl_ENSPANP00000017623 .............................................................................
hFl_ENSPANP00000011215 .............................................................................
hFl_ENSPANP00000000119 .............................................................................
hFl_ENSPANP00000002418 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000020421 vvkrefkkaeqlikhavylardhfgsk..................................................
hFl_ENSPANP00000008387 .............................................................................
hFl_ENSPANP00000005487 .............................................................................
hFl_ENSPANP00000002155 .............................................................................
hFl_ENSPANP00000002567 .............................................................................
hFl_ENSPANP00000019509 .............................................................................
hFl_ENSPANP00000005069 .............................................................................
hFl_ENSPANP00000000052 .............................................................................
hFl_ENSPANP00000005735 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000018982 rravggqs.....................................................................
hFl_ENSPANP00000018968 .............................................................................
hFl_ENSPANP00000008513 eylgyktglyeaiadhymqvlvcqhecvrelatrpgrlspi....................................
hFl_ENSPANP00000019509 .............................................................................
hFl_ENSPANP00000006588 .............................................................................
hFl_ENSPANP00000011118 .............................................................................
hFl_ENSPANP00000003166 .............................................................................
hFl_ENSPANP00000004798 .............................................................................
hFl_ENSPANP00000015019 .............................................................................
hFl_ENSPANP00000020573 .............................................................................
hFl_ENSPANP00000004562 .............................................................................
hFl_ENSPANP00000004252 .............................................................................
hFl_ENSPANP00000020003 haaeekdwktaysyfyeafegydsidspkaitslkymllckimln................................
hFl_ENSPANP00000006922 .............................................................................
hFl_ENSPANP00000001081 .............................................................................
hFl_ENSPANP00000020426 .............................................................................
hFl_ENSPANP00000014026 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000015639 .............................................................................
hFl_ENSPANP00000004438 .............................................................................
hFl_ENSPANP00000015636 .............................................................................
hFl_ENSPANP00000006186 .............................................................................
hFl_ENSPANP00000015209 ldrisdaithlnpenvtdvslgissneqdqgsdkgeneamessgkrapqcypssv......................
hFl_ENSPANP00000000119 .............................................................................
hFl_ENSPANP00000011874 .............................................................................
hFl_ENSPANP00000013299 .............................................................................
hFl_ENSPANP00000003968 nwekvvpenlgl.................................................................
hFl_ENSPANP00000005681 .............................................................................
hFl_ENSPANP00000012992 .............................................................................
hFl_ENSPANP00000004384 .............................................................................
hFl_ENSPANP00000020572 mkcedkaihhfiegvkinqksrekekmkdklqkiakmrlsk....................................
hFl_ENSPANP00000006404 .............................................................................
hFl_ENSPANP00000000870 .............................................................................
hFl_ENSPANP00000001745 .............................................................................
hFl_ENSPANP00000011077 .............................................................................
hFl_ENSPANP00000003398 vlnnlaksaseeylkenhileyateisnlldn.............................................
hFl_ENSPANP00000008218 .............................................................................
hFl_ENSPANP00000010361 .............................................................................
hFl_ENSPANP00000017310 .............................................................................
hFl_ENSPANP00000004678 .............................................................................
hFl_ENSPANP00000005519 .............................................................................
hFl_ENSPANP00000008921 .............................................................................
hFl_ENSPANP00000016699 rpe..........................................................................
hFl_ENSPANP00000001022 lrqgivvgs....................................................................
hFl_ENSPANP00000015209 ltyqaekalhllavlekmisqgnnnkngknetgnnnnkdg.....................................
hFl_ENSPANP00000012305 rpe..........................................................................
hFl_ENSPANP00000018202 .............................................................................


                                                                                           100      
                                                                                             |      
d1kt1a1                ......................................DSAN..........................EKGLYRRGE
hFl_ENSPANP00000004835 ......................................TRTR..........................HHVYVTAAL
hFl_ENSPANP00000017500 ......................................VPSN..........................GQPYNQLAI
hFl_ENSPANP00000011496 ......................................RPND..........................YLLWNKLGA
hFl_ENSPANP00000005875 ......................................APQI..........................GMPFNQLGT
hFl_ENSPANP00000015319 ......................................RPED..........................YSLWNRLGA
hFl_ENSPANP00000019493 ......................................APKN..........................GRPYNQLAL
hFl_ENSPANP00000015800 ......................................APHQmk........................DVPLISLAN
hFl_ENSPANP00000017125 ......................................LPRV..........................NQFWYKYTY
hFl_ENSPANP00000011271 ......................................YTDMgrftia....................AKHHISIAE
hFl_ENSPANP00000017151 ......................................YTDMgrftia....................AKHHITIAE
hFl_ENSPANP00000007093 ......................................NPAF..........................ADAHSNLAS
hFl_ENSPANP00000007238 ......................................NAKY..........................ANMWLEYYN
hFl_ENSPANP00000007093 ......................................SPNH..........................AVVHGNLAC
hFl_ENSPANP00000015526 ......................................GSKEeq........................RDYVFYLAV
hFl_ENSPANP00000010410 ......................................HENNralfha....................AKAYEQAGM
hFl_ENSPANP00000004737 ......................................GRENredyrqi...................AKAYARIGN
hFl_ENSPANP00000020946 ......................................LPSKeh........................VDVIAKFAQ
hFl_ENSPANP00000020864 ......................................NPQS..........................SVLLCHIGV
hFl_ENSPANP00000007952 ......................................QPDF..........................AAAWMNLGI
hFl_ENSPANP00000016788 ......................................AKSNnes.......................SFYAVKLAR
hFl_ENSPANP00000004737 ......................................EPTF..........................IKGYTRKAA
hFl_ENSPANP00000004737 ......................................KPDW..........................GKGYSRKAA
hFl_ENSPANP00000000707 ......................................CPDS..........................SDLHNNYGV
hFl_ENSPANP00000004108 ......................................DSKY..........................SKAYGRMGL
hFl_ENSPANP00000016788 ......................................YPYC..........................YGYWKKYAD
hFl_ENSPANP00000015646 ......................................ARELrdiqse....................ARALSNLGN
hFl_ENSPANP00000015647 ......................................ARELrdiqse....................ARALSNLGN
hFl_ENSPANP00000003166 ......................................HPNY..........................VDCYLRLGA
hFl_ENSPANP00000003324 ......................................DPAY..........................SKAYGRMGL
hFl_ENSPANP00000005479 ......................................DSNN..........................EKGLFRRGE
hFl_ENSPANP00000003528 ......................................NRSY..........................TKAYSRRGA
hFl_ENSPANP00000015647 ......................................GQKLkdpsle....................AQVYGNMGI
hFl_ENSPANP00000014391 ......................................NPKN..........................PGLWLESVR
hFl_ENSPANP00000015646 ......................................GQKLkdpsle....................AQVYGNMGI
hFl_ENSPANP00000015646 ......................................AEETnnptcq....................GRAYGNLGL
hFl_ENSPANP00000015647 ......................................AEETnnptcq....................GRAYGNLGL
hFl_ENSPANP00000010352 ......................................RPDF..........................KQAYISRGE
hFl_ENSPANP00000012491 ......................................DSAN..........................EKGLYRRGE
hFl_ENSPANP00000014791 ......................................DSTE..........................FDVVFNAAH
hFl_ENSPANP00000005591 ......................................DKKY..........................IKGYYRRAA
hFl_ENSPANP00000015348 ......................................LRNS..........................AEVLYQIAN
hFl_ENSPANP00000014791 ......................................RPTL..........................ASAYLNTGI
hFl_ENSPANP00000013486 ......................................DGQS..........................VKAHFFLGQ
hFl_ENSPANP00000015752 ......................................SRQLrdqave....................AQACYSLGN
hFl_ENSPANP00000014239 ......................................APFD..........................WKILYNLGL
hFl_ENSPANP00000001617 ......................................ARQLkdrave....................AQSCYSLGN
hFl_ENSPANP00000017253 ......................................NPDG..........................VRIMHSLGL
hFl_ENSPANP00000020687 ......................................DSTN..........................ADALYVRGL
hFl_ENSPANP00000014947 ......................................EPGN..........................IKALLRRAT
hFl_ENSPANP00000015753 ......................................SRQLrdqave....................AQACYSLGN
hFl_ENSPANP00000003528 ......................................DGSY..........................SKAFARRGT
hFl_ENSPANP00000008218 ......................................AENEeea.......................ADVWYNLGH
hFl_ENSPANP00000015646 ......................................AQELmekaie....................MRAYAGLGH
hFl_ENSPANP00000013297 ......................................DPNV..........................AKTKNNLAS
hFl_ENSPANP00000015647 ......................................AQELmekaie....................MRAYAGLGH
hFl_ENSPANP00000007362 ......................................NKRD..........................YRAWYGLGQ
hFl_ENSPANP00000014947 ......................................DDGN..........................VKACYRRAL
hFl_ENSPANP00000008383 ......................................DPSN..........................TKALYRRAQ
hFl_ENSPANP00000017676 ......................................DGKN..........................VKAFYRRAQ
hFl_ENSPANP00000001814 ......................................NPSY..........................IRAILRRAE
hFl_ENSPANP00000001168 ......................................EPDN..........................AEAWNNLST
hFl_ENSPANP00000003176 ......................................HPSV..........................ATALVNLAV
hFl_ENSPANP00000010724 ......................................EPGH..........................LKALYRRGV
hFl_ENSPANP00000013376 ......................................DGGD..........................VKALYRRSQ
hFl_ENSPANP00000013375 ......................................DGGD..........................VKALYRRSQ
hFl_ENSPANP00000000707 ......................................KPKDpkvi......................SELFFTKGN
hFl_ENSPANP00000012992 ......................................KNTW..........................PKGHYRYCD
hFl_ENSPANP00000020687 ......................................DDTY..........................IKAYLRRAQ
hFl_ENSPANP00000000643 ......................................DEKC..........................TKAYFHMGK
hFl_ENSPANP00000007559 ......................................DPNV..........................AKTKNNLAS
hFl_ENSPANP00000003197 ......................................NPKY..........................VKALFRRAK
hFl_ENSPANP00000003945 ......................................HPDV..........................AKQLNNLAL
hFl_ENSPANP00000012699 ......................................NPNV..........................ARTKNNLAS
hFl_ENSPANP00000004293 ......................................NSNS..........................VQALLLKGA
hFl_ENSPANP00000014070 ......................................DNANar........................MKAHVRRGT
hFl_ENSPANP00000008096 ......................................EPDN..........................VNALKDRAE
hFl_ENSPANP00000014947 ......................................HPFS..........................MKPLLRRAM
hFl_ENSPANP00000020577 ......................................NALD..........................VQSLSALGF
hFl_ENSPANP00000020573 ......................................APCQ..........................TDVLRSAAK
hFl_ENSPANP00000015642 ......................................SPTH..........................VKSMQRLAL
hFl_ENSPANP00000019972 ......................................HPEC..........................AKLY-----
hFl_ENSPANP00000002155 ......................................DPNS..........................GQSWYFLGR
hFl_ENSPANP00000003197 ......................................EPDN..........................ATTYVHKGL
hFl_ENSPANP00000010388 ......................................RPMG..........................FKAHFRKAQ
hFl_ENSPANP00000009536 ......................................KPCH..........................LKAIIRGAL
hFl_ENSPANP00000013401 ......................................NPDS..........................AQPYKWRGK
hFl_ENSPANP00000007559 ......................................HPAV..........................AATLNNLAV
hFl_ENSPANP00000020038 ......................................NSSD..........................IKALYRRCQ
hFl_ENSPANP00000020312 ......................................SPS-..........................CLTWLGLGI
hFl_ENSPANP00000000258 ......................................RPMG..........................FKAHFRKAQ
hFl_ENSPANP00000017676 ......................................VPFS..........................IKPLLRRAS
hFl_ENSPANP00000006518 ......................................NPCH..........................LKAHFRLAR
hFl_ENSPANP00000013297 ......................................HPAV..........................AATLNNLAV
hFl_ENSPANP00000003504 ......................................QPDN..........................IKALFRKGK
hFl_ENSPANP00000017184 ......................................EGEN..........................FKALYRSGV
hFl_ENSPANP00000006801 ......................................VNDYgkgwslkyr.................AMSQYHMAV
hFl_ENSPANP00000015190 ......................................QPNF..........................EVPYYNRGL
hFl_ENSPANP00000001081 ......................................KNTW..........................PKGHYRYCD
hFl_ENSPANP00000006437 ......................................TPTL..........................IELFYMKAK
hFl_ENSPANP00000012699 ......................................HPAV..........................AATLNNLAV
hFl_ENSPANP00000007476 ......................................V--Yks........................LKVWSMLAD
hFl_ENSPANP00000009269 ......................................KPKS..........................YEAFYARAR
hFl_ENSPANP00000014391 ......................................CPKA..........................EVLWLMGAK
hFl_ENSPANP00000019581 ......................................HPGI..........................VKAYYVRAR
hFl_ENSPANP00000020572 ......................................LPNN..........................AYLHCQIGC
hFl_ENSPANP00000007217 ......................................QQGN..........................FKATYRAGI
hFl_ENSPANP00000020685 ......................................DPTF..........................CKGILQKAE
hFl_ENSPANP00000020899 ......................................KPKS..........................YEAYYARAR
hFl_ENSPANP00000008387 ......................................ERYNlavvw.....................ASSCSIILE
hFl_ENSPANP00000010352 ......................................YPDH..........................IKGLILKGD
hFl_ENSPANP00000009338 ......................................QQGN..........................FKATYRAGI
hFl_ENSPANP00000018160 ......................................GQKN..........................-YLCYDLAE
hFl_ENSPANP00000020864 ......................................HYNT..........................GWVLCQIGR
hFl_ENSPANP00000008387 ......................................NPSD..........................TEEWVRLAE
hFl_ENSPANP00000009057 ......................................TPTL..........................IELFYMKAK
hFl_ENSPANP00000018160 ......................................DQDN..........................EAATMMMAD
hFl_ENSPANP00000007915 ......................................STELdddlsl....................GRAYEAIAK
hFl_ENSPANP00000003731 ......................................NPHD..........................ASLASRIGQ
hFl_ENSPANP00000015625 ......................................DQKN..........................AKALFRCGQ
hFl_ENSPANP00000014767 ......................................NPHS..........................WESWQTLGR
hFl_ENSPANP00000002080 ......................................RPGW..........................PRGLFRLGK
hFl_ENSPANP00000007403 ......................................NPNN..........................STAMLRKGI
hFl_ENSPANP00000007476 ......................................DEHA..........................REMCLRFAD
hFl_ENSPANP00000005487 ......................................DAGQ..........................LDWHLLLVD
hFl_ENSPANP00000003731 ......................................EQNH..........................ETASVLMAD
hFl_ENSPANP00000013410 ......................................DSES..........................IRALFRKAR
hFl_ENSPANP00000003097 ......................................DPTY..........................VKGYYRAGY
hFl_ENSPANP00000020575 ......................................TPTS..........................VLLHHQIGL
hFl_ENSPANP00000007248 ......................................DKHL..........................AVAYFQRGM
hFl_ENSPANP00000019375 ......................................QQDNykhlkrl...................TFVLYLQGQ
hFl_ENSPANP00000003854 ......................................YDDN..........................VKAYFKRGK
hFl_ENSPANP00000006795 ......................................CPTHrnarkyl...................CQTLVERGG
hFl_ENSPANP00000002479 ......................................ARDSgdmkgq....................WQACEGLGA
hFl_ENSPANP00000017125 ......................................TQH-..........................VKVWISFAQ
hFl_ENSPANP00000005048 ......................................NPHN..........................HLYCQQYAE
hFl_ENSPANP00000003731 ......................................TKD-..........................VLGLMGKAM
hFl_ENSPANP00000018160 ......................................DGND..........................TFALLGKAQ
hFl_ENSPANP00000019375 ......................................SPQD..........................EGANTRMGL
hFl_ENSPANP00000014239 ......................................NRH-..........................DLTYIMLGK
hFl_ENSPANP00000012835 ......................................DPTN..........................AVANNNAAV
hFl_ENSPANP00000001460 ......................................MSSQ..........................TYVFRYAAK
hFl_ENSPANP00000015753 ......................................ARTIgdrmge....................AKASGNLGN
hFl_ENSPANP00000003968 ......................................Q--Ael........................AIIHGQMAY
hFl_ENSPANP00000006868 ......................................LPDW..........................PEVYFRKGK
hFl_ENSPANP00000001460 ......................................K--Vrv........................VESVSLLGL
hFl_ENSPANP00000004313 ......................................DKDN..........................LQILRDLSL
hFl_ENSPANP00000001617 ......................................SRELndkvge....................ARALYNLGN
hFl_ENSPANP00000019732 ......................................HPEL..........................HMVLSNLAA
hFl_ENSPANP00000013913 ......................................NASN..........................CKALYRKSK
hFl_ENSPANP00000004649 ......................................SGGRgraa......................RQSFVQRGL
hFl_ENSPANP00000013914 ......................................NASN..........................CKALYRKSK
hFl_ENSPANP00000003176 ......................................HPYT..........................ARELEALAT
hFl_ENSPANP00000003166 ......................................FYKHqn........................TEVVLYLAR
hFl_ENSPANP00000015752 ......................................ARTIgdrmge....................AKASGNLGN
hFl_ENSPANP00000001460 ......................................CKKFanpscyrmec................PEMDCEEGW
hFl_ENSPANP00000004498 ......................................EPLL..........................IKGHQVKAQ
hFl_ENSPANP00000014540 ......................................DRKAssn.......................PDLHLNRAT
hFl_ENSPANP00000002479 ......................................RGLL..........................GHLYNDLGL
hFl_ENSPANP00000017858 ......................................EPTD..........................DNSLQALTI
hFl_ENSPANP00000007886 ......................................NPDS..........................AQPYKWQVK
hFl_ENSPANP00000018968 ......................................DSTD..........................VNLWYKIGH
hFl_ENSPANP00000015642 ......................................QGDD..........................ANSLHLLAL
hFl_ENSPANP00000003731 ......................................NKSC..........................YKAYEYMGF
hFl_ENSPANP00000019484 ......................................Y-PErlq.......................PKIMLRKAE
hFl_ENSPANP00000019485 ......................................Y-PErlq.......................PKIMLRKAE
hFl_ENSPANP00000020575 ......................................CKKPsnpfryrmec................PEIDCEEGW
hFl_ENSPANP00000017457 ......................................LRGHaaidytqlglrfklqa..........WEVLYNVAS
hFl_ENSPANP00000020575 ......................................NALD..........................LESLSLLGF
hFl_ENSPANP00000004562 ......................................GENE..........................MDGQVNLGC
hFl_ENSPANP00000004438 ......................................V---..........................---------
hFl_ENSPANP00000008640 ......................................EPTD..........................DNSLQALTI
hFl_ENSPANP00000020327 ......................................DPEH..........................QRAN-----
hFl_ENSPANP00000020572 ......................................CEKFsspyries..................PELDCEEGW
hFl_ENSPANP00000016643 ......................................QERD..........................PKAHRFLGL
hFl_ENSPANP00000006588 ......................................LQDV..........................TEDQLSLAS
hFl_ENSPANP00000003995 ......................................FPDD..........................EVICNSMGE
hFl_ENSPANP00000007718 ......................................AEQNhlyedl....................FRARYNLGT
hFl_ENSPANP00000004384 ......................................CPIN..........................CQLLEALVA
hFl_ENSPANP00000011118 ......................................AEQNhlyedl....................FRARYNLGT
hFl_ENSPANP00000004252 ......................................GENE..........................TDGQVSLGC
hFl_ENSPANP00000007476 ......................................LPITqh........................SRIWPLYLR
hFl_ENSPANP00000006588 ......................................IPDS..........................TIALNLKAC
hFl_ENSPANP00000001745 ......................................SKEYrlqyla....................SETVLNLAF
hFl_ENSPANP00000014391 ......................................CPTS..........................VELWLA---
hFl_ENSPANP00000004313 ......................................TPTL..........................IELFLVKAK
hFl_ENSPANP00000004562 ......................................QTAL..........................VEAFNLKAA
hFl_ENSPANP00000001425 ......................................QLPQlplaa.....................LQALGEAAS
hFl_ENSPANP00000015647 ......................................AKTLgdqtge....................CRAHGNLGS
hFl_ENSPANP00000019118 ......................................QQLR..........................AAALISRGL
hFl_ENSPANP00000015209 ......................................TNKR..........................YELLYNCGI
hFl_ENSPANP00000006801 ......................................PGTRagaqlg....................GQVSLSMGN
hFl_ENSPANP00000003551 ......................................DPSH..........................ERA------
hFl_ENSPANP00000004252 ......................................QTAL..........................VEAFNLKAA
hFl_ENSPANP00000002479 ......................................EKAQgrrh......................GDQCFNVAL
hFl_ENSPANP00000004798 ......................................NPDHsfpvsshclr................AAAFYVRGL
hFl_ENSPANP00000000477 ......................................DPSH..........................ERA------
hFl_ENSPANP00000007362 ......................................DKYR..........................VETCCVIGN
hFl_ENSPANP00000002485 ......................................QEQYleahdrll..................AETHYQLGL
hFl_ENSPANP00000014498 lsiqdefchflqmtgqksratsilresleakvgvfgnfSPEV..........................AETYRLLGG
hFl_ENSPANP00000017253 ......................................AFGE..........................FHLWYQVAL
hFl_ENSPANP00000016353 ......................................QPEN..........................PMAHFLLGR
hFl_ENSPANP00000016352 ......................................QPEN..........................PMAHFLLGR
hFl_ENSPANP00000018429 ......................................LQAE..........................ARACFLLAR
hFl_ENSPANP00000013579 ......................................NPTD..........................AWSVHTVAH
hFl_ENSPANP00000000348 ......................................CSPT..........................LLLLNGQAA
hFl_ENSPANP00000015511 ......................................----..........................---------
hFl_ENSPANP00000007718 ......................................RSGNmlee......................AKTWLNIAL
hFl_ENSPANP00000011118 ......................................RSGNmlee......................AKTWLNIAL
hFl_ENSPANP00000007718 ......................................AHSLrnhtel....................QRAWATIGR
hFl_ENSPANP00000015642 ......................................GEKTsefk......................AKGYLALGL
hFl_ENSPANP00000001022 ......................................CPPWlqspkealyy................AKVYYRLGR
hFl_ENSPANP00000010920 ......................................NPAY..........................FRNHLRQAT
hFl_ENSPANP00000007476 ......................................LPCS..........................YKLWYRY--
hFl_ENSPANP00000003968 ......................................YQNHqpkspah...................LSLIREAAN
hFl_ENSPANP00000001022 ......................................EQES..........................FESSLCLAW
hFl_ENSPANP00000009443 ......................................DPRN..........................VFTQFYVFK
hFl_ENSPANP00000011463 ......................................----..........................---------
hFl_ENSPANP00000002961 ......................................DPDF..........................VDALTEFGI
hFl_ENSPANP00000017623 ......................................QAQLgtpsgpdrp.................LLTLAGLAV
hFl_ENSPANP00000011215 ......................................NPDS..........................TQPYKWRGK
hFl_ENSPANP00000000119 ......................................NATH..........................SLLHRNLGL
hFl_ENSPANP00000002418 ......................................DPNFy.........................SKNLLLLGK
hFl_ENSPANP00000014391 ......................................NPHH..........................PPAWIASAR
hFl_ENSPANP00000020421 ......................................HPKY..........................SDTLLDYGF
hFl_ENSPANP00000008387 ......................................RGPC..........................QESFYNLGR
hFl_ENSPANP00000005487 ......................................LPRR..........................VEDFCCQGR
hFl_ENSPANP00000002155 ......................................----..........................ADTWCSIGV
hFl_ENSPANP00000002567 ......................................SRWSq.........................CYYAYLTAV
hFl_ENSPANP00000019509 ......................................STKYhgpkalkv..................ALSHHLVAR
hFl_ENSPANP00000005069 ......................................SRWSq.........................CYYAYLTAV
hFl_ENSPANP00000000052 ......................................TSDL..........................ISLYEETAQ
hFl_ENSPANP00000005735 ......................................SPDN..........................---------
hFl_ENSPANP00000001022 ......................................FIDLgerdka....................AEAWLGAGR
hFl_ENSPANP00000018160 ......................................RMAN..........................PRSFLLLGD
hFl_ENSPANP00000018982 ......................................LQAE..........................ARACFLLAR
hFl_ENSPANP00000018968 ......................................CPNR..........................FDSWAGMAL
hFl_ENSPANP00000008513 ......................................ENFL..........................PLHYDYLQF
hFl_ENSPANP00000019509 ......................................----..........................---------
hFl_ENSPANP00000006588 ......................................FYND..........................DIFNFNYAQ
hFl_ENSPANP00000011118 ......................................HTEL..........................QRAWATIGR
hFl_ENSPANP00000003166 ......................................SPNN..........................IPALLGKAC
hFl_ENSPANP00000004798 ......................................SQQTpywh......................CRLLFQLAQ
hFl_ENSPANP00000015019 ......................................----..........................PKIHLQYAK
hFl_ENSPANP00000020573 ......................................CK--..........................---------
hFl_ENSPANP00000004562 ......................................HYDNilnvs.....................AIVLANLCV
hFl_ENSPANP00000004252 ......................................HYDNilnvs.....................AIVLANLCV
hFl_ENSPANP00000020003 ......................................TPED..........................VQALVSGKL
hFl_ENSPANP00000006922 ......................................HPFN..........................PWNWGRLAE
hFl_ENSPANP00000001081 ......................................YHNEgld.......................CLAYCGIGK
hFl_ENSPANP00000020426 ......................................----..........................---------
hFl_ENSPANP00000014026 ......................................KSAIphplim....................GVIRECGGK
hFl_ENSPANP00000015646 ......................................AEQLgrrede....................AKIRHGLGL
hFl_ENSPANP00000015647 ......................................AEQLgrrede....................AKIRHGLGL
hFl_ENSPANP00000015639 ......................................----..........................---------
hFl_ENSPANP00000004438 ......................................GATL..........................PELQLLRGK
hFl_ENSPANP00000015636 ......................................----..........................---------
hFl_ENSPANP00000006186 ......................................----..........................---------
hFl_ENSPANP00000015209 ......................................NSAR..........................TVMLFNLGS
hFl_ENSPANP00000000119 ......................................ASCAfgtedirt..................SGGYFHLAN
hFl_ENSPANP00000011874 ......................................-SRL..........................AELYVERAK
hFl_ENSPANP00000013299 ......................................NKKSmysrvpecq.................VTTYYYVGF
hFl_ENSPANP00000003968 ......................................QEGT..........................HELCYNTAC
hFl_ENSPANP00000005681 ......................................AQKCfkncygenhqrlvhikgncgkekvlfLRLYLLQGI
hFl_ENSPANP00000012992 ......................................YPNEgld.......................CLAYCGIGK
hFl_ENSPANP00000004384 ......................................----..........................---------
hFl_ENSPANP00000020572 ......................................NGAD..........................SEALHVLAL
hFl_ENSPANP00000006404 ......................................GPQLig........................IGKHSAAAE
hFl_ENSPANP00000000870 ......................................YSKHyplyslnv..................ASMWLKLGR
hFl_ENSPANP00000001745 ......................................TESF..........................AVALCHLAE
hFl_ENSPANP00000011077 ......................................DRRN..........................--------R
hFl_ENSPANP00000003398 ......................................NPCNq.........................ATMKYIEGV
hFl_ENSPANP00000008218 ......................................---D..........................WWWKVQIGK
hFl_ENSPANP00000010361 ......................................DKSWsqtfes....................ATFYSLKGE
hFl_ENSPANP00000017310 ......................................CKKF..........................AFVHISFAQ
hFl_ENSPANP00000004678 ......................................QQTN..........................LEP------
hFl_ENSPANP00000005519 ......................................C---..........................---------
hFl_ENSPANP00000008921 ......................................---Rekpfedfl..................PSHYNYLQF
hFl_ENSPANP00000016699 ......................................NRSF..........................YLALYKQMS
hFl_ENSPANP00000001022 ......................................SPLE..........................ARACFLAIR
hFl_ENSPANP00000015209 ......................................S--Nhkaesgalieaak.............SKIHQYKVR
hFl_ENSPANP00000012305 ......................................NRSF..........................YLALYKQMS
hFl_ENSPANP00000018202 ......................................GPQLig........................IGKHSAAAE


                          110                                   120                130              
                            |                                     |                  |              
d1kt1a1                A.QL.LM.....................N.......EFESAKGDFEKVLEV.........NPQN.............
hFl_ENSPANP00000004835 MeYY.CS.....................K.......DKSVAFKIFELGLKK.........YGDI.............
hFl_ENSPANP00000017500 L.AS.SK.....................G.......DHLTTIFYYCRSIAV.........KFPF.............
hFl_ENSPANP00000011496 T.LA.NG.....................N.......QSEEAVAAYRRALEL.........QPGY.............
hFl_ENSPANP00000005875 L.AG.SK.....................Y.......YNVEAMYCYLRCIQS.........EVSF.............
hFl_ENSPANP00000015319 T.LA.NG.....................D.......RSEEAVEAYTRALEI.........QPGF.............
hFl_ENSPANP00000019493 L.AV.YT.....................R.......RKLDAVYYYMRSLAA.........SNPI.............
hFl_ENSPANP00000015800 I.LH.NA.....................K.......LWNDAVIVATMAVEI.........APHF.............
hFl_ENSPANP00000017125 M.EE.ML.....................G.......NIAGARQVFERWMEW.........QPE-.............
hFl_ENSPANP00000011271 I.YEtEL.....................V.......DIEKAIAHYEQSADYykgees...NSSA.............
hFl_ENSPANP00000017151 I.YEtEL.....................V.......DIEKAIAHYEQSADYykgees...NSSA.............
hFl_ENSPANP00000007093 I.HK.DS.....................G.......NIPEAIASYRTALKL.........KPDF.............
hFl_ENSPANP00000007238 L.ER.AH.....................G.......DTQHCRKALHRAVQC.........TSDYpehv.........
hFl_ENSPANP00000007093 V.YY.EQ.....................G.......LIDLAIDTYRRAIEL.........QPHF.............
hFl_ENSPANP00000015526 G.NY.RL.....................K.......EYEKALKYVRGLLQT.........EPQN.............
hFl_ENSPANP00000010410 M.LK.EM.....................Q.......KLPEAVQLIEKASMMyleng....TPDT.............
hFl_ENSPANP00000004737 S.YF.KE.....................E.......KYKDAIHFYNKSLAE.........H---.............
hFl_ENSPANP00000020946 L.EF.QL.....................G.......DAERAKAIFENTLST.........YPKR.............
hFl_ENSPANP00000020864 V.QH.AL.....................K.......KSEKALDTLNKAIVI.........DPKN.............
hFl_ENSPANP00000007952 V.QN.SL.....................K.......RFEAAEQSYRMAIKH.........RRKY.............
hFl_ENSPANP00000016788 H.LF.KI.....................Qk......NLPKSRKVLLEAIER.........DKEN.............
hFl_ENSPANP00000004737 A.LE.AM.....................K.......DYTKAMDVYQKALDL.........DSSC.............
hFl_ENSPANP00000004737 A.LE.FL.....................N.......RFEEAKRTYEEGLKH.........EANN.............
hFl_ENSPANP00000000707 F.LV.DT.....................G.......LPEKAVAHYQQAIKL.........SPSH.............
hFl_ENSPANP00000004108 A.LT.AM.....................N.......KFEEAVTSYQKALDL.........DPEN.............
hFl_ENSPANP00000016788 L.EK.RH.....................D.......NIKPSDEVYRRGLQA.........IPLS.............
hFl_ENSPANP00000015646 F.HC.SR.....................G.......EYVQAAPYYEQYLRL.........APDLqdmege.......
hFl_ENSPANP00000015647 F.HC.SR.....................G.......EYVQAAPYYEQYLRL.........APDLqdmege.......
hFl_ENSPANP00000003166 M.AR.DK.....................G.......NFYEASDWFKEALQI.........NQDH.............
hFl_ENSPANP00000003324 A.LS.SL.....................N.......KHVEAVAYYKKALEL.........DPDN.............
hFl_ENSPANP00000005479 A.HL.AV.....................N.......DFELARADFQKVLQL.........YPNN.............
hFl_ENSPANP00000003528 A.RF.AL.....................Q.......KLEEAKKDYERVLEL.........EPNN.............
hFl_ENSPANP00000015647 T.KM.NM.....................N.......VMEEAIGYFEQQLAM.........LQQLsgnesvldr....
hFl_ENSPANP00000014391 L.EY.RA.....................G.......LKNIANTLMAKALQE.........CPNS.............
hFl_ENSPANP00000015646 T.KM.NM.....................N.......VMEEAIGYFEQQLAM.........LQQLsgnesvldr....
hFl_ENSPANP00000015646 T.YE.SL.....................G.......TFERAVVYQEQHLSI.........AAQMndlaak.......
hFl_ENSPANP00000015647 T.YE.SL.....................G.......TFERAVVYQEQHLSI.........AAQMndlaak.......
hFl_ENSPANP00000010352 L.LL.KM.....................N.......KPLKAKEAYLKALEL.........DRNN.............
hFl_ENSPANP00000012491 A.QL.LM.....................N.......EFESAKGDFEKVLEV.........NPQN.............
hFl_ENSPANP00000014791 M.LR.QA.....................S.......LNEAAEKYYDLAARL.........RPNY.............
hFl_ENSPANP00000005591 S.NM.AL.....................G.......KFRAALRDYETVVKV.........KPHD.............
hFl_ENSPANP00000015348 I.YE.LM.....................E.......NPSQAIEWLMQVVSV.........VPTD.............
hFl_ENSPANP00000014791 I.LM.NQ.....................G.......RTEEARRTFLKCSEI.........PDENlkdphahkssv..
hFl_ENSPANP00000013486 C.QL.EM.....................E.......SYDEAIANLQRAYSL.........AK--.............
hFl_ENSPANP00000015752 T.YT.LL.....................Q.......DYERAAEYHLRHLLI.........AQELadrvge.......
hFl_ENSPANP00000014239 V.HL.TM.....................Q.......QYASAFHFLSAAINF.........QPKM.............
hFl_ENSPANP00000001617 T.YT.LL.....................Q.......DYEKAIDYHLKHLAI.........AQELndrige.......
hFl_ENSPANP00000017253 M.LS.RL.....................G.......HKSLAQKVLRDAVER.........QSTC.............
hFl_ENSPANP00000020687 C.LY.YE.....................D.......CIEKAVQFFVQALRM.........APDH.............
hFl_ENSPANP00000014947 T.YK.HQ.....................N.......KLQEAIEDLSKVLDV.........EPDN.............
hFl_ENSPANP00000015753 T.YT.LL.....................Q.......DYERAAEYHLRHLLI.........AQELadrvge.......
hFl_ENSPANP00000003528 A.RT.FL.....................G.......KLNEAKQDFETVLLL.........EPGN.............
hFl_ENSPANP00000008218 V.AV.GI.....................G.......DTNLAHQCFRLALVN.........NNHH.............
hFl_ENSPANP00000015646 A.AR.CM.....................Q.......DLERAKQYHEQQLGI.........AEDLkdraae.......
hFl_ENSPANP00000013297 C.YL.KQ.....................G.......KFKQAETLYKEILTRaherefgsvDDEN.............
hFl_ENSPANP00000015647 A.AR.CM.....................Q.......DLERAKQYHEQQLGI.........AEDLkdraae.......
hFl_ENSPANP00000007362 T.YE.IL.....................K.......MPFYCLYYYRRAHQL.........RPND.............
hFl_ENSPANP00000014947 A.HK.GL.....................K.......NYQKSLTDLNKVLLL.........DSSI.............
hFl_ENSPANP00000008383 G.WQ.GL.....................K.......EYDQALADLKKAQEI.........APED.............
hFl_ENSPANP00000017676 A.HK.AL.....................K.......DYKSSFADISNLLQI.........EPRN.............
hFl_ENSPANP00000001814 L.YE.KT.....................D.......KLDEALEDYKSILEK.........DPSV.............
hFl_ENSPANP00000001168 S.YI.RL.....................K.......QKVKAFRTLQEALKC.........NYEH.............
hFl_ENSPANP00000003176 L.YS.QM.....................K.......KHVEALPLYERALKIyedslgqm.HPRV.............
hFl_ENSPANP00000010724 A.QA.AL.....................G.......NLEKATADLKKVLAI.........DPKN.............
hFl_ENSPANP00000013376 A.LE.KL.....................G.......RLDQAVLDLQRCVSL.........EPKN.............
hFl_ENSPANP00000013375 A.LE.KL.....................G.......RLDQAVLDLQRCVSL.........EPKN.............
hFl_ENSPANP00000000707 Q.LR.EQ.....................N.......LLDKAFESYRAAVQL.........NPDQ.............
hFl_ENSPANP00000012992 A.LS.ML.....................G.......EYDWALQANIKAQKL.........CKND.............
hFl_ENSPANP00000020687 C.YM.DT.....................E.......QYEEAVRDYEKVYQT.........----.............
hFl_ENSPANP00000000643 V.NL.AL.....................K.......NYSVSRECYKKILEI.........NPK-.............
hFl_ENSPANP00000007559 C.YL.KQ.....................G.......KYQDAETLYKEILTR.........----.............
hFl_ENSPANP00000003197 A.HE.KL.....................D.......NKKECLEDVT-----.........----.............
hFl_ENSPANP00000003945 L.CQ.NQ.....................G.......KFEDVERHYARALSIyealggph.DPNV.............
hFl_ENSPANP00000012699 C.YL.KQ.....................A.......KYAEAETLYKEILTR.........----.............
hFl_ENSPANP00000004293 A.LR.NM.....................G.......RVQEAIIHFREAIRL.........APCR.............
hFl_ENSPANP00000014070 A.FC.QL.....................E.......LYVEGLQDYEAALKI.........DPSN.............
hFl_ENSPANP00000008096 A.YL.IE.....................E.......MYDEAIQDYETAQEH.........NEND.............
hFl_ENSPANP00000014947 A.YE.TL.....................E.......QYGKAYVDYKTVLQI.........D---.............
hFl_ENSPANP00000020577 V.YK.LE.....................G.......EKRQAAEYYEKAQKI.........DPEN.............
hFl_ENSPANP00000020573 F.YR.RK.....................G.......DLDKAIELFQRALES.........TPNN.............
hFl_ENSPANP00000015642 I.LH.QL.....................G.......RYSLAEKILRDAVQV.........NSTA.............
hFl_ENSPANP00000019972 -.--.--.....................-.......---------------.........----.............
hFl_ENSPANP00000002155 C.YS.SI.....................G.......KVQDAFISYRQSIDK.........SEAS.............
hFl_ENSPANP00000003197 L.QL.QW.....................Kq......DLDRGLELISKAIEI.........DNKC.............
hFl_ENSPANP00000010388 A.LA.TL.....................G.......KVEEALREFLYCVSL.........DGKN.............
hFl_ENSPANP00000009536 C.HL.EL.....................K.......HFAEAVNWCDEGLQI.........DGKE.............
hFl_ENSPANP00000013401 A.HR.LL.....................G.......HWEEAAHDLALACKL.........DYD-.............
hFl_ENSPANP00000007559 L.YG.KR.....................G.......KYKEAEPLCKRALEI.........----.............
hFl_ENSPANP00000020038 A.LE.HL.....................G.......KLDQAFKDVQRCATL.........EPRN.............
hFl_ENSPANP00000020312 A.CY.RL.....................E.......ELTEAEDALSEANAL.........NNYN.............
hFl_ENSPANP00000000258 A.LA.TL.....................G.......KVEEALREFLYCVSL.........DGKN.............
hFl_ENSPANP00000017676 A.YE.AL.....................E.......KYPMAYVDYKTVLQI.........DNSV.............
hFl_ENSPANP00000006518 C.LF.EL.....................K.......YVAEALECLDDFK--.........----.............
hFl_ENSPANP00000013297 L.YG.KR.....................G.......KYKEAEPLCKRALEI.........----.............
hFl_ENSPANP00000003504 V.LA.QQ.....................G.......EYSEAIPILRAALKL.........EPSN.............
hFl_ENSPANP00000017184 A.FY.HL.....................G.......DYDKALYYLKEARTQ.........QPTD.............
hFl_ENSPANP00000006801 A.YR.LL.....................G.......HLGSAMECCEESMKIalqhgd...RPLQ.............
hFl_ENSPANP00000015190 I.LY.RL.....................Gr......YFDDALEDFKKVLDL.........NPGF.............
hFl_ENSPANP00000001081 A.LS.ML.....................G.......EYNWALQANIKAQKL.........CKND.............
hFl_ENSPANP00000006437 I.YK.HI.....................G.......NLREAAKWMDEAQSL.........DTAD.............
hFl_ENSPANP00000012699 L.YG.KR.....................G.......KYKEAEPLCQRALEI.........----.............
hFl_ENSPANP00000007476 L.EE.SL.....................G.......TFQSTKAVYDRILDL.........RIAT.............
hFl_ENSPANP00000009269 A.KR.NS.....................R.......QFVAALADLQEAVKL.........CPTN.............
hFl_ENSPANP00000014391 S.KW.LA.....................G.......DVPAARSILALAFQA.........NPNS.............
hFl_ENSPANP00000019581 A.HA.EV.....................W.......NEAEAKADLQKVLEL.........EPSMq............
hFl_ENSPANP00000020572 C.YR.AKvlqvmnlrengiygkrkll..E.......LIGHAVAHLKKADEA.........NDNL.............
hFl_ENSPANP00000007217 A.FY.HL.....................G.......DYARALRYLQEARSR.........EPTD.............
hFl_ENSPANP00000020685 T.LY.TM.....................G.......DFEFALVFYHRGYKL.........RPD-.............
hFl_ENSPANP00000020899 A.KR.SS.....................R.......QFAAALEDLNEAIKL.........CPNN.............
hFl_ENSPANP00000008387 C.LK.AL.....................G.......YMERAAESYGKVVDL.........APLH.............
hFl_ENSPANP00000010352 I.LM.NQ.....................Kk......DILGAKKCFERILEM.........DPSN.............
hFl_ENSPANP00000009338 A.FY.HL.....................G.......DYARALRYLQEARSR.........EPTD.............
hFl_ENSPANP00000018160 L.LL.KL.....................K.......WYDKAEKVLQHALAH.........EPVN.............
hFl_ENSPANP00000020864 A.YF.EL.....................S.......EYMQAERIFSEVRR-.........----.............
hFl_ENSPANP00000008387 M.SL.EQ.....................D.......NIKQAIFCYTKALKY.........EPTN.............
hFl_ENSPANP00000009057 I.YK.HI.....................G.......NLREAAKWMDEAQSL.........DTAD.............
hFl_ENSPANP00000018160 L.MF.RK.....................Q.......DYEQAVFHLQQLLER.........KPDN.............
hFl_ENSPANP00000007915 V.LQ.SQ.....................G.......NTTEAITYLKKFVKI.........ARNNfqsldf.......
hFl_ENSPANP00000003731 A.YV.KA.....................H.......QYTEAIEYYEAAQKI.........NGQD.............
hFl_ENSPANP00000015625 A.CL.LL.....................T.......EYQKARDFLVRAQRE.........QPFN.............
hFl_ENSPANP00000014767 A.QL.GL.....................G.......EIILAIRSFQVALHI.........YPMN.............
hFl_ENSPANP00000002080 A.LM.GLqiplgp...............K.......RFREAAAVFQETLK-.........----.............
hFl_ENSPANP00000007403 C.EY.HE.....................K.......NYAAALETFTEGQKL.........DSAD.............
hFl_ENSPANP00000007476 M.EC.KL.....................G.......EIDRARAIYSFCSQI.........----.............
hFl_ENSPANP00000005487 V.LM.AR.....................G.......SYEEAGTHLEKALHP.........APTS.............
hFl_ENSPANP00000003731 L.MF.RK.....................Q.......KHEAAINLYHQVLEK.........VPDN.............
hFl_ENSPANP00000013410 A.LN.EL.....................G.......RHKEAYECSSRCSLA.........LPHD.............
hFl_ENSPANP00000003097 S.LL.RL.....................H.......QSYEAARMFFEGLRL.........----.............
hFl_ENSPANP00000020575 C.YK.AQmiqikeatkgqprgqnrekidK.......MIRLAIFHFESAVEK.........KPTF.............
hFl_ENSPANP00000007248 L.YY.QT.....................E.......KYDLAIKDLKEALIQ.........LRGNqlidykilglqfk
hFl_ENSPANP00000019375 C.LF.EQ.....................C.......AFLDALNVFSHAAEL.........QPEK.............
hFl_ENSPANP00000003854 A.HA.AV.....................W.......NAQEAQADFAKVLEL.........DPALa............
hFl_ENSPANP00000006795 Q.LE.EE.....................E.......KFLNAESYYKKALAL.........DETF.............
hFl_ENSPANP00000002479 A.AA.RL.....................G.......QYDQALKYYKEALAQ.........----.............
hFl_ENSPANP00000017125 F.EL.SS.....................Gkeg....SLAKCRQIYEEANKT.........MRNC.............
hFl_ENSPANP00000005048 V.KY.TQ.....................Ggle....NLELSRKYFAQALKL.........NNRN.............
hFl_ENSPANP00000003731 Y.FM.MQ.....................Q.......NYSEALEVVNQITVT.........SGSF.............
hFl_ENSPANP00000018160 C.LE.MR.....................Q.......NYSGALETVNQIIVN.........FPSF.............
hFl_ENSPANP00000019375 L.QE.KM.....................GfceqkhrQFQKAEDHFSTAIRH.........NPQK.............
hFl_ENSPANP00000014239 I.HL.LE.....................G.......DLDKAIEIYKKAVEF.........SPEN.............
hFl_ENSPANP00000012835 C.LL.YL.....................G.......KLKDSLRQLEAMVQQ.........DPR-.............
hFl_ENSPANP00000001460 F.YR.RK.....................G.......SVDKALELLKMALET.........TPTS.............
hFl_ENSPANP00000015753 T.LK.VL.....................G.......RFDEAAVCCQRHLSI.........AQEQgdkvge.......
hFl_ENSPANP00000003968 I.LQ.LQ.....................G.......RTEEALQLYNQIIKL.........KPTD.............
hFl_ENSPANP00000006868 V.LY.DA.....................G.......FLGDALQLFLQCLAL.........DEDF.............
hFl_ENSPANP00000001460 I.HK.LK.....................G.......EVSDALLCYERALR-.........----.............
hFl_ENSPANP00000004313 L.QI.QM.....................R.......DLEGYRETRYQLLQL.........RPAQ.............
hFl_ENSPANP00000001617 V.YH.AK.....................G.......K--------------.........----.............
hFl_ENSPANP00000019732 V.LM.HR.....................E.......RYTQAEEIYQEALK-.........----.............
hFl_ENSPANP00000013913 A.LS.DL.....................G.......RYKKAYDAVAKCSLA.........VPQD.............
hFl_ENSPANP00000004649 L.AR.LQ.....................G.......RDDDARRDFARAARL.........GSPF.............
hFl_ENSPANP00000013914 A.LS.DL.....................G.......RYKKAYDAVAKCSLA.........VPQD.............
hFl_ENSPANP00000003176 L.YQ.KQ.....................N.......KYEQAEHFRKKSFKI.........----.............
hFl_ENSPANP00000003166 A.LF.KC.....................G.......KLQECKQTLLKARHV.........APSD.............
hFl_ENSPANP00000015752 T.LK.VL.....................G.......RFDEAAVCCQRHLSI.........AQEQgdkvge.......
hFl_ENSPANP00000001460 A.LA.KC.....................Ggk.....NYERAKACFEKALEG.........DPEN.............
hFl_ENSPANP00000004498 A.LS.GL.....................G.......RSKEVLKQFLYCLAL.........NPE-.............
hFl_ENSPANP00000014540 L.HK.YE.....................E.......SYGEALEGFSRAAAL.........DPAW.............
hFl_ENSPANP00000002479 G.YC.QL.....................R.......LFPLAVEAFLQAL--.........----.............
hFl_ENSPANP00000017858 L.YR.EM.....................H.......RPELVTKLYEAAVKK.........VPNS.............
hFl_ENSPANP00000007886 A.HR.LL.....................G.......HWEDAH---------.........----.............
hFl_ENSPANP00000018968 V.AL.RL.....................I.......RIPLARHAFEEGLRC.........NPDH.............
hFl_ENSPANP00000015642 L.LS.AQ.....................K.......HYHDALNIIDMALSE.........YPEN.............
hFl_ENSPANP00000003731 I.ME.KE.....................Q.......SYKDAVTNYKLAWKYs........HHAN.............
hFl_ENSPANP00000019484 C.LV.AL.....................G.......RLQEASQ--------.........----.............
hFl_ENSPANP00000019485 C.LV.AL.....................G.......RLQEASQ--------.........----.............
hFl_ENSPANP00000020575 A.LL.KC.....................Ggk.....NYERAKACFEKALEG.........DHEN.............
hFl_ENSPANP00000017457 A.QC.QL.....................G.......LWTEAAGSLREAMSK.........WP--.............
hFl_ENSPANP00000020575 V.YK.LK.....................G.......NMNEALEYYERALRL.........AA--.............
hFl_ENSPANP00000004562 L.LY.KE.....................G.......QYEAACSKFSAALQA.........SGYQ.............
hFl_ENSPANP00000004438 -.--.--.....................-.......---------------.........----.............
hFl_ENSPANP00000008640 L.YR.EM.....................H.......RPELVTKLYEAAVKK.........VPNS.............
hFl_ENSPANP00000020327 -.--.--.....................-.......---------------.........----.............
hFl_ENSPANP00000020572 T.RL.KC.....................Ggn.....QNERAKVCFEKALEK.........KPKN.............
hFl_ENSPANP00000016643 L.YE.LE.....................E.......NTDKAVECYRRSVEL.........NPTQ.............
hFl_ENSPANP00000006588 I.HY.MR.....................S.......HYQEAIDIYKRILLD.........NREY.............
hFl_ENSPANP00000003995 H.LF.RM.....................G.......FRDEAAGYFHKAVKL.........NPDF.............
hFl_ENSPANP00000007718 V.HW.RA.....................G.......QHSQAMRCLEGAREC.........AHTMrkrfme.......
hFl_ENSPANP00000004384 L.YL.KT.....................N.......QHDKARALWLTAFEK.........NPQN.............
hFl_ENSPANP00000011118 V.HW.RA.....................G.......QHSQAMRCLEGAREC.........AHTMrkrfme.......
hFl_ENSPANP00000004252 L.LY.RE.....................G.......QYEAACSKFFAALQA.........SGYQ.............
hFl_ENSPANP00000007476 F.LR.SH.....................P.......LPETAVRGYRRFLKL.........SPES.............
hFl_ENSPANP00000006588 N.HF.RLyngraaeaelk..........S.......LMDNASSSFEFAKEL.........IRHNllffrggegalqv
hFl_ENSPANP00000001745 A.QL.IL.....................G.......IPEQALSLLHMAIE-.........----.............
hFl_ENSPANP00000014391 -.LA.RL.....................E.......TYENARKVLNKAREN.........IPTD.............
hFl_ENSPANP00000004313 I.YK.HA.....................G.......NIKEAARWMDEAQAL.........DTAD.............
hFl_ENSPANP00000004562 I.EY.QL.....................R.......NYEVAQETL------.........----.............
hFl_ENSPANP00000001425 C.QL.LA.....................R.......DYTGALAVFTRMQRL.........A---.............
hFl_ENSPANP00000015647 A.FF.SK.....................G.......NYREALTNHRHQL--.........----.............
hFl_ENSPANP00000019118 E.WV.AS.....................G.......QDTKALQDFLLGVQM.........CPGN.............
hFl_ENSPANP00000015209 Q.LL.HI.....................G.......RPLAAFECLIEAVQV.........YHAN.............
hFl_ENSPANP00000006801 A.FL.GL.....................S.......VFQKALESFEKALRY.........AHNN.............
hFl_ENSPANP00000003551 -.--.--.....................-.......---------------.........----.............
hFl_ENSPANP00000004252 I.EY.QL.....................R.......NYEAAQEALT-----.........----.............
hFl_ENSPANP00000002479 A.YH.AL.....................G.......ELPQALAWYHRALG-.........----.............
hFl_ENSPANP00000004798 F.SF.FQ.....................G.......RYNEAKRFLRETLKM.........SNAEdlnrlt.......
hFl_ENSPANP00000000477 -.--.--.....................-.......---------------.........----.............
hFl_ENSPANP00000007362 Y.YS.LR.....................S.......QHEKAALYFQRALKL.........NPRY.............
hFl_ENSPANP00000002485 A.YG.YN.....................S.......QYDEAVAQFSKSIEV.........----.............
hFl_ENSPANP00000014498 A.DL.VQ.....................G.......NHSEAHKKLKKCL--.........----.............
hFl_ENSPANP00000017253 S.MV.AC.....................G.......KSAYAVSLLRECVKL.........RPSD.............
hFl_ENSPANP00000016353 W.CY.QVshlswlatallespls.....A.......TVEDALQSFLKAEEL.........QPGFs............
hFl_ENSPANP00000016352 W.CY.QVshlswlekktatallespls.A.......TVEDALQSFLKAEEL.........QPGFs............
hFl_ENSPANP00000018429 H.HV.HL.....................K.......QPEEALPFLERLLLL.........HRDS.............
hFl_ENSPANP00000013579 I.HE.MK.....................A.......EIKDGLEFMQHSETH.........WKDSdmla.........
hFl_ENSPANP00000000348 C.HM.AQ.....................G.......RWEAAEGLLQEALDK.........DSGY.............
hFl_ENSPANP00000015511 -.--.--.....................-.......---------------.........----.............
hFl_ENSPANP00000007718 S.RE.EA.....................Gd......AYELLAPCFQKALSC.........----.............
hFl_ENSPANP00000011118 S.RE.EA.....................Gd......AYELLAPCFQKALSC.........----.............
hFl_ENSPANP00000007718 T.HL.DI.....................Y.......DHCQSRDALLQAQ--.........----.............
hFl_ENSPANP00000015642 T.YS.LQatdaslrgmqe..........V.......LQRKALLAFQRAHSL.........SPTD.............
hFl_ENSPANP00000001022 L.TFcQL.....................K.......DAHDATEYFLLALA-.........----.............
hFl_ENSPANP00000010920 V.FR.CL.....................E.......RYSEAA---------.........----.............
hFl_ENSPANP00000007476 -.--.--.....................-.......---------------.........----.............
hFl_ENSPANP00000003968 F.KL.KY.....................G.......RKKEAISDLQQLWKQ.........NPKD.............
hFl_ENSPANP00000001022 A.YL.LA.....................S.......QAKKALDVLEPLLGS.........LKETesltqr.......
hFl_ENSPANP00000009443 I.AV.IE.....................G.......NSERALQA-------.........----.............
hFl_ENSPANP00000011463 -.--.--.....................-.......---------------.........----.............
hFl_ENSPANP00000002961 F.SE.ED.....................K.......DIIQADYLYTRALTI.........SPYH.............
hFl_ENSPANP00000017623 C.HQ.EL.....................E.......DPGEARACCEKALQL.........LG--.............
hFl_ENSPANP00000011215 A.HL.-L.....................G.......HWEETARDLALACEL.........NY--.............
hFl_ENSPANP00000000119 L.YI.AK.....................K.......NYEEAR---------.........----.............
hFl_ENSPANP00000002418 T.YL.KL.....................H.......NKKLAAFW-------.........----.............
hFl_ENSPANP00000014391 L.EE.VT.....................G.......KLQVARNLIMKGTEM.........CPKS.............
hFl_ENSPANP00000020421 Y.LL.NV.....................D.......NICQSVAIYQAALDI.........R---.............
hFl_ENSPANP00000008387 G.LH.QL.....................G.......LIHLAIHYYQKALEL.........PPLVvegievdqldlr.
hFl_ENSPANP00000005487 L.LL.SL.....................G.......DQAAAAGAFVQALKL.........APTL.............
hFl_ENSPANP00000002155 L.YQ.QQ.....................N.......QPMDALQAYICAVQL.........DHGH.............
hFl_ENSPANP00000002567 C.QG.AT.....................G.......DVDGAQIVFKEVQKL.........F---.............
hFl_ENSPANP00000019509 V.YE.SK.....................A.......EFRSALQHEKE----.........----.............
hFl_ENSPANP00000005069 C.QG.AT.....................G.......DVDGAQIVFKEVQKL.........F---.............
hFl_ENSPANP00000000052 I.EQ.LR.....................R.......NHNQAIQYLQQAHSIcvslftev.SPKT.............
hFl_ENSPANP00000005735 -.--.--.....................-.......---------------.........----.............
hFl_ENSPANP00000001022 L.HY.LM.....................Q.......EDELVELYLQAAIQT.........ALKS.............
hFl_ENSPANP00000018160 A.YM.NI.....................L.......EPEEAIVAYEQALNQ.........NPK-.............
hFl_ENSPANP00000018982 H.HV.HL.....................K.......KPEEALPFLEWLLLF.........HRDS.............
hFl_ENSPANP00000018968 A.RA.SRiqdklnsnelksdgpiw....K.......HATPVLNCFRRALEI.........DSSN.............
hFl_ENSPANP00000008513 A.YY.RV.....................G.......EYVKALECAKAYLLC.........HPDD.............
hFl_ENSPANP00000019509 -.--.--.....................-.......---------------.........----.............
hFl_ENSPANP00000006588 A.KA.AT.....................G.......NTSEGEEAFLLIQSEk........MKND.............
hFl_ENSPANP00000011118 T.HL.DI.....................Y.......DHCQSRDALLQAQ--.........----.............
hFl_ENSPANP00000003166 I.SF.NK.....................K.......DYRGALAYYKKALRT.........NPGC.............
hFl_ENSPANP00000004798 L.HT.LE.....................K.......DLVSACD--------.........----.............
hFl_ENSPANP00000015019 A.KE.AD.....................G.......RYKEAVVAYENAKQW.........----.............
hFl_ENSPANP00000020573 -.--.--.....................-.......---------------.........----.............
hFl_ENSPANP00000004562 S.YI.MT.....................S.......QNEEAEELMRK----.........----.............
hFl_ENSPANP00000004252 S.YI.MT.....................S.......QNEEAEELMRK----.........----.............
hFl_ENSPANP00000020003 A.LR.YA.....................G.......RQTEALKCVAQAS--.........----.............
hFl_ENSPANP00000006922 A.YL.NL.....................G.......---------------.........----.............
hFl_ENSPANP00000001081 V.YL.KK.....................N.......RFLEALNHFEKART-.........----.............
hFl_ENSPANP00000020426 -.--.--.....................-.......---------------.........----.............
hFl_ENSPANP00000014026 M.HL.RE.....................G.......EFEKAHTDFFEAFKN.........----.............
hFl_ENSPANP00000015646 S.LW.AS.....................G.......NLEEAQHQLYRASAL.........FETIrheaqlntdykls
hFl_ENSPANP00000015647 S.LW.AS.....................G.......NLEEAQHQLYRASAL.........FETIrheaqlntdykls
hFl_ENSPANP00000015639 -.--.--.....................-.......---------------.........----.............
hFl_ENSPANP00000004438 C.LR.IK.....................G.......EDANAAACFKRAVEL.........----.............
hFl_ENSPANP00000015636 -.--.--.....................-.......---------------.........----.............
hFl_ENSPANP00000006186 -.--.--.....................-.......---------------.........----.............
hFl_ENSPANP00000015209 A.YC.LR.....................S.......EYDKARKCLHQAASMi........HPKEvp...........
hFl_ENSPANP00000000119 I.FY.DL.....................K.......KLDLADTLYTKVSEI.........----.............
hFl_ENSPANP00000011874 W.LW.SK.....................G.......DVHQALIVLQKGVEL.........----.............
hFl_ENSPANP00000013299 A.YL.MM.....................R.......RYQDAIRVFANILLY.........IQRT.............
hFl_ENSPANP00000003968 A.LI.GQ.....................G.......QLNQAMKILQKA---.........----.............
hFl_ENSPANP00000005681 R.NY.HS.....................G.......NDVEACEYLNKARQLlkelyi...DPSK.............
hFl_ENSPANP00000012992 V.YF.FD.....................F.......RFLEALNHFEKART-.........----.............
hFl_ENSPANP00000004384 -.--.--.....................-.......---------------.........----.............
hFl_ENSPANP00000020572 L.QE.LN.....................K.......KMQQADEDSER----.........----.............
hFl_ENSPANP00000006404 L.YL.NL.....................D.......LVKEAIDAFI-----.........----.............
hFl_ENSPANP00000000870 L.YM.GL.....................E.......HKAAGEKALKKAIAI.........----.............
hFl_ENSPANP00000001745 L.HA.EQ.....................G.......CFAAASEVLKHLKER.........FPPN.............
hFl_ENSPANP00000011077 L.KV.YQ.....................G.......LYCVAIRDFKQAAEL.........F---.............
hFl_ENSPANP00000003398 L.MF.VA.....................G.......NTSLAKMKLQECLNI.........RKS-.............
hFl_ENSPANP00000008218 C.YY.RL.....................G.......MYREAEKQFKSALK-.........----.............
hFl_ENSPANP00000010361 V.CF.NM.....................G.......QIALAKKMLRKALKL.........----.............
hFl_ENSPANP00000017310 F.EL.SQ.....................G.......NVKKSKQLLQKAVE-.........----.............
hFl_ENSPANP00000004678 -.--.--.....................-.......---------------.........----.............
hFl_ENSPANP00000005519 -.--.--.....................-.......---------------.........----.............
hFl_ENSPANP00000008921 A.YY.NI.....................G.......NYTQAVECAKTYLLF.........FPND.............
hFl_ENSPANP00000016699 F.LE.KR.....................G.......CPRTALEYCKLILSL.........EPDE.............
hFl_ENSPANP00000001022 L.LL.SL.....................G.......RHEEVL---------.........----.............
hFl_ENSPANP00000015209 A.YI.QM.....................K.......SLKACKREIKSVMNT.........AGNS.............
hFl_ENSPANP00000012305 F.LE.KR.....................G.......CPRTALEYCKLILSL.........EPDE.............
hFl_ENSPANP00000018202 L.YL.NL.....................D.......LVKEAIDAFI-----.........----.............


                                     140       150       160                                        
                                       |         |         |                                        
d1kt1a1                ........KAARLQIFMCQKKAKEHNERDRRTYANMFKKF-----aeqda...........................
hFl_ENSPANP00000004835 ........PEYVLAYIDYLSHLNEDNN------------------trvlfervltsgslppeksgeiwarflafesn
hFl_ENSPANP00000017500 ........PAASTNLQKALS-------------------------kalesrdevktkwgvsdfikafikfhghvyls
hFl_ENSPANP00000011496 ........IRSRYNLGISCINLGAHREAVEHFLEALNM-------qrksrgprgeggamseniwstlrlalsmlgqs
hFl_ENSPANP00000005875 ........EGAYGNLKRLYDKAAK---------------------myhqlkkcetrklspgkkrckdikrllvnfmy
hFl_ENSPANP00000015319 ........IRSRYNLGISCINLGAYREAVSNFLTAL---------slqrksrnqqqvphpaisgniwaalrialslm
hFl_ENSPANP00000019493 ........LTAKESLMSLFEETKRKAEQME---------------kkqheelelspdqwrkgkkstfrhvgddttrl
hFl_ENSPANP00000015800 ........AVNHFTLGNVYVAMEEFEKALVWYESTLKLQP-----efvpaknriqtiqc..................
hFl_ENSPANP00000017125 ........EQAWHSYINFELRYKEVDRARTIYERFVLVHPD----vknwikyarfeekhayfaharkvyeraveffg
hFl_ENSPANP00000011271 ........NKCLLKVAGYAALLEQYQKAIDIYEQ-----------vgtnamdspllkysakdyffkaalchfcidml
hFl_ENSPANP00000017151 ........NKCLLKVAAYAAQLEQYQKAIEIYEQV----------gantmdnpllkysakdyffkaalchfivdeln
hFl_ENSPANP00000007093 ........PDAYCNLAHCLQIVCDWTDYDERMK------------klvsivadqleknrlpsvhphhsmlyplshgf
hFl_ENSPANP00000007238 ........CEVLLTMERTE--------------------------gsledwdtavqktetrlarvneqrmka.....
hFl_ENSPANP00000007093 ........PDAYCNLANALKEKGSVAEAEDCYNTALR--------lcpt............................
hFl_ENSPANP00000015526 ........NQAKELERLI---------------------------dkamkkdglvgmaivggmalgvaglagligla
hFl_ENSPANP00000010410 ........AAMALERAGKLIENVDPEKAVQLY-------------qqtanvfeneerlrqavellgkasrllvrgrr
hFl_ENSPANP00000004737 ........-------------------------------------rtpdvlkkcqqaekilke..............
hFl_ENSPANP00000020946 ........TDVWSVYIDMTIKHGSQKAVRDIFERVIHL-------slapkrmkfffkryldyekqhgtekdvqavka
hFl_ENSPANP00000020864 ........PLCKFHRASVLFANEKYKSALQ---------------eleelkqivpkeslvyfligkvykklgqthla
hFl_ENSPANP00000007952 ........PDCYYNLGRLYADLNRHVDALNAWRNATVLKPE----hslawnnmiilldntgnlaqaeavgrealeli
hFl_ENSPANP00000016788 ........TKLYLNLLEME--------------------------ysgdlkqneenilncfdkavhgslpikmritf
hFl_ENSPANP00000004737 ........KEAADGYQRC---------------------------m...............................
hFl_ENSPANP00000004737 ........PQLKEGLQ-----------------------------nme.............................
hFl_ENSPANP00000000707 ........HVAMVNLGRLYRSLGENSMAEEWYKRAL---------qva.............................
hFl_ENSPANP00000004108 ........DSYKSNLK-----------------------------ia..............................
hFl_ENSPANP00000016788 ........VDLWIHYI-----------------------------nflketldpgdpetnntirgtfehavlaagtd
hFl_ENSPANP00000015646 ........GKVCHNLGYAHYCLGNYQEAVKYYEQ-----------dlalakdlhdklsqakaycnlglafkallnfs
hFl_ENSPANP00000015647 ........GKVCHNLGYAHYCLGNYQEAVKYYEQ-----------dlalakdlhdklsqakaycnlglafkallnfs
hFl_ENSPANP00000003166 ........PDAWSLIGNLHLAKQEWGPGQKKFERIL---------kqpst...........................
hFl_ENSPANP00000003324 ........ETYKSNLKIAELKLR----------------------e...............................
hFl_ENSPANP00000005479 ........KAAKTQLAVCQQRIRRQL-------------------arekklyanm......................
hFl_ENSPANP00000003528 ........FEATNELR-----------------------------ki..............................
hFl_ENSPANP00000015647 ........GRAYGNLGDCYEALGDYEEAIKYYEQYL---------svaqs...........................
hFl_ENSPANP00000014391 ........GILWSEAIFLEARPQRRTKS-----------------vdalkkcehdphvllavaklfwsqrkitkare
hFl_ENSPANP00000015646 ........GRAYGNLGDCYEALGDYEEAIKYYEQYL---------svaqsl..........................
hFl_ENSPANP00000015646 ........TVSYSSLGRTHHALQNYSQAVMY--------------lqeglrlae.......................
hFl_ENSPANP00000015647 ........TVSYSSLGRTHHALQNYSQAV----------------mylqeglr........................
hFl_ENSPANP00000010352 ........ADLWYNLAIVYIELKEPNEALKNFNRALELNPK----hklalfnsailmqesg................
hFl_ENSPANP00000012491 ........KAARLQISMCQKKAKEHNERDRRIYANMFK-------kf..............................
hFl_ENSPANP00000014791 ........PAALMNLGAILHLNGRLQKAEANYLRALQLKPD----dvitqsnlrklwn...................
hFl_ENSPANP00000005591 ........KDAKMKYQECNKIVKQ---------------------kaferaiagd......................
hFl_ENSPANP00000015348 ........PQVLSKLGELYDHEGDKSQAFQYYYE-----------syryfpcnieviewlgayyidtqfwekaiqyf
hFl_ENSPANP00000014791 ........TSCLYNLGKLYHEQGHYEEALSVYKEAIQ--------kmprqfapqslynmmgeaymrlsklpeaehwy
hFl_ENSPANP00000013486 ........-------------------------------------eq..............................
hFl_ENSPANP00000015752 ........GRACWSLGNAYVSMGRPAQALTFAKKH----------lqisqeigdrhgeltarmnvaqlqlvlgrl..
hFl_ENSPANP00000014239 ........GELYMLLAVALTNLEDIENAKRAYAEAVHL-------dkcnplvnlnyavllynqgekknalaqyqe..
hFl_ENSPANP00000001617 ........GRACWSLGNAYTALGNHDQAMHFAEKHLE--------isrevgdksgeltarlnlsdlqm.........
hFl_ENSPANP00000017253 ........HEAWQGLGEVLQAQGQNEAAVDCFLTALE--------lea.............................
hFl_ENSPANP00000020687 ........EKACIACRNAKALKAKKE-------------------dgnkafk.........................
hFl_ENSPANP00000014947 ........ELAKKTLSEVERDLKNS--------------------ea..............................
hFl_ENSPANP00000015753 ........GRACWSLGNAYVSMGRPAQALTFAKKH----------lqisqeigdrhgeltarmnvaqlqlvlgrl..
hFl_ENSPANP00000003528 ........KQAVTELSK----------------------------ik..............................
hFl_ENSPANP00000008218 ........AEAYNNLAVLEMRKGHVEQARALLQTA----------sslaphmyephfnfatisdkigdlqrsyvaaq
hFl_ENSPANP00000015646 ........GRASSNLGIIHQMKGDYDTALK---------------lhk.............................
hFl_ENSPANP00000013297 ........KPIW---------------------------------mhaeereeckgkqkdgtsfgeyggwykackvd
hFl_ENSPANP00000015647 ........GRASSNLGIIHQMKGDYDTALK---------------lhkt............................
hFl_ENSPANP00000007362 ........SRMLVALGECYEKLNQLVEAKKCYWRAY---------avgdvekmalvklaklheqlteseqaaqcyik
hFl_ENSPANP00000014947 ........VEAKMELEEVTRLL-----------------------nl..............................
hFl_ENSPANP00000008383 ........KAIQAELLKVKQKIKAQKDKEKAVY------------akm.............................
hFl_ENSPANP00000017676 ........GPAQKLRQEV---------------------------kqn.............................
hFl_ENSPANP00000001814 ........HQAREACMRLPKQIEERNERL----------------k...............................
hFl_ENSPANP00000001168 ........WQIWENYILTSTDVGEFSEAIKAYHRLL---------dlrdkykdvqvlkilvravingmtdrsgdvtt
hFl_ENSPANP00000003176 ........GETLKNLAVLSYEGGDFEKAAELYKRAME--------ik..............................
hFl_ENSPANP00000010724 ........RAAQEELGKVVIQGKKQ--------------------dag.............................
hFl_ENSPANP00000013376 ........KVFQEAL------------------------------rn..............................
hFl_ENSPANP00000013375 ........KVFQEAL------------------------------rn..............................
hFl_ENSPANP00000000707 ........AQAWMNMGGIQHIKGKYVSARAYYERALQ--------lvpds...........................
hFl_ENSPANP00000012992 ........PEG----------------------------------ikdli...........................
hFl_ENSPANP00000020687 ........-------------------------------------ektke...........................
hFl_ENSPANP00000000643 ........-------------------------------------lqtqvkdy........................
hFl_ENSPANP00000007559 ........-------------------------------------ahekefgsvngdnkpiwmhaeereeskdkrrd
hFl_ENSPANP00000003197 ........-------------------------------------avci............................
hFl_ENSPANP00000003945 ........AKTKNNLASAYLKQNKYQQAEELYKEI----------lhk.............................
hFl_ENSPANP00000012699 ........-------------------------------------ahvqefgsvdddhkpiwmhaeereemsksrhh
hFl_ENSPANP00000004293 ........LDCYEGLIECYLASNSIREAMV---------------mannvyktlganaqtltllatvcledpvtqek
hFl_ENSPANP00000014070 ........K------------------------------------iv..............................
hFl_ENSPANP00000008096 ........QQIREGLEKAQRLLKQSQ-------------------krdyykilgvkrnakkqeiikayrklalqwhp
hFl_ENSPANP00000014947 ........-------------------------------------................................
hFl_ENSPANP00000020577 ........AEFLTA-------------------------------l...............................
hFl_ENSPANP00000020573 ........GYLYHQIGCCYKA------------------------kvrqmqntgesetsgnkekiealkqyamdysn
hFl_ENSPANP00000015642 ........HEVWNGLGEVLQAQGNDAAATECFLTAL---------el..............................
hFl_ENSPANP00000019972 ........-------------------------------------keehpdyseeilkgelariiyknsvsiikgae
hFl_ENSPANP00000002155 ........ADTWCSIGVLYQQQ-----------------------n...............................
hFl_ENSPANP00000003197 ........DFAYETMGTIEVQRGNMEKAIDMFNKAIN--------laksememahlyslcdaahaqt..........
hFl_ENSPANP00000010388 ........KRARC--------------------------------e...............................
hFl_ENSPANP00000009536 ........KKLLE--------------------------------lra.............................
hFl_ENSPANP00000013401 ........-------------------------------------e...............................
hFl_ENSPANP00000007559 ........-------------------------------------re..............................
hFl_ENSPANP00000020038 ........QNFQETLR-----------------------------rln.............................
hFl_ENSPANP00000020312 ........AEVWAYLALVCLKVGRQLEAEQAYKYMIKLKL-----kdeallaeihtlq...................
hFl_ENSPANP00000000258 ........KRA----------------------------------r...............................
hFl_ENSPANP00000017676 ........TSALE--------------------------------gi..............................
hFl_ENSPANP00000006518 ........-------------------------------------gkfpeq..........................
hFl_ENSPANP00000013297 ........-------------------------------------re..............................
hFl_ENSPANP00000003504 ........KTIHAELSKL---------------------------vkk.............................
hFl_ENSPANP00000017184 ........TNVIRYIQLTEMKLSRC--------------------sqre............................
hFl_ENSPANP00000006801 ........ALCLLCFADIHRSRGDLETAFPRYDSAM---------simteignrlgqvqallgvakcwvarkaldka
hFl_ENSPANP00000015190 ........QDATLS-------------------------------lk..............................
hFl_ENSPANP00000001081 ........PEG----------------------------------ikdli...........................
hFl_ENSPANP00000006437 ........RFINSKCAKYMLRANMIKEAEEMCSK-----------ftr.............................
hFl_ENSPANP00000012699 ........-------------------------------------re..............................
hFl_ENSPANP00000007476 ........PQIVINYAMFLEEHKYFEESFKAYERG----------islfk...........................
hFl_ENSPANP00000009269 ........QEIKRLLARVEEECKQLQRS-----------------qq..............................
hFl_ENSPANP00000014391 ........EEIWLAAVKLESENDEYERARRLLAKA----------rssaptarvfmksvklewvqdniraaqdlcee
hFl_ENSPANP00000019581 ........KAVRRELRLLENR------------------------maekqeeer.......................
hFl_ENSPANP00000020572 ........FRVCSILASLHALADQYEEAEYYFQ------------ke..............................
hFl_ENSPANP00000007217 ........TNVLRYIQLTQLKMNR---------------------cs..............................
hFl_ENSPANP00000020685 ........-------------------------------------refkvgiqkaqeainnsvgspssiklenkgdl
hFl_ENSPANP00000020899 ........REIQRLLLRVEEECRQMQ-------------------q...............................
hFl_ENSPANP00000008387 ........LDARISLSTLQQQLGRPEKALEALE------------pmydp...........................
hFl_ENSPANP00000010352 ........VQGKHNLCVVYFEEKDLLKAERCLLE-----------tlala...........................
hFl_ENSPANP00000009338 ........TNVLRYIQLTQLKMNR---------------------c...............................
hFl_ENSPANP00000018160 ........-------------------------------------elsalmedgrcqvllakvyskmerpgdaital
hFl_ENSPANP00000020864 ........-------------------------------------i...............................
hFl_ENSPANP00000008387 ........VRYLWERSSLYEQMGDHKMAMDGYRRI----------lnllspsdgerfmqlardmaksyyeandvtsa
hFl_ENSPANP00000009057 ........RFINSKCAKYMLRANMIKEAEEMCSK-----------ftr.............................
hFl_ENSPANP00000018160 ........YMTLSRLIDLLRRCGKLEDVP----------------rffsmaekrnsraklepgfqyckglylwytge
hFl_ENSPANP00000007915 ........VRASTMLGDIYNEKGHYNKASQRFQQAF---------dttvelms........................
hFl_ENSPANP00000003731 ........FL-CCDLAELLLKLKKINKAEKVLKQAL---------ehd.............................
hFl_ENSPANP00000015625 ........HDINNELKKLASDYRDYVDKEKEMWHRMF--------ar..............................
hFl_ENSPANP00000014767 ........PEIWK--------------------------------e...............................
hFl_ENSPANP00000002080 ........-------------------------------------ggsqpda.........................
hFl_ENSPANP00000007403 ........ANFSVWIKRCQEAQ-----------------------n...............................
hFl_ENSPANP00000007476 ........-------------------------------------cdprttgafwqtwkdfevrhgnedtikemlri
hFl_ENSPANP00000005487 ........EAARARLGLLRLKKGDVPAAARDLQ------------glaevda.........................
hFl_ENSPANP00000003731 ........FLVLNKLIDLLRRSGKLEDI-----------------paffelakkvssrvplepgfnycrgiycwhig
hFl_ENSPANP00000013410 ........-------------------------------------esvt............................
hFl_ENSPANP00000003097 ........-------------------------------------vqrsq...........................
hFl_ENSPANP00000020575 ........EVAHLDLARMYIEAGNHRKAEETFQKLLCMKP-----................................
hFl_ENSPANP00000007248 .....lfaCEVLYNIAFMYAKKEEWKKAEE---------------q...............................
hFl_ENSPANP00000019375 ........ACFRYRCMACLLALKQHPACLSL--------------iteelkqdttnadvyilrarlynflqktqlsh
hFl_ENSPANP00000003854 ........PVVSRELRALEA-------------------------rirqkdeedka.....................
hFl_ENSPANP00000006795 ........KDAEDALQKLHKYMQ----------------------k...............................
hFl_ENSPANP00000002479 ........-------------------------------------cqkepd..........................
hFl_ENSPANP00000017125 ........-------------------------------------eekeerlmlleswrsfeeefgtasdke.....
hFl_ENSPANP00000005048 ........MRALFGLYM----------------------------sashiasnpka.....................
hFl_ENSPANP00000003731 ........LPALVLKMQLFLARQDWEQTVE---------------m...............................
hFl_ENSPANP00000018160 ........LPAFVKKMKLQLALQDWDQTVETA-------------qrl.............................
hFl_ENSPANP00000019375 ........AQYYLYRAKSRQLLQNIFGARQDVATVLLLNP-----kq..............................
hFl_ENSPANP00000014239 ........-------------------------------------................................
hFl_ENSPANP00000012835 ........-------------------------------------h...............................
hFl_ENSPANP00000001460 ........AFLHHQMGLCYKA------------------------q...............................
hFl_ENSPANP00000015753 ........ARALYNIGNVYHAKGK---------------------................................
hFl_ENSPANP00000003968 ........VGLLAVIAN----------------------------niitinkdqnvfdskkkvkltnaegvefklsk
hFl_ENSPANP00000006868 ........APAKLQVQKI---------------------------lc..............................
hFl_ENSPANP00000001460 ........-------------------------------------la..............................
hFl_ENSPANP00000004313 ........RASWIGYAIAYHLLEDYEMAAKILE------------ef..............................
hFl_ENSPANP00000001617 ........-------------------------------------sfgypgpqdvgefpeevrdalqaavdfyeenl
hFl_ENSPANP00000019732 ........-------------------------------------q...............................
hFl_ENSPANP00000013913 ........EHVIKLTQELAQKLG----------------------................................
hFl_ENSPANP00000004649 ........-------------------------------------arrqlvllnpyaalcnrmladmmgqlrr....
hFl_ENSPANP00000013914 ........EHVIKLTQELAQKLG----------------------................................
hFl_ENSPANP00000003176 ........-------------------------------------rqk.............................
hFl_ENSPANP00000003166 ........TVLMFNVALVLQRL-----------------------................................
hFl_ENSPANP00000015752 ........ARALYNIGNVYHAKGK---------------------................................
hFl_ENSPANP00000001460 ........PEFNTGYAITVYRLDNFN-------------------ia..............................
hFl_ENSPANP00000004498 ........-------------------------------------c...............................
hFl_ENSPANP00000014540 ........PEPRQREQQLLEFL-----------------------drl.............................
hFl_ENSPANP00000002479 ........-------------------------------------pl..............................
hFl_ENSPANP00000017858 ........EEYHSHLFMAYARVGEYKKMQQ---------------agmalykivpknpyyfwsvmslimqsisaqde
hFl_ENSPANP00000007886 ........-------------------------------------dl..............................
hFl_ENSPANP00000018968 ........WPCLDNLITVLYTLSDYTT------------------clyfickalekd....................
hFl_ENSPANP00000015642 ........FILLFSKVKLQSLCRGPDEAL----------------ltckhmlqiwksc...................
hFl_ENSPANP00000003731 ........PAIGFRLAFNYLKDKKFVEAIEICHDVLREHPN----ypk.............................
hFl_ENSPANP00000019484 ........-------------------------------------tigdl...........................
hFl_ENSPANP00000019485 ........-------------------------------------tigdl...........................
hFl_ENSPANP00000020575 ........PEFSTGYAISAYRLDGFKLATKGYRQF----------sllplrqavslnpdngylkvllalklqdngqe
hFl_ENSPANP00000017457 ........-------------------------------------................................
hFl_ENSPANP00000020575 ........-------------------------------------df..............................
hFl_ENSPANP00000004562 ........PDLSYNLALAYYSSRQYASALKH--------------i...............................
hFl_ENSPANP00000004438 ........-------------------------------------davqellavdeaalnqalvflakageselgat
hFl_ENSPANP00000008640 ........EEYHSHLFMAYARVGEYKKMQQ---------------agmalykivpknpyyfwsvmslimqsisaqde
hFl_ENSPANP00000020327 ........-------------------------------------gnlkyfey........................
hFl_ENSPANP00000020572 ........PEFTSGLAIASYRLDNW--------------------................................
hFl_ENSPANP00000016643 ........KDLVLKIAELLCKND----------------------vtdgrakywveraaklfpgspaiyklkeqlld
hFl_ENSPANP00000006588 ........LALNVYVALCYYKLDYYD-------------------vsqev...........................
hFl_ENSPANP00000003995 ........SDAKENFY-----------------------------rv..............................
hFl_ENSPANP00000007718 ........SECCVAIAQVLQDLGDFLAAKRALKKAYR--------lgsqkpvqraavcqnlqhvlavvrlqqqleda
hFl_ENSPANP00000004384 ........AEVFYHMC-----------------------------kff.............................
hFl_ENSPANP00000011118 ........SECCVAIAQVLQDLGDFLAAKRALKKAYR--------lgsqkpvqraavcqnlqhvlavvrlqqqleda
hFl_ENSPANP00000004252 ........PDLSYNLALAYYSSRQYASALKHI-------------ae..............................
hFl_ENSPANP00000007476 ........A------------------------------------eey.............................
hFl_ENSPANP00000006588 lpplvdviPEARLNLVIYYLRQDDVQEAYN---------------likdlepttpqeyilkgvvnaalgqemgsrdh
hFl_ENSPANP00000001745 ........-------------------------------------piladgaildkgramflvakcqvasaasydqp
hFl_ENSPANP00000014391 ........RHIWITAAKLEEANGNTQMVEKIIDRAI---------tslrangveinreqwiqdaeecdragsvatcq
hFl_ENSPANP00000004313 ........RFINSKCAKYMLKANLIKEAEEMC-------------skf.............................
hFl_ENSPANP00000004562 ........-------------------------------------tdmppraeeeldpvtlhnqalmnmdarptegf
hFl_ENSPANP00000001425 ........-------------------------------------reh.............................
hFl_ENSPANP00000015647 ........-------------------------------------vlamklkdremrklryllrenisvgdlvstss
hFl_ENSPANP00000019118 ........RDTYFHLLQTLKRLDRRDEATA---------------lw..............................
hFl_ENSPANP00000015209 ........PRLWLRLAECCIA------------------------an..............................
hFl_ENSPANP00000006801 ........DDAMLECRVC---------------------------c...............................
hFl_ENSPANP00000003551 ........-------------------------------------ggnlryfeq.......................
hFl_ENSPANP00000004252 ........-------------------------------------dmppraeeeldpvtlhnqalmnmdarptegfe
hFl_ENSPANP00000002479 ........-------------------------------------hyqpqgd.........................
hFl_ENSPANP00000004798 ........ACSLVLLGHIFYVLGNHR-------------------e...............................
hFl_ENSPANP00000000477 ........-------------------------------------ggnlryfeq.......................
hFl_ENSPANP00000007362 ........LGAWTLMG-----------------------------................................
hFl_ENSPANP00000002485 ........-------------------------------------iekrmavl........................
hFl_ENSPANP00000014498 ........-------------------------------------qiq.............................
hFl_ENSPANP00000017253 ........PTVPLMAAKV---------------------------cig.............................
hFl_ENSPANP00000016353 ........KAGRVYISKCYRELGKNSEA-----------------rww.............................
hFl_ENSPANP00000016352 ........KAGRVYISKCYRELGKNSEA-----------------rww.............................
hFl_ENSPANP00000018429 ........-------------------------------------gapeaawlsdcsllladiyshkclphlvlscv
hFl_ENSPANP00000013579 ........CHNYWHWALYLIEKGEYEAALTI--------------f...............................
hFl_ENSPANP00000000348 ........PETLVNLIVLSQHLGKP--------------------pe..............................
hFl_ENSPANP00000015511 ........-------------------------------------................................
hFl_ENSPANP00000007718 ........-------------------------------------aqqaqrpqlqrq....................
hFl_ENSPANP00000011118 ........-------------------------------------aqqaqrpqlqrq....................
hFl_ENSPANP00000007718 ........-------------------------------------aaf.............................
hFl_ENSPANP00000015642 ........HQAAFYLALQLAISRQIPEALGYVRQALQ--------lqgddanslhllal..................
hFl_ENSPANP00000001022 ........-------------------------------------aavllgdd........................
hFl_ENSPANP00000010920 ........-------------------------------------r...............................
hFl_ENSPANP00000007476 ........-------------------------------------lkar............................
hFl_ENSPANP00000003968 ........IHTLAQLISAY--------------------------sl..............................
hFl_ENSPANP00000001022 ........GVVYNLLGLALQGEGRVNRAARSYLRAL---------nraqevgdvrnqavamanlghlslkswaqhpa
hFl_ENSPANP00000009443 ........-------------------------------------i...............................
hFl_ENSPANP00000011463 ........-------------------------------------inkrlfekylkdesgfkdpssdwemsqssiks
hFl_ENSPANP00000002961 ........EKA----------------------------------lv..............................
hFl_ENSPANP00000017623 ........-------------------------------------dkslhpllapfleahvrlswrlgl........
hFl_ENSPANP00000011215 ........-------------------------------------d...............................
hFl_ENSPANP00000000119 ........-------------------------------------................................
hFl_ENSPANP00000002418 ........-------------------------------------lmk.............................
hFl_ENSPANP00000014391 ........EDVWLEAARL---------------------------qpgdtakavvaqavrhlpqsvriyiraaelet
hFl_ENSPANP00000020421 ........-------------------------------------qs..............................
hFl_ENSPANP00000008387 ........RDIAYNLSLIYQSSGNTGM------------------aqrl............................
hFl_ENSPANP00000005487 ........A------------------------------------qnslrkqpgraptarlfllrgqrcleeqchpe
hFl_ENSPANP00000002155 ........AAAWMDLGTLYESCNQPQDAIKCYLN-----------at..............................
hFl_ENSPANP00000002567 ........-------------------------------------krknnqieqfsvkk..................
hFl_ENSPANP00000019509 ........-------------------------------------gyti............................
hFl_ENSPANP00000005069 ........-------------------------------------krknnqieqfsvkk..................
hFl_ENSPANP00000000052 ........AETSALLAKAYAMSGE---------------------a...............................
hFl_ENSPANP00000005735 ........-------------------------------------krmarnvlkye.....................
hFl_ENSPANP00000001022 ........EEPLLAL------------------------------klyeeagdvffngtrhrhhaveyyraga....
hFl_ENSPANP00000018160 ........-------------------------------------................................
hFl_ENSPANP00000018982 ........G------------------------------------apeaawldchllladicsckclphlvlscvkv
hFl_ENSPANP00000018968 ........LSLWIEYGTMSYA------------------------lh..............................
hFl_ENSPANP00000008513 ........EDV----------------------------------l...............................
hFl_ENSPANP00000019509 ........-------------------------------------l...............................
hFl_ENSPANP00000006588 ........YIYLSWLARCYIMNKKPRLAWELYLKM----------etsgesfsllqliandcykmgqfyysakafdv
hFl_ENSPANP00000011118 ........-------------------------------------aafe............................
hFl_ENSPANP00000003166 ........P------------------------------------a...............................
hFl_ENSPANP00000004798 ........-------------------------------------llgvgae.........................
hFl_ENSPANP00000015019 ........---QSVIRIYLDHLNNPEKAV----------------sivretqspdgakmvarfflqlgdygsaiqfl
hFl_ENSPANP00000020573 ........-------------------------------------kfsn............................
hFl_ENSPANP00000004562 ........-------------------------------------i...............................
hFl_ENSPANP00000004252 ........-------------------------------------ie..............................
hFl_ENSPANP00000020003 ........-------------------------------------knrsladfekaltdyraelrddpiisthlakl
hFl_ENSPANP00000006922 ........-------------------------------------palsaalas.......................
hFl_ENSPANP00000001081 ........-------------------------------------l...............................
hFl_ENSPANP00000020426 ........-------------------------------------rqleh...........................
hFl_ENSPANP00000014026 ........-------------------------------------ydesgsprrttclkylvlanmlmksginpfds
hFl_ENSPANP00000015646 ...lfdlqTSSYQALQRVLVTLGHHDEALAV--------------aergrtrafadl....................
hFl_ENSPANP00000015647 ...lfdlqTSSYQALQRVLVTLGHHDEALAV--------------aergrtrafadl....................
hFl_ENSPANP00000015639 ........-------------------------------------gmagsrelkdfdlcelsllyaelevel.....
hFl_ENSPANP00000004438 ........-------------------------------------d...............................
hFl_ENSPANP00000015636 ........-------------------------------------gmagsrelkdfdlcelsllyaelevel.....
hFl_ENSPANP00000006186 ........-------------------------------------lineskqsa.......................
hFl_ENSPANP00000015209 ........PEAILLAVYLELQNGNTQLA-----------------lqii............................
hFl_ENSPANP00000000119 ........-------------------------------------whayln..........................
hFl_ENSPANP00000011874 ........-------------------------------------cfpen...........................
hFl_ENSPANP00000013299 ........KSMFQ--------------------------------rttykyeminkqneqmhallai..........
hFl_ENSPANP00000003968 ........-------------------------------------e...............................
hFl_ENSPANP00000005681 ........VDNLLQLG-----------------------------ft..............................
hFl_ENSPANP00000012992 ........-------------------------------------l...............................
hFl_ENSPANP00000004384 ........-------------------------------------slwkdqllfeaseggktdnlrklvskcqe...
hFl_ENSPANP00000020572 ........-------------------------------------gle.............................
hFl_ENSPANP00000006404 ........-------------------------------------egeewnk.........................
hFl_ENSPANP00000000870 ........-------------------------------------mevah...........................
hFl_ENSPANP00000001745 ........-------------------------------------sq..............................
hFl_ENSPANP00000011077 ........-------------------------------------ldtvstftsye.....................
hFl_ENSPANP00000003398 ........-------------------------------------lfgkknmlvgevmefladllffpqrdskksqr
hFl_ENSPANP00000008218 ........-------------------------------------qq..............................
hFl_ENSPANP00000010361 ........-------------------------------------................................
hFl_ENSPANP00000017310 ........-------------------------------------rgavplem........................
hFl_ENSPANP00000004678 ........-------------------------------------lsp.............................
hFl_ENSPANP00000005519 ........-------------------------------------sdffn...........................
hFl_ENSPANP00000008921 ........EVMNQNLAYYAAMLGE---------------------eharsigpre......................
hFl_ENSPANP00000016699 ........-------------------------------------dplcmll.........................
hFl_ENSPANP00000001022 ........-------------------------------------pfaerl..........................
hFl_ENSPANP00000015209 ........APSLFLKSNFEYLRGNYRKAVKL--------------l...............................
hFl_ENSPANP00000012305 ........-------------------------------------dplcmll.........................
hFl_ENSPANP00000018202 ........-------------------------------------egeewnk.........................


                                                                                                    
                                                                                                    
d1kt1a1                .............................................................................
hFl_ENSPANP00000004835 igdlasilkvekrrftafkeeyegketallvdrykfmdlypcsaselkalgykdv......................
hFl_ENSPANP00000017500 ksleklsplrekleeqfkrllfqkafnsqqlvhvtvinlfqlhhlrdfsneteqhsysqdeqlcwtqllalfmsflg
hFl_ENSPANP00000011496 daygaadardlstlltmfgl.........................................................
hFl_ENSPANP00000005875 lqsllqpksssmdseltslcqsvledfnlclfylpsspnlslasedeeeyesgyaflpdllifqmviiclmcvhsle
hFl_ENSPANP00000015319 dqpelfqaanlgdldvllrafnl......................................................
hFl_ENSPANP00000019493 eiwihpshprssqgtesgkdseqenglgslspsdlnkrfilsflhahgklftrigmetfpavaekvlrefqvllqhs
hFl_ENSPANP00000015800 .............................................................................
hFl_ENSPANP00000017125 dehmdehlyvafakfeenqkefervrviykyaldriskqdaqelfknytifekkfgdrrgiediivskrrfqyeeev
hFl_ENSPANP00000011271 naklavqkyeelfpafsdsrecklmkklleaheeqnvdsytesvkeydsisrldqwlttmllrikktiqgdeed...
hFl_ENSPANP00000017151 aklalekyeemfpaftdsreckllkklleaheeqnseayteavkefdsisrldqwlttmllrikksiqgd.......
hFl_ENSPANP00000007093 rkaiaerhgnlcldkinvlhkppyehpkdlklsdgrlrvgyvssdfgnhptshlmqsipgmhnpdkfevfcyalspd
hFl_ENSPANP00000007238 .............................................................................
hFl_ENSPANP00000007093 .............................................................................
hFl_ENSPANP00000015526 vsk..........................................................................
hFl_ENSPANP00000010410 fdeaalsiqkekniykeienyptcykktiaqvlvhlhrndyvaaercvresysipgfngsedcaaleqllegydqqd
hFl_ENSPANP00000004737 .............................................................................
hFl_ENSPANP00000020946 kaleyvea.....................................................................
hFl_ENSPANP00000020864 lmnfswamdldpkg...............................................................
hFl_ENSPANP00000007952 pndhslmfslanvlgksqkykesealflkaikanpnaasyhgnlavlyhrwghldlakkhyeislqldptasg....
hFl_ENSPANP00000016788 sqrkvefledfgsdvnkllnaydehqtllkeqdslkrka......................................
hFl_ENSPANP00000004737 .............................................................................
hFl_ENSPANP00000004737 .............................................................................
hFl_ENSPANP00000000707 .............................................................................
hFl_ENSPANP00000004108 .............................................................................
hFl_ENSPANP00000016788 frsdrlwemyinweneqgnlrevtaiydrilgiptqlyshhfqrfkehvqnnlprdlltg.................
hFl_ENSPANP00000015646 kaeecqkyllslaqslnns..........................................................
hFl_ENSPANP00000015647 kaeecqkyllslaqslnns..........................................................
hFl_ENSPANP00000003166 .............................................................................
hFl_ENSPANP00000003324 .............................................................................
hFl_ENSPANP00000005479 .............................................................................
hFl_ENSPANP00000003528 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000014391 wfhrtvkidsdlgdawaffykfelqhgteeqqeevrkrcesaeprhgelw...........................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000010352 .............................................................................
hFl_ENSPANP00000012491 .............................................................................
hFl_ENSPANP00000014791 .............................................................................
hFl_ENSPANP00000005591 .............................................................................
hFl_ENSPANP00000015348 erasliqptqvkwqlmvascfrrsgnyqkaldtykdthrkfpenveclr............................
hFl_ENSPANP00000014791 mes..........................................................................
hFl_ENSPANP00000013486 .............................................................................
hFl_ENSPANP00000015752 .............................................................................
hFl_ENSPANP00000014239 .............................................................................
hFl_ENSPANP00000001617 .............................................................................
hFl_ENSPANP00000017253 .............................................................................
hFl_ENSPANP00000020687 .............................................................................
hFl_ENSPANP00000014947 .............................................................................
hFl_ENSPANP00000015753 .............................................................................
hFl_ENSPANP00000003528 .............................................................................
hFl_ENSPANP00000008218 kseaafpdhvdtqhlikqlr.........................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000013297 sptvtttlknlgalyrrqgkfeaa.....................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000007362 yiqdiyscgeivehleestafrylaqyyfkcklwdeastcaqkccafnd............................
hFl_ENSPANP00000014947 .............................................................................
hFl_ENSPANP00000008383 .............................................................................
hFl_ENSPANP00000017676 .............................................................................
hFl_ENSPANP00000001814 .............................................................................
hFl_ENSPANP00000001168 glkgklqelfgrvtsrvtndgeiwrlyaqvygngqsekpdenekafqclskaykcd.....................
hFl_ENSPANP00000003176 .............................................................................
hFl_ENSPANP00000010724 .............................................................................
hFl_ENSPANP00000013376 .............................................................................
hFl_ENSPANP00000013375 .............................................................................
hFl_ENSPANP00000000707 .............................................................................
hFl_ENSPANP00000012992 .............................................................................
hFl_ENSPANP00000020687 .............................................................................
hFl_ENSPANP00000000643 .............................................................................
hFl_ENSPANP00000007559 sapygeygswykackvdsptvnttlrslgalyrrqgkleaa....................................
hFl_ENSPANP00000003197 .............................................................................
hFl_ENSPANP00000003945 .............................................................................
hFl_ENSPANP00000012699 eggtpyaeyggwykackvssptvnttlrnlgalyrrqgkleaa..................................
hFl_ENSPANP00000004293 aktlldkaltqrpdyikavvkkaellsreqkyedgiallrnalanqsdcvlhrilgdflvavneyqeamdqysials
hFl_ENSPANP00000014070 .............................................................................
hFl_ENSPANP00000008096 dn...........................................................................
hFl_ENSPANP00000014947 .............................................................................
hFl_ENSPANP00000020577 .............................................................................
hFl_ENSPANP00000020573 kalekglnpldaysdlaefleaecyqtpfskedpdaekqqshqhycnlqkyngksedtalqrgleglsiskksteke
hFl_ENSPANP00000015642 .............................................................................
hFl_ENSPANP00000019972 fhvsllsiaqlfdfakdlqkeiyddlqtlhtddpltwdyvarreleiesqtgeeqpttkqakavevgrkeerccavy
hFl_ENSPANP00000002155 .............................................................................
hFl_ENSPANP00000003197 .............................................................................
hFl_ENSPANP00000010388 .............................................................................
hFl_ENSPANP00000009536 .............................................................................
hFl_ENSPANP00000013401 .............................................................................
hFl_ENSPANP00000007559 .............................................................................
hFl_ENSPANP00000020038 .............................................................................
hFl_ENSPANP00000020312 .............................................................................
hFl_ENSPANP00000000258 .............................................................................
hFl_ENSPANP00000017676 .............................................................................
hFl_ENSPANP00000006518 .............................................................................
hFl_ENSPANP00000013297 .............................................................................
hFl_ENSPANP00000003504 .............................................................................
hFl_ENSPANP00000017184 .............................................................................
hFl_ENSPANP00000006801 ldvieraqdlaee................................................................
hFl_ENSPANP00000015190 .............................................................................
hFl_ENSPANP00000001081 .............................................................................
hFl_ENSPANP00000006437 .............................................................................
hFl_ENSPANP00000012699 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000009269 .............................................................................
hFl_ENSPANP00000014391 alrhyed......................................................................
hFl_ENSPANP00000019581 .............................................................................
hFl_ENSPANP00000020572 .............................................................................
hFl_ENSPANP00000007217 .............................................................................
hFl_ENSPANP00000020685 sflskqaetikaqqkpqpmrhllhptkgepkrkgslksektvrqllgelyvdkeylekllldedlikgtmkggltve
hFl_ENSPANP00000020899 .............................................................................
hFl_ENSPANP00000008387 .............................................................................
hFl_ENSPANP00000010352 .............................................................................
hFl_ENSPANP00000009338 .............................................................................
hFl_ENSPANP00000018160 qqarelq......................................................................
hFl_ENSPANP00000020864 .............................................................................
hFl_ENSPANP00000008387 iniideafskh..................................................................
hFl_ENSPANP00000009057 .............................................................................
hFl_ENSPANP00000018160 pndalrhfnkark................................................................
hFl_ENSPANP00000007915 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000015625 .............................................................................
hFl_ENSPANP00000014767 .............................................................................
hFl_ENSPANP00000002080 .............................................................................
hFl_ENSPANP00000007403 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000005487 .............................................................................
hFl_ENSPANP00000003731 qpnealkflnkark...............................................................
hFl_ENSPANP00000013410 .............................................................................
hFl_ENSPANP00000003097 .............................................................................
hFl_ENSPANP00000020575 .............................................................................
hFl_ENSPANP00000007248 .............................................................................
hFl_ENSPANP00000019375 yrdlhgalllnpkhpqarmllqkmvqaqqarqdagilavqgrlqhalqrincaiennpldpslflfrgtmyrrlqef
hFl_ENSPANP00000003854 .............................................................................
hFl_ENSPANP00000006795 .............................................................................
hFl_ENSPANP00000002479 .............................................................................
hFl_ENSPANP00000017125 .............................................................................
hFl_ENSPANP00000005048 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000019375 .............................................................................
hFl_ENSPANP00000014239 .............................................................................
hFl_ENSPANP00000012835 .............................................................................
hFl_ENSPANP00000001460 .............................................................................
hFl_ENSPANP00000015753 .............................................................................
hFl_ENSPANP00000003968 kqlqaiefnkallamytnqaeqcrkisaslqsqspehllpvliqaaqlcrekqhtkaiellqefsdqhpenaaeikl
hFl_ENSPANP00000006868 .............................................................................
hFl_ENSPANP00000001460 .............................................................................
hFl_ENSPANP00000004313 .............................................................................
hFl_ENSPANP00000001617 sl...........................................................................
hFl_ENSPANP00000019732 .............................................................................
hFl_ENSPANP00000013913 .............................................................................
hFl_ENSPANP00000004649 .............................................................................
hFl_ENSPANP00000013914 .............................................................................
hFl_ENSPANP00000003176 .............................................................................
hFl_ENSPANP00000003166 .............................................................................
hFl_ENSPANP00000015752 .............................................................................
hFl_ENSPANP00000001460 .............................................................................
hFl_ENSPANP00000004498 .............................................................................
hFl_ENSPANP00000014540 .............................................................................
hFl_ENSPANP00000002479 .............................................................................
hFl_ENSPANP00000017858 nlsktmflplaermvekmvkedkieaeaevelyymilerlgkyqealdvi...........................
hFl_ENSPANP00000007886 .............................................................................
hFl_ENSPANP00000018968 .............................................................................
hFl_ENSPANP00000015642 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000019484 .............................................................................
hFl_ENSPANP00000019485 .............................................................................
hFl_ENSPANP00000020575 aegekyleeal..................................................................
hFl_ENSPANP00000017457 .............................................................................
hFl_ENSPANP00000020575 .............................................................................
hFl_ENSPANP00000004562 .............................................................................
hFl_ENSPANP00000004438 lpelqllrgkclrikgedanaaacfkraveld.............................................
hFl_ENSPANP00000008640 nlsktmflplaermvekmvkedkieaeaevelyymilerlgkyqealdvi...........................
hFl_ENSPANP00000020327 .............................................................................
hFl_ENSPANP00000020572 .............................................................................
hFl_ENSPANP00000016643 cegedgwnklfdliqselyvrpddvhvnirlvelyrsnkrlkdavahchea..........................
hFl_ENSPANP00000006588 .............................................................................
hFl_ENSPANP00000003995 .............................................................................
hFl_ENSPANP00000007718 .............................................................................
hFl_ENSPANP00000004384 .............................................................................
hFl_ENSPANP00000011118 .............................................................................
hFl_ENSPANP00000004252 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000006588 mkiaqq.......................................................................
hFl_ENSPANP00000001745 kkaealeaaienlneaknyfakvdckerirdvvyfqarlyhtlgktqernrc.........................
hFl_ENSPANP00000014391 aa...........................................................................
hFl_ENSPANP00000004313 .............................................................................
hFl_ENSPANP00000004562 eklqfllqqnpfppetfgnllllyckyeyfdlaadvlaenahltykfltpylyefldavitcqtapeeafikldgla
hFl_ENSPANP00000001425 .............................................................................
hFl_ENSPANP00000015647 hfslykdwlgaassalsslghvytaigdypnalashkq.......................................
hFl_ENSPANP00000019118 .............................................................................
hFl_ENSPANP00000015209 .............................................................................
hFl_ENSPANP00000006801 .............................................................................
hFl_ENSPANP00000003551 .............................................................................
hFl_ENSPANP00000004252 klqfllqqnpfppetfgnllllyckyeyfdlaadvlaenahltykfltpylyefldavitcqtapeeafikldglag
hFl_ENSPANP00000002479 .............................................................................
hFl_ENSPANP00000004798 .............................................................................
hFl_ENSPANP00000000477 .............................................................................
hFl_ENSPANP00000007362 .............................................................................
hFl_ENSPANP00000002485 .............................................................................
hFl_ENSPANP00000014498 .............................................................................
hFl_ENSPANP00000017253 .............................................................................
hFl_ENSPANP00000016353 .............................................................................
hFl_ENSPANP00000016352 .............................................................................
hFl_ENSPANP00000018429 kvaslrtqdslagslrsvnlvlqnalqphglptqtshylrralasltpgagqalrgllhaslaqlyshhgyhgpait
hFl_ENSPANP00000013579 .............................................................................
hFl_ENSPANP00000000348 .............................................................................
hFl_ENSPANP00000015511 .............................................................................
hFl_ENSPANP00000007718 .............................................................................
hFl_ENSPANP00000011118 .............................................................................
hFl_ENSPANP00000007718 .............................................................................
hFl_ENSPANP00000015642 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000010920 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000003968 .............................................................................
hFl_ENSPANP00000001022 rnyllqtvrlycelqasketdmelvqvflwlaqvlvsghqlthgllcyeta..........................
hFl_ENSPANP00000009443 .............................................................................
hFl_ENSPANP00000011463 sicllrgkiydaldnrtlatysykealkldvycfeafdlltshhmltaqeekelleslplsklgneeqellrflfen
hFl_ENSPANP00000002961 .............................................................................
hFl_ENSPANP00000017623 .............................................................................
hFl_ENSPANP00000011215 .............................................................................
hFl_ENSPANP00000000119 .............................................................................
hFl_ENSPANP00000002418 .............................................................................
hFl_ENSPANP00000014391 dirakkrvlrkalehvpnsvrlwkaav..................................................
hFl_ENSPANP00000020421 .............................................................................
hFl_ENSPANP00000008387 .............................................................................
hFl_ENSPANP00000005487 awmaaesgllvdpd...............................................................
hFl_ENSPANP00000002155 .............................................................................
hFl_ENSPANP00000002567 .............................................................................
hFl_ENSPANP00000019509 .............................................................................
hFl_ENSPANP00000005069 .............................................................................
hFl_ENSPANP00000000052 .............................................................................
hFl_ENSPANP00000005735 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000018982 aslrardslagslrsvnlvlqnvlqphsphylrralasltpgtgqvlrgllhaslaqlyshhgyhgpaitfmtqave
hFl_ENSPANP00000018968 .............................................................................
hFl_ENSPANP00000008513 .............................................................................
hFl_ENSPANP00000019509 .............................................................................
hFl_ENSPANP00000006588 lerldpnp.....................................................................
hFl_ENSPANP00000011118 .............................................................................
hFl_ENSPANP00000003166 .............................................................................
hFl_ENSPANP00000004798 .............................................................................
hFl_ENSPANP00000015019 vm...........................................................................
hFl_ENSPANP00000020573 .............................................................................
hFl_ENSPANP00000004562 .............................................................................
hFl_ENSPANP00000004252 .............................................................................
hFl_ENSPANP00000020003 ydnlle.......................................................................
hFl_ENSPANP00000006922 .............................................................................
hFl_ENSPANP00000001081 .............................................................................
hFl_ENSPANP00000020426 .............................................................................
hFl_ENSPANP00000014026 qeakpykndpeilamtnlvsayqnnditefekilktnhsnimddpfir.............................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000015639 .............................................................................
hFl_ENSPANP00000004438 .............................................................................
hFl_ENSPANP00000015636 .............................................................................
hFl_ENSPANP00000006186 .............................................................................
hFl_ENSPANP00000015209 .............................................................................
hFl_ENSPANP00000000119 .............................................................................
hFl_ENSPANP00000011874 .............................................................................
hFl_ENSPANP00000013299 .............................................................................
hFl_ENSPANP00000003968 .............................................................................
hFl_ENSPANP00000005681 .............................................................................
hFl_ENSPANP00000012992 .............................................................................
hFl_ENSPANP00000004384 .............................................................................
hFl_ENSPANP00000020572 .............................................................................
hFl_ENSPANP00000006404 .............................................................................
hFl_ENSPANP00000000870 .............................................................................
hFl_ENSPANP00000001745 .............................................................................
hFl_ENSPANP00000011077 .............................................................................
hFl_ENSPANP00000003398 kqvlkyykqvikiken.............................................................
hFl_ENSPANP00000008218 .............................................................................
hFl_ENSPANP00000010361 .............................................................................
hFl_ENSPANP00000017310 .............................................................................
hFl_ENSPANP00000004678 .............................................................................
hFl_ENSPANP00000005519 .............................................................................
hFl_ENSPANP00000008921 .............................................................................
hFl_ENSPANP00000016699 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000015209 .............................................................................
hFl_ENSPANP00000012305 .............................................................................
hFl_ENSPANP00000018202 .............................................................................


                                                                                                    
                                                                                                    
d1kt1a1                .............................................................................
hFl_ENSPANP00000004835 .............................................................................
hFl_ENSPANP00000017500 ilckcplqnesqeesynayplpavkvsmdwlrlrprvfqeavvderqyiwpwlisllnsfhpheedlsstsatplpe
hFl_ENSPANP00000011496 .............................................................................
hFl_ENSPANP00000005875 ragskqysaaiaftlalfshlvnhvnirlqaeleegenpvpafqsdgtdepeskeplekeeepdpepppivpqvgeg
hFl_ENSPANP00000015319 .............................................................................
hFl_ENSPANP00000019493 psplgstrmlqlmtinmfavhnsqlkdcfseecrsviqeqaaalglamfsllvrrctyllkesakaqlsspedqedq
hFl_ENSPANP00000015800 .............................................................................
hFl_ENSPANP00000017125 kanphnydawfdylrlvesdaeaeavrevyeraianvppiqekrhwkryiylwinyalyeeleakdpertrqvyqas
hFl_ENSPANP00000011271 .............................................................................
hFl_ENSPANP00000017151 .............................................................................
hFl_ENSPANP00000007093 dgtnfrvkvmaeanhfidlsqipcngkaadrihqdgihilvnmngytkgarnelfalrpapiqamwlgypgtsgalf
hFl_ENSPANP00000007238 .............................................................................
hFl_ENSPANP00000007093 .............................................................................
hFl_ENSPANP00000015526 .............................................................................
hFl_ENSPANP00000010410 qdqvsdvc.....................................................................
hFl_ENSPANP00000004737 .............................................................................
hFl_ENSPANP00000020946 .............................................................................
hFl_ENSPANP00000020864 .............................................................................
hFl_ENSPANP00000007952 .............................................................................
hFl_ENSPANP00000016788 .............................................................................
hFl_ENSPANP00000004737 .............................................................................
hFl_ENSPANP00000004737 .............................................................................
hFl_ENSPANP00000000707 .............................................................................
hFl_ENSPANP00000004108 .............................................................................
hFl_ENSPANP00000016788 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000003166 .............................................................................
hFl_ENSPANP00000003324 .............................................................................
hFl_ENSPANP00000005479 .............................................................................
hFl_ENSPANP00000003528 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000010352 .............................................................................
hFl_ENSPANP00000012491 .............................................................................
hFl_ENSPANP00000014791 .............................................................................
hFl_ENSPANP00000005591 .............................................................................
hFl_ENSPANP00000015348 .............................................................................
hFl_ENSPANP00000014791 .............................................................................
hFl_ENSPANP00000013486 .............................................................................
hFl_ENSPANP00000015752 .............................................................................
hFl_ENSPANP00000014239 .............................................................................
hFl_ENSPANP00000001617 .............................................................................
hFl_ENSPANP00000017253 .............................................................................
hFl_ENSPANP00000020687 .............................................................................
hFl_ENSPANP00000014947 .............................................................................
hFl_ENSPANP00000015753 .............................................................................
hFl_ENSPANP00000003528 .............................................................................
hFl_ENSPANP00000008218 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000013297 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000007362 .............................................................................
hFl_ENSPANP00000014947 .............................................................................
hFl_ENSPANP00000008383 .............................................................................
hFl_ENSPANP00000017676 .............................................................................
hFl_ENSPANP00000001814 .............................................................................
hFl_ENSPANP00000001168 .............................................................................
hFl_ENSPANP00000003176 .............................................................................
hFl_ENSPANP00000010724 .............................................................................
hFl_ENSPANP00000013376 .............................................................................
hFl_ENSPANP00000013375 .............................................................................
hFl_ENSPANP00000000707 .............................................................................
hFl_ENSPANP00000012992 .............................................................................
hFl_ENSPANP00000020687 .............................................................................
hFl_ENSPANP00000000643 .............................................................................
hFl_ENSPANP00000007559 .............................................................................
hFl_ENSPANP00000003197 .............................................................................
hFl_ENSPANP00000003945 .............................................................................
hFl_ENSPANP00000012699 .............................................................................
hFl_ENSPANP00000004293 ldpndq.......................................................................
hFl_ENSPANP00000014070 .............................................................................
hFl_ENSPANP00000008096 .............................................................................
hFl_ENSPANP00000014947 .............................................................................
hFl_ENSPANP00000020577 .............................................................................
hFl_ENSPANP00000020573 eikdqpqnvsenllpqnapnywyhqglihkqngdllqavkcyek.................................
hFl_ENSPANP00000015642 .............................................................................
hFl_ENSPANP00000019972 eeavktlpteamwkcyitfclerftkksnsgflrgkrlertmtsfrkahelkllsecqykqlivsllchkflreale
hFl_ENSPANP00000002155 .............................................................................
hFl_ENSPANP00000003197 .............................................................................
hFl_ENSPANP00000010388 .............................................................................
hFl_ENSPANP00000009536 .............................................................................
hFl_ENSPANP00000013401 .............................................................................
hFl_ENSPANP00000007559 .............................................................................
hFl_ENSPANP00000020038 .............................................................................
hFl_ENSPANP00000020312 .............................................................................
hFl_ENSPANP00000000258 .............................................................................
hFl_ENSPANP00000017676 .............................................................................
hFl_ENSPANP00000006518 .............................................................................
hFl_ENSPANP00000013297 .............................................................................
hFl_ENSPANP00000003504 .............................................................................
hFl_ENSPANP00000017184 .............................................................................
hFl_ENSPANP00000006801 .............................................................................
hFl_ENSPANP00000015190 .............................................................................
hFl_ENSPANP00000001081 .............................................................................
hFl_ENSPANP00000006437 .............................................................................
hFl_ENSPANP00000012699 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000009269 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000019581 .............................................................................
hFl_ENSPANP00000020572 .............................................................................
hFl_ENSPANP00000007217 .............................................................................
hFl_ENSPANP00000020685 dlimtginyldthsnfwrqqkpiyarerdqklmqekwlrdhkhhpsqtahyilksledidmlltsgsaegslqkaek
hFl_ENSPANP00000020899 .............................................................................
hFl_ENSPANP00000008387 .............................................................................
hFl_ENSPANP00000010352 .............................................................................
hFl_ENSPANP00000009338 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000020864 .............................................................................
hFl_ENSPANP00000008387 .............................................................................
hFl_ENSPANP00000009057 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000007915 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000015625 .............................................................................
hFl_ENSPANP00000014767 .............................................................................
hFl_ENSPANP00000002080 .............................................................................
hFl_ENSPANP00000007403 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000005487 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000013410 .............................................................................
hFl_ENSPANP00000003097 .............................................................................
hFl_ENSPANP00000020575 .............................................................................
hFl_ENSPANP00000007248 .............................................................................
hFl_ENSPANP00000019375 dgavedflkvldmvtedqe..........................................................
hFl_ENSPANP00000003854 .............................................................................
hFl_ENSPANP00000006795 .............................................................................
hFl_ENSPANP00000002479 .............................................................................
hFl_ENSPANP00000017125 .............................................................................
hFl_ENSPANP00000005048 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000019375 .............................................................................
hFl_ENSPANP00000014239 .............................................................................
hFl_ENSPANP00000012835 .............................................................................
hFl_ENSPANP00000001460 .............................................................................
hFl_ENSPANP00000015753 .............................................................................
hFl_ENSPANP00000003968 tmaqlkisqgniskaclilrsieelkhkpgmvsalvtmysheedidsaievfalaiqwyqnhqpkspahlslireaa
hFl_ENSPANP00000006868 .............................................................................
hFl_ENSPANP00000001460 .............................................................................
hFl_ENSPANP00000004313 .............................................................................
hFl_ENSPANP00000001617 .............................................................................
hFl_ENSPANP00000019732 .............................................................................
hFl_ENSPANP00000013913 .............................................................................
hFl_ENSPANP00000004649 .............................................................................
hFl_ENSPANP00000013914 .............................................................................
hFl_ENSPANP00000003176 .............................................................................
hFl_ENSPANP00000003166 .............................................................................
hFl_ENSPANP00000015752 .............................................................................
hFl_ENSPANP00000001460 .............................................................................
hFl_ENSPANP00000004498 .............................................................................
hFl_ENSPANP00000014540 .............................................................................
hFl_ENSPANP00000002479 .............................................................................
hFl_ENSPANP00000017858 .............................................................................
hFl_ENSPANP00000007886 .............................................................................
hFl_ENSPANP00000018968 .............................................................................
hFl_ENSPANP00000015642 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000019484 .............................................................................
hFl_ENSPANP00000019485 .............................................................................
hFl_ENSPANP00000020575 .............................................................................
hFl_ENSPANP00000017457 .............................................................................
hFl_ENSPANP00000020575 .............................................................................
hFl_ENSPANP00000004562 .............................................................................
hFl_ENSPANP00000004438 .............................................................................
hFl_ENSPANP00000008640 .............................................................................
hFl_ENSPANP00000020327 .............................................................................
hFl_ENSPANP00000020572 .............................................................................
hFl_ENSPANP00000016643 .............................................................................
hFl_ENSPANP00000006588 .............................................................................
hFl_ENSPANP00000003995 .............................................................................
hFl_ENSPANP00000007718 .............................................................................
hFl_ENSPANP00000004384 .............................................................................
hFl_ENSPANP00000011118 .............................................................................
hFl_ENSPANP00000004252 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000006588 .............................................................................
hFl_ENSPANP00000001745 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000004313 .............................................................................
hFl_ENSPANP00000004562 gmlteqlrrltkqvqearhnrddeaikkavneydetmekyipvlmaqakiywnlenypmvekifrksvefcndh...
hFl_ENSPANP00000001425 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000019118 .............................................................................
hFl_ENSPANP00000015209 .............................................................................
hFl_ENSPANP00000006801 .............................................................................
hFl_ENSPANP00000003551 .............................................................................
hFl_ENSPANP00000004252 mltevlrkltiqvrearhnrddeaikkavneydetmekyipvlmtqakiywnlenypmvekifrksvefcndh....
hFl_ENSPANP00000002479 .............................................................................
hFl_ENSPANP00000004798 .............................................................................
hFl_ENSPANP00000000477 .............................................................................
hFl_ENSPANP00000007362 .............................................................................
hFl_ENSPANP00000002485 .............................................................................
hFl_ENSPANP00000014498 .............................................................................
hFl_ENSPANP00000017253 .............................................................................
hFl_ENSPANP00000016353 .............................................................................
hFl_ENSPANP00000016352 .............................................................................
hFl_ENSPANP00000018429 fmtqaveasavagvraivdrllalawlhvlhgqspvaldilqsvqdavvasedqegvianmvavalkrtgrtrqaae
hFl_ENSPANP00000013579 .............................................................................
hFl_ENSPANP00000000348 .............................................................................
hFl_ENSPANP00000015511 .............................................................................
hFl_ENSPANP00000007718 .............................................................................
hFl_ENSPANP00000011118 .............................................................................
hFl_ENSPANP00000007718 .............................................................................
hFl_ENSPANP00000015642 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000010920 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000003968 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000009443 .............................................................................
hFl_ENSPANP00000011463 klkkynkpsetvipesvnglqenldvvvslaerhyyncdfkmcykltsvnmeftpsyvlclgmhlslnfskpnelfy
hFl_ENSPANP00000002961 .............................................................................
hFl_ENSPANP00000017623 .............................................................................
hFl_ENSPANP00000011215 .............................................................................
hFl_ENSPANP00000000119 .............................................................................
hFl_ENSPANP00000002418 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000020421 .............................................................................
hFl_ENSPANP00000008387 .............................................................................
hFl_ENSPANP00000005487 .............................................................................
hFl_ENSPANP00000002155 .............................................................................
hFl_ENSPANP00000002567 .............................................................................
hFl_ENSPANP00000019509 .............................................................................
hFl_ENSPANP00000005069 .............................................................................
hFl_ENSPANP00000000052 .............................................................................
hFl_ENSPANP00000005735 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000018982 asavarvraivdrlvavawlhvlqgqspvalhilqsvqdavvasedqegvnanmvavalkrtgrtrqaaegyyrtlr
hFl_ENSPANP00000018968 .............................................................................
hFl_ENSPANP00000008513 .............................................................................
hFl_ENSPANP00000019509 .............................................................................
hFl_ENSPANP00000006588 .............................................................................
hFl_ENSPANP00000011118 .............................................................................
hFl_ENSPANP00000003166 .............................................................................
hFl_ENSPANP00000004798 .............................................................................
hFl_ENSPANP00000015019 .............................................................................
hFl_ENSPANP00000020573 .............................................................................
hFl_ENSPANP00000004562 .............................................................................
hFl_ENSPANP00000004252 .............................................................................
hFl_ENSPANP00000020003 .............................................................................
hFl_ENSPANP00000006922 .............................................................................
hFl_ENSPANP00000001081 .............................................................................
hFl_ENSPANP00000020426 .............................................................................
hFl_ENSPANP00000014026 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000015639 .............................................................................
hFl_ENSPANP00000004438 .............................................................................
hFl_ENSPANP00000015636 .............................................................................
hFl_ENSPANP00000006186 .............................................................................
hFl_ENSPANP00000015209 .............................................................................
hFl_ENSPANP00000000119 .............................................................................
hFl_ENSPANP00000011874 .............................................................................
hFl_ENSPANP00000013299 .............................................................................
hFl_ENSPANP00000003968 .............................................................................
hFl_ENSPANP00000005681 .............................................................................
hFl_ENSPANP00000012992 .............................................................................
hFl_ENSPANP00000004384 .............................................................................
hFl_ENSPANP00000020572 .............................................................................
hFl_ENSPANP00000006404 .............................................................................
hFl_ENSPANP00000000870 .............................................................................
hFl_ENSPANP00000001745 .............................................................................
hFl_ENSPANP00000011077 .............................................................................
hFl_ENSPANP00000003398 .............................................................................
hFl_ENSPANP00000008218 .............................................................................
hFl_ENSPANP00000010361 .............................................................................
hFl_ENSPANP00000017310 .............................................................................
hFl_ENSPANP00000004678 .............................................................................
hFl_ENSPANP00000005519 .............................................................................
hFl_ENSPANP00000008921 .............................................................................
hFl_ENSPANP00000016699 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000015209 .............................................................................
hFl_ENSPANP00000012305 .............................................................................
hFl_ENSPANP00000018202 .............................................................................


                                                                                                    
                                                                                                    
d1kt1a1                .............................................................................
hFl_ENSPANP00000004835 .............................................................................
hFl_ENSPANP00000017500 efelqgflalrpsfrnldfskghqgitgdkegqqrrlrqqrliaigkwiadnqprliqcenevgkllfiteipelil
hFl_ENSPANP00000011496 .............................................................................
hFl_ENSPANP00000005875 rksrkfsrlsclrrrrhppkagddsdlsegfesdsshdsarasegsdsgsdkslegggtafdaetdsemnsqesrsd
hFl_ENSPANP00000015319 .............................................................................
hFl_ENSPANP00000019493 ddikvssfvpdlkellpsvkvwsdwmlgypdtwnppptsldlpshvavdvwstladfcniltavnqsevplykdpdd
hFl_ENSPANP00000015800 .............................................................................
hFl_ENSPANP00000017125 leliphkkftfakmwilyaqfeirqknlslarralgtsigkcpknklfkvyielelqlrefdrcrklyekflefgpe
hFl_ENSPANP00000011271 .............................................................................
hFl_ENSPANP00000017151 .............................................................................
hFl_ENSPANP00000007093 mdyiitdqetspaevaeqyseklaymphtffigdhanmfphlkkkavidfksnghiydnrivlngidlkafldslpd
hFl_ENSPANP00000007238 .............................................................................
hFl_ENSPANP00000007093 .............................................................................
hFl_ENSPANP00000015526 .............................................................................
hFl_ENSPANP00000010410 .............................................................................
hFl_ENSPANP00000004737 .............................................................................
hFl_ENSPANP00000020946 .............................................................................
hFl_ENSPANP00000020864 .............................................................................
hFl_ENSPANP00000007952 .............................................................................
hFl_ENSPANP00000016788 .............................................................................
hFl_ENSPANP00000004737 .............................................................................
hFl_ENSPANP00000004737 .............................................................................
hFl_ENSPANP00000000707 .............................................................................
hFl_ENSPANP00000004108 .............................................................................
hFl_ENSPANP00000016788 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000003166 .............................................................................
hFl_ENSPANP00000003324 .............................................................................
hFl_ENSPANP00000005479 .............................................................................
hFl_ENSPANP00000003528 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000010352 .............................................................................
hFl_ENSPANP00000012491 .............................................................................
hFl_ENSPANP00000014791 .............................................................................
hFl_ENSPANP00000005591 .............................................................................
hFl_ENSPANP00000015348 .............................................................................
hFl_ENSPANP00000014791 .............................................................................
hFl_ENSPANP00000013486 .............................................................................
hFl_ENSPANP00000015752 .............................................................................
hFl_ENSPANP00000014239 .............................................................................
hFl_ENSPANP00000001617 .............................................................................
hFl_ENSPANP00000017253 .............................................................................
hFl_ENSPANP00000020687 .............................................................................
hFl_ENSPANP00000014947 .............................................................................
hFl_ENSPANP00000015753 .............................................................................
hFl_ENSPANP00000003528 .............................................................................
hFl_ENSPANP00000008218 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000013297 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000007362 .............................................................................
hFl_ENSPANP00000014947 .............................................................................
hFl_ENSPANP00000008383 .............................................................................
hFl_ENSPANP00000017676 .............................................................................
hFl_ENSPANP00000001814 .............................................................................
hFl_ENSPANP00000001168 .............................................................................
hFl_ENSPANP00000003176 .............................................................................
hFl_ENSPANP00000010724 .............................................................................
hFl_ENSPANP00000013376 .............................................................................
hFl_ENSPANP00000013375 .............................................................................
hFl_ENSPANP00000000707 .............................................................................
hFl_ENSPANP00000012992 .............................................................................
hFl_ENSPANP00000020687 .............................................................................
hFl_ENSPANP00000000643 .............................................................................
hFl_ENSPANP00000007559 .............................................................................
hFl_ENSPANP00000003197 .............................................................................
hFl_ENSPANP00000003945 .............................................................................
hFl_ENSPANP00000012699 .............................................................................
hFl_ENSPANP00000004293 .............................................................................
hFl_ENSPANP00000014070 .............................................................................
hFl_ENSPANP00000008096 .............................................................................
hFl_ENSPANP00000014947 .............................................................................
hFl_ENSPANP00000020577 .............................................................................
hFl_ENSPANP00000020573 .............................................................................
hFl_ENSPANP00000015642 .............................................................................
hFl_ENSPANP00000019972 vavagtelfrdsgtmwqlklrvlieskspdiamlfeeafvhlkpqvclplwiswaewsegaksqedteavfkkalla
hFl_ENSPANP00000002155 .............................................................................
hFl_ENSPANP00000003197 .............................................................................
hFl_ENSPANP00000010388 .............................................................................
hFl_ENSPANP00000009536 .............................................................................
hFl_ENSPANP00000013401 .............................................................................
hFl_ENSPANP00000007559 .............................................................................
hFl_ENSPANP00000020038 .............................................................................
hFl_ENSPANP00000020312 .............................................................................
hFl_ENSPANP00000000258 .............................................................................
hFl_ENSPANP00000017676 .............................................................................
hFl_ENSPANP00000006518 .............................................................................
hFl_ENSPANP00000013297 .............................................................................
hFl_ENSPANP00000003504 .............................................................................
hFl_ENSPANP00000017184 .............................................................................
hFl_ENSPANP00000006801 .............................................................................
hFl_ENSPANP00000015190 .............................................................................
hFl_ENSPANP00000001081 .............................................................................
hFl_ENSPANP00000006437 .............................................................................
hFl_ENSPANP00000012699 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000009269 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000019581 .............................................................................
hFl_ENSPANP00000020572 .............................................................................
hFl_ENSPANP00000007217 .............................................................................
hFl_ENSPANP00000020685 vlkkvlewnkeevpnkdelvgnlyscignaqielgqmaaalqshrkdleiakeyllp....................
hFl_ENSPANP00000020899 .............................................................................
hFl_ENSPANP00000008387 .............................................................................
hFl_ENSPANP00000010352 .............................................................................
hFl_ENSPANP00000009338 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000020864 .............................................................................
hFl_ENSPANP00000008387 .............................................................................
hFl_ENSPANP00000009057 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000007915 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000015625 .............................................................................
hFl_ENSPANP00000014767 .............................................................................
hFl_ENSPANP00000002080 .............................................................................
hFl_ENSPANP00000007403 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000005487 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000013410 .............................................................................
hFl_ENSPANP00000003097 .............................................................................
hFl_ENSPANP00000020575 .............................................................................
hFl_ENSPANP00000007248 .............................................................................
hFl_ENSPANP00000019375 .............................................................................
hFl_ENSPANP00000003854 .............................................................................
hFl_ENSPANP00000006795 .............................................................................
hFl_ENSPANP00000002479 .............................................................................
hFl_ENSPANP00000017125 .............................................................................
hFl_ENSPANP00000005048 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000019375 .............................................................................
hFl_ENSPANP00000014239 .............................................................................
hFl_ENSPANP00000012835 .............................................................................
hFl_ENSPANP00000001460 .............................................................................
hFl_ENSPANP00000015753 .............................................................................
hFl_ENSPANP00000003968 nfklkygrkkeaisdlqqlwkqnpkdi..................................................
hFl_ENSPANP00000006868 .............................................................................
hFl_ENSPANP00000001460 .............................................................................
hFl_ENSPANP00000004313 .............................................................................
hFl_ENSPANP00000001617 .............................................................................
hFl_ENSPANP00000019732 .............................................................................
hFl_ENSPANP00000013913 .............................................................................
hFl_ENSPANP00000004649 .............................................................................
hFl_ENSPANP00000013914 .............................................................................
hFl_ENSPANP00000003176 .............................................................................
hFl_ENSPANP00000003166 .............................................................................
hFl_ENSPANP00000015752 .............................................................................
hFl_ENSPANP00000001460 .............................................................................
hFl_ENSPANP00000004498 .............................................................................
hFl_ENSPANP00000014540 .............................................................................
hFl_ENSPANP00000002479 .............................................................................
hFl_ENSPANP00000017858 .............................................................................
hFl_ENSPANP00000007886 .............................................................................
hFl_ENSPANP00000018968 .............................................................................
hFl_ENSPANP00000015642 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000019484 .............................................................................
hFl_ENSPANP00000019485 .............................................................................
hFl_ENSPANP00000020575 .............................................................................
hFl_ENSPANP00000017457 .............................................................................
hFl_ENSPANP00000020575 .............................................................................
hFl_ENSPANP00000004562 .............................................................................
hFl_ENSPANP00000004438 .............................................................................
hFl_ENSPANP00000008640 .............................................................................
hFl_ENSPANP00000020327 .............................................................................
hFl_ENSPANP00000020572 .............................................................................
hFl_ENSPANP00000016643 .............................................................................
hFl_ENSPANP00000006588 .............................................................................
hFl_ENSPANP00000003995 .............................................................................
hFl_ENSPANP00000007718 .............................................................................
hFl_ENSPANP00000004384 .............................................................................
hFl_ENSPANP00000011118 .............................................................................
hFl_ENSPANP00000004252 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000006588 .............................................................................
hFl_ENSPANP00000001745 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000004313 .............................................................................
hFl_ENSPANP00000004562 .............................................................................
hFl_ENSPANP00000001425 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000019118 .............................................................................
hFl_ENSPANP00000015209 .............................................................................
hFl_ENSPANP00000006801 .............................................................................
hFl_ENSPANP00000003551 .............................................................................
hFl_ENSPANP00000004252 .............................................................................
hFl_ENSPANP00000002479 .............................................................................
hFl_ENSPANP00000004798 .............................................................................
hFl_ENSPANP00000000477 .............................................................................
hFl_ENSPANP00000007362 .............................................................................
hFl_ENSPANP00000002485 .............................................................................
hFl_ENSPANP00000014498 .............................................................................
hFl_ENSPANP00000017253 .............................................................................
hFl_ENSPANP00000016353 .............................................................................
hFl_ENSPANP00000016352 .............................................................................
hFl_ENSPANP00000018429 gyyralrvardlgqqrnqavvlanfgalclhagasrlaqhylleavrl.............................
hFl_ENSPANP00000013579 .............................................................................
hFl_ENSPANP00000000348 .............................................................................
hFl_ENSPANP00000015511 .............................................................................
hFl_ENSPANP00000007718 .............................................................................
hFl_ENSPANP00000011118 .............................................................................
hFl_ENSPANP00000007718 .............................................................................
hFl_ENSPANP00000015642 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000010920 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000003968 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000009443 .............................................................................
hFl_ENSPANP00000011463 lshklvdlypsnpvswfavgcyylmv...................................................
hFl_ENSPANP00000002961 .............................................................................
hFl_ENSPANP00000017623 .............................................................................
hFl_ENSPANP00000011215 .............................................................................
hFl_ENSPANP00000000119 .............................................................................
hFl_ENSPANP00000002418 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000020421 .............................................................................
hFl_ENSPANP00000008387 .............................................................................
hFl_ENSPANP00000005487 .............................................................................
hFl_ENSPANP00000002155 .............................................................................
hFl_ENSPANP00000002567 .............................................................................
hFl_ENSPANP00000019509 .............................................................................
hFl_ENSPANP00000005069 .............................................................................
hFl_ENSPANP00000000052 .............................................................................
hFl_ENSPANP00000005735 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000018982 vawdldqrrnqavvlanfralclhagasrlaqhylleamrlflrlpcrecgrdlthvllqlghlctyqgpaqqgkgy
hFl_ENSPANP00000018968 .............................................................................
hFl_ENSPANP00000008513 .............................................................................
hFl_ENSPANP00000019509 .............................................................................
hFl_ENSPANP00000006588 .............................................................................
hFl_ENSPANP00000011118 .............................................................................
hFl_ENSPANP00000003166 .............................................................................
hFl_ENSPANP00000004798 .............................................................................
hFl_ENSPANP00000015019 .............................................................................
hFl_ENSPANP00000020573 .............................................................................
hFl_ENSPANP00000004562 .............................................................................
hFl_ENSPANP00000004252 .............................................................................
hFl_ENSPANP00000020003 .............................................................................
hFl_ENSPANP00000006922 .............................................................................
hFl_ENSPANP00000001081 .............................................................................
hFl_ENSPANP00000020426 .............................................................................
hFl_ENSPANP00000014026 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000015639 .............................................................................
hFl_ENSPANP00000004438 .............................................................................
hFl_ENSPANP00000015636 .............................................................................
hFl_ENSPANP00000006186 .............................................................................
hFl_ENSPANP00000015209 .............................................................................
hFl_ENSPANP00000000119 .............................................................................
hFl_ENSPANP00000011874 .............................................................................
hFl_ENSPANP00000013299 .............................................................................
hFl_ENSPANP00000003968 .............................................................................
hFl_ENSPANP00000005681 .............................................................................
hFl_ENSPANP00000012992 .............................................................................
hFl_ENSPANP00000004384 .............................................................................
hFl_ENSPANP00000020572 .............................................................................
hFl_ENSPANP00000006404 .............................................................................
hFl_ENSPANP00000000870 .............................................................................
hFl_ENSPANP00000001745 .............................................................................
hFl_ENSPANP00000011077 .............................................................................
hFl_ENSPANP00000003398 .............................................................................
hFl_ENSPANP00000008218 .............................................................................
hFl_ENSPANP00000010361 .............................................................................
hFl_ENSPANP00000017310 .............................................................................
hFl_ENSPANP00000004678 .............................................................................
hFl_ENSPANP00000005519 .............................................................................
hFl_ENSPANP00000008921 .............................................................................
hFl_ENSPANP00000016699 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000015209 .............................................................................
hFl_ENSPANP00000012305 .............................................................................
hFl_ENSPANP00000018202 .............................................................................


                                                                                                    
                                                                                                    
d1kt1a1                .............................................................................
hFl_ENSPANP00000004835 .............................................................................
hFl_ENSPANP00000017500 e............................................................................
hFl_ENSPANP00000011496 .............................................................................
hFl_ENSPANP00000005875 ledmeeeegtrsptleppqgrseapdslngplgpseasiasnlqamstqmfqtkrcfrlaptfsnlllqpttdphts
hFl_ENSPANP00000015319 .............................................................................
hFl_ENSPANP00000019493 dltllileedrllsgfvpllaapqdpcyvektsdkviaadckrvtvlkyflealcgqeepllaf.............
hFl_ENSPANP00000015800 .............................................................................
hFl_ENSPANP00000017125 nctswikfaeletilgdidraraiyelaisqprldm.........................................
hFl_ENSPANP00000011271 .............................................................................
hFl_ENSPANP00000017151 .............................................................................
hFl_ENSPANP00000007093 vkivkmkcpdggdnadssntalnmpvipmntiaeavieminrgqiqitingfsisnglattqinnkaatgeevprti
hFl_ENSPANP00000007238 .............................................................................
hFl_ENSPANP00000007093 .............................................................................
hFl_ENSPANP00000015526 .............................................................................
hFl_ENSPANP00000010410 .............................................................................
hFl_ENSPANP00000004737 .............................................................................
hFl_ENSPANP00000020946 .............................................................................
hFl_ENSPANP00000020864 .............................................................................
hFl_ENSPANP00000007952 .............................................................................
hFl_ENSPANP00000016788 .............................................................................
hFl_ENSPANP00000004737 .............................................................................
hFl_ENSPANP00000004737 .............................................................................
hFl_ENSPANP00000000707 .............................................................................
hFl_ENSPANP00000004108 .............................................................................
hFl_ENSPANP00000016788 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000003166 .............................................................................
hFl_ENSPANP00000003324 .............................................................................
hFl_ENSPANP00000005479 .............................................................................
hFl_ENSPANP00000003528 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000010352 .............................................................................
hFl_ENSPANP00000012491 .............................................................................
hFl_ENSPANP00000014791 .............................................................................
hFl_ENSPANP00000005591 .............................................................................
hFl_ENSPANP00000015348 .............................................................................
hFl_ENSPANP00000014791 .............................................................................
hFl_ENSPANP00000013486 .............................................................................
hFl_ENSPANP00000015752 .............................................................................
hFl_ENSPANP00000014239 .............................................................................
hFl_ENSPANP00000001617 .............................................................................
hFl_ENSPANP00000017253 .............................................................................
hFl_ENSPANP00000020687 .............................................................................
hFl_ENSPANP00000014947 .............................................................................
hFl_ENSPANP00000015753 .............................................................................
hFl_ENSPANP00000003528 .............................................................................
hFl_ENSPANP00000008218 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000013297 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000007362 .............................................................................
hFl_ENSPANP00000014947 .............................................................................
hFl_ENSPANP00000008383 .............................................................................
hFl_ENSPANP00000017676 .............................................................................
hFl_ENSPANP00000001814 .............................................................................
hFl_ENSPANP00000001168 .............................................................................
hFl_ENSPANP00000003176 .............................................................................
hFl_ENSPANP00000010724 .............................................................................
hFl_ENSPANP00000013376 .............................................................................
hFl_ENSPANP00000013375 .............................................................................
hFl_ENSPANP00000000707 .............................................................................
hFl_ENSPANP00000012992 .............................................................................
hFl_ENSPANP00000020687 .............................................................................
hFl_ENSPANP00000000643 .............................................................................
hFl_ENSPANP00000007559 .............................................................................
hFl_ENSPANP00000003197 .............................................................................
hFl_ENSPANP00000003945 .............................................................................
hFl_ENSPANP00000012699 .............................................................................
hFl_ENSPANP00000004293 .............................................................................
hFl_ENSPANP00000014070 .............................................................................
hFl_ENSPANP00000008096 .............................................................................
hFl_ENSPANP00000014947 .............................................................................
hFl_ENSPANP00000020577 .............................................................................
hFl_ENSPANP00000020573 .............................................................................
hFl_ENSPANP00000015642 .............................................................................
hFl_ENSPANP00000019972 vigadsvtlknkyldwayrsggyrkaravfkslqesrpfsvdffrkmiqfekeqescnmanireyyegalrefgstd
hFl_ENSPANP00000002155 .............................................................................
hFl_ENSPANP00000003197 .............................................................................
hFl_ENSPANP00000010388 .............................................................................
hFl_ENSPANP00000009536 .............................................................................
hFl_ENSPANP00000013401 .............................................................................
hFl_ENSPANP00000007559 .............................................................................
hFl_ENSPANP00000020038 .............................................................................
hFl_ENSPANP00000020312 .............................................................................
hFl_ENSPANP00000000258 .............................................................................
hFl_ENSPANP00000017676 .............................................................................
hFl_ENSPANP00000006518 .............................................................................
hFl_ENSPANP00000013297 .............................................................................
hFl_ENSPANP00000003504 .............................................................................
hFl_ENSPANP00000017184 .............................................................................
hFl_ENSPANP00000006801 .............................................................................
hFl_ENSPANP00000015190 .............................................................................
hFl_ENSPANP00000001081 .............................................................................
hFl_ENSPANP00000006437 .............................................................................
hFl_ENSPANP00000012699 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000009269 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000019581 .............................................................................
hFl_ENSPANP00000020572 .............................................................................
hFl_ENSPANP00000007217 .............................................................................
hFl_ENSPANP00000020685 .............................................................................
hFl_ENSPANP00000020899 .............................................................................
hFl_ENSPANP00000008387 .............................................................................
hFl_ENSPANP00000010352 .............................................................................
hFl_ENSPANP00000009338 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000020864 .............................................................................
hFl_ENSPANP00000008387 .............................................................................
hFl_ENSPANP00000009057 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000007915 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000015625 .............................................................................
hFl_ENSPANP00000014767 .............................................................................
hFl_ENSPANP00000002080 .............................................................................
hFl_ENSPANP00000007403 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000005487 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000013410 .............................................................................
hFl_ENSPANP00000003097 .............................................................................
hFl_ENSPANP00000020575 .............................................................................
hFl_ENSPANP00000007248 .............................................................................
hFl_ENSPANP00000019375 .............................................................................
hFl_ENSPANP00000003854 .............................................................................
hFl_ENSPANP00000006795 .............................................................................
hFl_ENSPANP00000002479 .............................................................................
hFl_ENSPANP00000017125 .............................................................................
hFl_ENSPANP00000005048 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000019375 .............................................................................
hFl_ENSPANP00000014239 .............................................................................
hFl_ENSPANP00000012835 .............................................................................
hFl_ENSPANP00000001460 .............................................................................
hFl_ENSPANP00000015753 .............................................................................
hFl_ENSPANP00000003968 .............................................................................
hFl_ENSPANP00000006868 .............................................................................
hFl_ENSPANP00000001460 .............................................................................
hFl_ENSPANP00000004313 .............................................................................
hFl_ENSPANP00000001617 .............................................................................
hFl_ENSPANP00000019732 .............................................................................
hFl_ENSPANP00000013913 .............................................................................
hFl_ENSPANP00000004649 .............................................................................
hFl_ENSPANP00000013914 .............................................................................
hFl_ENSPANP00000003176 .............................................................................
hFl_ENSPANP00000003166 .............................................................................
hFl_ENSPANP00000015752 .............................................................................
hFl_ENSPANP00000001460 .............................................................................
hFl_ENSPANP00000004498 .............................................................................
hFl_ENSPANP00000014540 .............................................................................
hFl_ENSPANP00000002479 .............................................................................
hFl_ENSPANP00000017858 .............................................................................
hFl_ENSPANP00000007886 .............................................................................
hFl_ENSPANP00000018968 .............................................................................
hFl_ENSPANP00000015642 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000019484 .............................................................................
hFl_ENSPANP00000019485 .............................................................................
hFl_ENSPANP00000020575 .............................................................................
hFl_ENSPANP00000017457 .............................................................................
hFl_ENSPANP00000020575 .............................................................................
hFl_ENSPANP00000004562 .............................................................................
hFl_ENSPANP00000004438 .............................................................................
hFl_ENSPANP00000008640 .............................................................................
hFl_ENSPANP00000020327 .............................................................................
hFl_ENSPANP00000020572 .............................................................................
hFl_ENSPANP00000016643 .............................................................................
hFl_ENSPANP00000006588 .............................................................................
hFl_ENSPANP00000003995 .............................................................................
hFl_ENSPANP00000007718 .............................................................................
hFl_ENSPANP00000004384 .............................................................................
hFl_ENSPANP00000011118 .............................................................................
hFl_ENSPANP00000004252 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000006588 .............................................................................
hFl_ENSPANP00000001745 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000004313 .............................................................................
hFl_ENSPANP00000004562 .............................................................................
hFl_ENSPANP00000001425 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000019118 .............................................................................
hFl_ENSPANP00000015209 .............................................................................
hFl_ENSPANP00000006801 .............................................................................
hFl_ENSPANP00000003551 .............................................................................
hFl_ENSPANP00000004252 .............................................................................
hFl_ENSPANP00000002479 .............................................................................
hFl_ENSPANP00000004798 .............................................................................
hFl_ENSPANP00000000477 .............................................................................
hFl_ENSPANP00000007362 .............................................................................
hFl_ENSPANP00000002485 .............................................................................
hFl_ENSPANP00000014498 .............................................................................
hFl_ENSPANP00000017253 .............................................................................
hFl_ENSPANP00000016353 .............................................................................
hFl_ENSPANP00000016352 .............................................................................
hFl_ENSPANP00000018429 .............................................................................
hFl_ENSPANP00000013579 .............................................................................
hFl_ENSPANP00000000348 .............................................................................
hFl_ENSPANP00000015511 .............................................................................
hFl_ENSPANP00000007718 .............................................................................
hFl_ENSPANP00000011118 .............................................................................
hFl_ENSPANP00000007718 .............................................................................
hFl_ENSPANP00000015642 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000010920 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000003968 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000009443 .............................................................................
hFl_ENSPANP00000011463 .............................................................................
hFl_ENSPANP00000002961 .............................................................................
hFl_ENSPANP00000017623 .............................................................................
hFl_ENSPANP00000011215 .............................................................................
hFl_ENSPANP00000000119 .............................................................................
hFl_ENSPANP00000002418 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000020421 .............................................................................
hFl_ENSPANP00000008387 .............................................................................
hFl_ENSPANP00000005487 .............................................................................
hFl_ENSPANP00000002155 .............................................................................
hFl_ENSPANP00000002567 .............................................................................
hFl_ENSPANP00000019509 .............................................................................
hFl_ENSPANP00000005069 .............................................................................
hFl_ENSPANP00000000052 .............................................................................
hFl_ENSPANP00000005735 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000018982 yewahlvavemghvengcpgsscapsgatrvrahlefaiqtqvvflplkgqalcarmgalvltsvsdsraykssldy
hFl_ENSPANP00000018968 .............................................................................
hFl_ENSPANP00000008513 .............................................................................
hFl_ENSPANP00000019509 .............................................................................
hFl_ENSPANP00000006588 .............................................................................
hFl_ENSPANP00000011118 .............................................................................
hFl_ENSPANP00000003166 .............................................................................
hFl_ENSPANP00000004798 .............................................................................
hFl_ENSPANP00000015019 .............................................................................
hFl_ENSPANP00000020573 .............................................................................
hFl_ENSPANP00000004562 .............................................................................
hFl_ENSPANP00000004252 .............................................................................
hFl_ENSPANP00000020003 .............................................................................
hFl_ENSPANP00000006922 .............................................................................
hFl_ENSPANP00000001081 .............................................................................
hFl_ENSPANP00000020426 .............................................................................
hFl_ENSPANP00000014026 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000015639 .............................................................................
hFl_ENSPANP00000004438 .............................................................................
hFl_ENSPANP00000015636 .............................................................................
hFl_ENSPANP00000006186 .............................................................................
hFl_ENSPANP00000015209 .............................................................................
hFl_ENSPANP00000000119 .............................................................................
hFl_ENSPANP00000011874 .............................................................................
hFl_ENSPANP00000013299 .............................................................................
hFl_ENSPANP00000003968 .............................................................................
hFl_ENSPANP00000005681 .............................................................................
hFl_ENSPANP00000012992 .............................................................................
hFl_ENSPANP00000004384 .............................................................................
hFl_ENSPANP00000020572 .............................................................................
hFl_ENSPANP00000006404 .............................................................................
hFl_ENSPANP00000000870 .............................................................................
hFl_ENSPANP00000001745 .............................................................................
hFl_ENSPANP00000011077 .............................................................................
hFl_ENSPANP00000003398 .............................................................................
hFl_ENSPANP00000008218 .............................................................................
hFl_ENSPANP00000010361 .............................................................................
hFl_ENSPANP00000017310 .............................................................................
hFl_ENSPANP00000004678 .............................................................................
hFl_ENSPANP00000005519 .............................................................................
hFl_ENSPANP00000008921 .............................................................................
hFl_ENSPANP00000016699 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000015209 .............................................................................
hFl_ENSPANP00000012305 .............................................................................
hFl_ENSPANP00000018202 .............................................................................


                                                                                                    
                                                                                                    
d1kt1a1                .............................................................................
hFl_ENSPANP00000004835 .............................................................................
hFl_ENSPANP00000017500 .............................................................................
hFl_ENSPANP00000011496 .............................................................................
hFl_ENSPANP00000005875 ashrpcvngdvdkpsepgsslgsesegsessgrscrnersiqeklqvlmaegllpavkvfldwlrtnpdliivcaqs
hFl_ENSPANP00000015319 .............................................................................
hFl_ENSPANP00000019493 .............................................................................
hFl_ENSPANP00000015800 .............................................................................
hFl_ENSPANP00000017125 .............................................................................
hFl_ENSPANP00000011271 .............................................................................
hFl_ENSPANP00000017151 .............................................................................
hFl_ENSPANP00000007093 ivttrsqyglpedaivycnfnqlykidpstlqmwanilkrvpnsvlwllrfpavgepniqqyaqnmglpqnriifsp
hFl_ENSPANP00000007238 .............................................................................
hFl_ENSPANP00000007093 .............................................................................
hFl_ENSPANP00000015526 .............................................................................
hFl_ENSPANP00000010410 .............................................................................
hFl_ENSPANP00000004737 .............................................................................
hFl_ENSPANP00000020946 .............................................................................
hFl_ENSPANP00000020864 .............................................................................
hFl_ENSPANP00000007952 .............................................................................
hFl_ENSPANP00000016788 .............................................................................
hFl_ENSPANP00000004737 .............................................................................
hFl_ENSPANP00000004737 .............................................................................
hFl_ENSPANP00000000707 .............................................................................
hFl_ENSPANP00000004108 .............................................................................
hFl_ENSPANP00000016788 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000003166 .............................................................................
hFl_ENSPANP00000003324 .............................................................................
hFl_ENSPANP00000005479 .............................................................................
hFl_ENSPANP00000003528 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000010352 .............................................................................
hFl_ENSPANP00000012491 .............................................................................
hFl_ENSPANP00000014791 .............................................................................
hFl_ENSPANP00000005591 .............................................................................
hFl_ENSPANP00000015348 .............................................................................
hFl_ENSPANP00000014791 .............................................................................
hFl_ENSPANP00000013486 .............................................................................
hFl_ENSPANP00000015752 .............................................................................
hFl_ENSPANP00000014239 .............................................................................
hFl_ENSPANP00000001617 .............................................................................
hFl_ENSPANP00000017253 .............................................................................
hFl_ENSPANP00000020687 .............................................................................
hFl_ENSPANP00000014947 .............................................................................
hFl_ENSPANP00000015753 .............................................................................
hFl_ENSPANP00000003528 .............................................................................
hFl_ENSPANP00000008218 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000013297 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000007362 .............................................................................
hFl_ENSPANP00000014947 .............................................................................
hFl_ENSPANP00000008383 .............................................................................
hFl_ENSPANP00000017676 .............................................................................
hFl_ENSPANP00000001814 .............................................................................
hFl_ENSPANP00000001168 .............................................................................
hFl_ENSPANP00000003176 .............................................................................
hFl_ENSPANP00000010724 .............................................................................
hFl_ENSPANP00000013376 .............................................................................
hFl_ENSPANP00000013375 .............................................................................
hFl_ENSPANP00000000707 .............................................................................
hFl_ENSPANP00000012992 .............................................................................
hFl_ENSPANP00000020687 .............................................................................
hFl_ENSPANP00000000643 .............................................................................
hFl_ENSPANP00000007559 .............................................................................
hFl_ENSPANP00000003197 .............................................................................
hFl_ENSPANP00000003945 .............................................................................
hFl_ENSPANP00000012699 .............................................................................
hFl_ENSPANP00000004293 .............................................................................
hFl_ENSPANP00000014070 .............................................................................
hFl_ENSPANP00000008096 .............................................................................
hFl_ENSPANP00000014947 .............................................................................
hFl_ENSPANP00000020577 .............................................................................
hFl_ENSPANP00000020573 .............................................................................
hFl_ENSPANP00000015642 .............................................................................
hFl_ENSPANP00000019972 sdlwmdymkeelnhplgrpencgqiywramkmlqge.........................................
hFl_ENSPANP00000002155 .............................................................................
hFl_ENSPANP00000003197 .............................................................................
hFl_ENSPANP00000010388 .............................................................................
hFl_ENSPANP00000009536 .............................................................................
hFl_ENSPANP00000013401 .............................................................................
hFl_ENSPANP00000007559 .............................................................................
hFl_ENSPANP00000020038 .............................................................................
hFl_ENSPANP00000020312 .............................................................................
hFl_ENSPANP00000000258 .............................................................................
hFl_ENSPANP00000017676 .............................................................................
hFl_ENSPANP00000006518 .............................................................................
hFl_ENSPANP00000013297 .............................................................................
hFl_ENSPANP00000003504 .............................................................................
hFl_ENSPANP00000017184 .............................................................................
hFl_ENSPANP00000006801 .............................................................................
hFl_ENSPANP00000015190 .............................................................................
hFl_ENSPANP00000001081 .............................................................................
hFl_ENSPANP00000006437 .............................................................................
hFl_ENSPANP00000012699 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000009269 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000019581 .............................................................................
hFl_ENSPANP00000020572 .............................................................................
hFl_ENSPANP00000007217 .............................................................................
hFl_ENSPANP00000020685 .............................................................................
hFl_ENSPANP00000020899 .............................................................................
hFl_ENSPANP00000008387 .............................................................................
hFl_ENSPANP00000010352 .............................................................................
hFl_ENSPANP00000009338 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000020864 .............................................................................
hFl_ENSPANP00000008387 .............................................................................
hFl_ENSPANP00000009057 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000007915 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000015625 .............................................................................
hFl_ENSPANP00000014767 .............................................................................
hFl_ENSPANP00000002080 .............................................................................
hFl_ENSPANP00000007403 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000005487 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000013410 .............................................................................
hFl_ENSPANP00000003097 .............................................................................
hFl_ENSPANP00000020575 .............................................................................
hFl_ENSPANP00000007248 .............................................................................
hFl_ENSPANP00000019375 .............................................................................
hFl_ENSPANP00000003854 .............................................................................
hFl_ENSPANP00000006795 .............................................................................
hFl_ENSPANP00000002479 .............................................................................
hFl_ENSPANP00000017125 .............................................................................
hFl_ENSPANP00000005048 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000019375 .............................................................................
hFl_ENSPANP00000014239 .............................................................................
hFl_ENSPANP00000012835 .............................................................................
hFl_ENSPANP00000001460 .............................................................................
hFl_ENSPANP00000015753 .............................................................................
hFl_ENSPANP00000003968 .............................................................................
hFl_ENSPANP00000006868 .............................................................................
hFl_ENSPANP00000001460 .............................................................................
hFl_ENSPANP00000004313 .............................................................................
hFl_ENSPANP00000001617 .............................................................................
hFl_ENSPANP00000019732 .............................................................................
hFl_ENSPANP00000013913 .............................................................................
hFl_ENSPANP00000004649 .............................................................................
hFl_ENSPANP00000013914 .............................................................................
hFl_ENSPANP00000003176 .............................................................................
hFl_ENSPANP00000003166 .............................................................................
hFl_ENSPANP00000015752 .............................................................................
hFl_ENSPANP00000001460 .............................................................................
hFl_ENSPANP00000004498 .............................................................................
hFl_ENSPANP00000014540 .............................................................................
hFl_ENSPANP00000002479 .............................................................................
hFl_ENSPANP00000017858 .............................................................................
hFl_ENSPANP00000007886 .............................................................................
hFl_ENSPANP00000018968 .............................................................................
hFl_ENSPANP00000015642 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000019484 .............................................................................
hFl_ENSPANP00000019485 .............................................................................
hFl_ENSPANP00000020575 .............................................................................
hFl_ENSPANP00000017457 .............................................................................
hFl_ENSPANP00000020575 .............................................................................
hFl_ENSPANP00000004562 .............................................................................
hFl_ENSPANP00000004438 .............................................................................
hFl_ENSPANP00000008640 .............................................................................
hFl_ENSPANP00000020327 .............................................................................
hFl_ENSPANP00000020572 .............................................................................
hFl_ENSPANP00000016643 .............................................................................
hFl_ENSPANP00000006588 .............................................................................
hFl_ENSPANP00000003995 .............................................................................
hFl_ENSPANP00000007718 .............................................................................
hFl_ENSPANP00000004384 .............................................................................
hFl_ENSPANP00000011118 .............................................................................
hFl_ENSPANP00000004252 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000006588 .............................................................................
hFl_ENSPANP00000001745 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000004313 .............................................................................
hFl_ENSPANP00000004562 .............................................................................
hFl_ENSPANP00000001425 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000019118 .............................................................................
hFl_ENSPANP00000015209 .............................................................................
hFl_ENSPANP00000006801 .............................................................................
hFl_ENSPANP00000003551 .............................................................................
hFl_ENSPANP00000004252 .............................................................................
hFl_ENSPANP00000002479 .............................................................................
hFl_ENSPANP00000004798 .............................................................................
hFl_ENSPANP00000000477 .............................................................................
hFl_ENSPANP00000007362 .............................................................................
hFl_ENSPANP00000002485 .............................................................................
hFl_ENSPANP00000014498 .............................................................................
hFl_ENSPANP00000017253 .............................................................................
hFl_ENSPANP00000016353 .............................................................................
hFl_ENSPANP00000016352 .............................................................................
hFl_ENSPANP00000018429 .............................................................................
hFl_ENSPANP00000013579 .............................................................................
hFl_ENSPANP00000000348 .............................................................................
hFl_ENSPANP00000015511 .............................................................................
hFl_ENSPANP00000007718 .............................................................................
hFl_ENSPANP00000011118 .............................................................................
hFl_ENSPANP00000007718 .............................................................................
hFl_ENSPANP00000015642 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000010920 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000003968 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000009443 .............................................................................
hFl_ENSPANP00000011463 .............................................................................
hFl_ENSPANP00000002961 .............................................................................
hFl_ENSPANP00000017623 .............................................................................
hFl_ENSPANP00000011215 .............................................................................
hFl_ENSPANP00000000119 .............................................................................
hFl_ENSPANP00000002418 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000020421 .............................................................................
hFl_ENSPANP00000008387 .............................................................................
hFl_ENSPANP00000005487 .............................................................................
hFl_ENSPANP00000002155 .............................................................................
hFl_ENSPANP00000002567 .............................................................................
hFl_ENSPANP00000019509 .............................................................................
hFl_ENSPANP00000005069 .............................................................................
hFl_ENSPANP00000000052 .............................................................................
hFl_ENSPANP00000005735 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000018982 tkrslgifidlqkkeaahawlqagkiyyilyiqlfihraqnvalytgdpnlglelfeaagdtffngtwerekavsfy
hFl_ENSPANP00000018968 .............................................................................
hFl_ENSPANP00000008513 .............................................................................
hFl_ENSPANP00000019509 .............................................................................
hFl_ENSPANP00000006588 .............................................................................
hFl_ENSPANP00000011118 .............................................................................
hFl_ENSPANP00000003166 .............................................................................
hFl_ENSPANP00000004798 .............................................................................
hFl_ENSPANP00000015019 .............................................................................
hFl_ENSPANP00000020573 .............................................................................
hFl_ENSPANP00000004562 .............................................................................
hFl_ENSPANP00000004252 .............................................................................
hFl_ENSPANP00000020003 .............................................................................
hFl_ENSPANP00000006922 .............................................................................
hFl_ENSPANP00000001081 .............................................................................
hFl_ENSPANP00000020426 .............................................................................
hFl_ENSPANP00000014026 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000015639 .............................................................................
hFl_ENSPANP00000004438 .............................................................................
hFl_ENSPANP00000015636 .............................................................................
hFl_ENSPANP00000006186 .............................................................................
hFl_ENSPANP00000015209 .............................................................................
hFl_ENSPANP00000000119 .............................................................................
hFl_ENSPANP00000011874 .............................................................................
hFl_ENSPANP00000013299 .............................................................................
hFl_ENSPANP00000003968 .............................................................................
hFl_ENSPANP00000005681 .............................................................................
hFl_ENSPANP00000012992 .............................................................................
hFl_ENSPANP00000004384 .............................................................................
hFl_ENSPANP00000020572 .............................................................................
hFl_ENSPANP00000006404 .............................................................................
hFl_ENSPANP00000000870 .............................................................................
hFl_ENSPANP00000001745 .............................................................................
hFl_ENSPANP00000011077 .............................................................................
hFl_ENSPANP00000003398 .............................................................................
hFl_ENSPANP00000008218 .............................................................................
hFl_ENSPANP00000010361 .............................................................................
hFl_ENSPANP00000017310 .............................................................................
hFl_ENSPANP00000004678 .............................................................................
hFl_ENSPANP00000005519 .............................................................................
hFl_ENSPANP00000008921 .............................................................................
hFl_ENSPANP00000016699 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000015209 .............................................................................
hFl_ENSPANP00000012305 .............................................................................
hFl_ENSPANP00000018202 .............................................................................


                                                                                                    
                                                                                                    
d1kt1a1                .............................................................................
hFl_ENSPANP00000004835 .............................................................................
hFl_ENSPANP00000017500 .............................................................................
hFl_ENSPANP00000011496 .............................................................................
hFl_ENSPANP00000005875 sqslwnrlsvllnllpaagelqesglalcpevqdllegcelpdlpsslllpedmalrnlpplraahrrfnfdtdrpl
hFl_ENSPANP00000015319 .............................................................................
hFl_ENSPANP00000019493 .............................................................................
hFl_ENSPANP00000015800 .............................................................................
hFl_ENSPANP00000017125 .............................................................................
hFl_ENSPANP00000011271 .............................................................................
hFl_ENSPANP00000017151 .............................................................................
hFl_ENSPANP00000007093 vapkeehvrrgq.................................................................
hFl_ENSPANP00000007238 .............................................................................
hFl_ENSPANP00000007093 .............................................................................
hFl_ENSPANP00000015526 .............................................................................
hFl_ENSPANP00000010410 .............................................................................
hFl_ENSPANP00000004737 .............................................................................
hFl_ENSPANP00000020946 .............................................................................
hFl_ENSPANP00000020864 .............................................................................
hFl_ENSPANP00000007952 .............................................................................
hFl_ENSPANP00000016788 .............................................................................
hFl_ENSPANP00000004737 .............................................................................
hFl_ENSPANP00000004737 .............................................................................
hFl_ENSPANP00000000707 .............................................................................
hFl_ENSPANP00000004108 .............................................................................
hFl_ENSPANP00000016788 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000003166 .............................................................................
hFl_ENSPANP00000003324 .............................................................................
hFl_ENSPANP00000005479 .............................................................................
hFl_ENSPANP00000003528 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000010352 .............................................................................
hFl_ENSPANP00000012491 .............................................................................
hFl_ENSPANP00000014791 .............................................................................
hFl_ENSPANP00000005591 .............................................................................
hFl_ENSPANP00000015348 .............................................................................
hFl_ENSPANP00000014791 .............................................................................
hFl_ENSPANP00000013486 .............................................................................
hFl_ENSPANP00000015752 .............................................................................
hFl_ENSPANP00000014239 .............................................................................
hFl_ENSPANP00000001617 .............................................................................
hFl_ENSPANP00000017253 .............................................................................
hFl_ENSPANP00000020687 .............................................................................
hFl_ENSPANP00000014947 .............................................................................
hFl_ENSPANP00000015753 .............................................................................
hFl_ENSPANP00000003528 .............................................................................
hFl_ENSPANP00000008218 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000013297 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000007362 .............................................................................
hFl_ENSPANP00000014947 .............................................................................
hFl_ENSPANP00000008383 .............................................................................
hFl_ENSPANP00000017676 .............................................................................
hFl_ENSPANP00000001814 .............................................................................
hFl_ENSPANP00000001168 .............................................................................
hFl_ENSPANP00000003176 .............................................................................
hFl_ENSPANP00000010724 .............................................................................
hFl_ENSPANP00000013376 .............................................................................
hFl_ENSPANP00000013375 .............................................................................
hFl_ENSPANP00000000707 .............................................................................
hFl_ENSPANP00000012992 .............................................................................
hFl_ENSPANP00000020687 .............................................................................
hFl_ENSPANP00000000643 .............................................................................
hFl_ENSPANP00000007559 .............................................................................
hFl_ENSPANP00000003197 .............................................................................
hFl_ENSPANP00000003945 .............................................................................
hFl_ENSPANP00000012699 .............................................................................
hFl_ENSPANP00000004293 .............................................................................
hFl_ENSPANP00000014070 .............................................................................
hFl_ENSPANP00000008096 .............................................................................
hFl_ENSPANP00000014947 .............................................................................
hFl_ENSPANP00000020577 .............................................................................
hFl_ENSPANP00000020573 .............................................................................
hFl_ENSPANP00000015642 .............................................................................
hFl_ENSPANP00000019972 .............................................................................
hFl_ENSPANP00000002155 .............................................................................
hFl_ENSPANP00000003197 .............................................................................
hFl_ENSPANP00000010388 .............................................................................
hFl_ENSPANP00000009536 .............................................................................
hFl_ENSPANP00000013401 .............................................................................
hFl_ENSPANP00000007559 .............................................................................
hFl_ENSPANP00000020038 .............................................................................
hFl_ENSPANP00000020312 .............................................................................
hFl_ENSPANP00000000258 .............................................................................
hFl_ENSPANP00000017676 .............................................................................
hFl_ENSPANP00000006518 .............................................................................
hFl_ENSPANP00000013297 .............................................................................
hFl_ENSPANP00000003504 .............................................................................
hFl_ENSPANP00000017184 .............................................................................
hFl_ENSPANP00000006801 .............................................................................
hFl_ENSPANP00000015190 .............................................................................
hFl_ENSPANP00000001081 .............................................................................
hFl_ENSPANP00000006437 .............................................................................
hFl_ENSPANP00000012699 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000009269 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000019581 .............................................................................
hFl_ENSPANP00000020572 .............................................................................
hFl_ENSPANP00000007217 .............................................................................
hFl_ENSPANP00000020685 .............................................................................
hFl_ENSPANP00000020899 .............................................................................
hFl_ENSPANP00000008387 .............................................................................
hFl_ENSPANP00000010352 .............................................................................
hFl_ENSPANP00000009338 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000020864 .............................................................................
hFl_ENSPANP00000008387 .............................................................................
hFl_ENSPANP00000009057 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000007915 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000015625 .............................................................................
hFl_ENSPANP00000014767 .............................................................................
hFl_ENSPANP00000002080 .............................................................................
hFl_ENSPANP00000007403 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000005487 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000013410 .............................................................................
hFl_ENSPANP00000003097 .............................................................................
hFl_ENSPANP00000020575 .............................................................................
hFl_ENSPANP00000007248 .............................................................................
hFl_ENSPANP00000019375 .............................................................................
hFl_ENSPANP00000003854 .............................................................................
hFl_ENSPANP00000006795 .............................................................................
hFl_ENSPANP00000002479 .............................................................................
hFl_ENSPANP00000017125 .............................................................................
hFl_ENSPANP00000005048 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000019375 .............................................................................
hFl_ENSPANP00000014239 .............................................................................
hFl_ENSPANP00000012835 .............................................................................
hFl_ENSPANP00000001460 .............................................................................
hFl_ENSPANP00000015753 .............................................................................
hFl_ENSPANP00000003968 .............................................................................
hFl_ENSPANP00000006868 .............................................................................
hFl_ENSPANP00000001460 .............................................................................
hFl_ENSPANP00000004313 .............................................................................
hFl_ENSPANP00000001617 .............................................................................
hFl_ENSPANP00000019732 .............................................................................
hFl_ENSPANP00000013913 .............................................................................
hFl_ENSPANP00000004649 .............................................................................
hFl_ENSPANP00000013914 .............................................................................
hFl_ENSPANP00000003176 .............................................................................
hFl_ENSPANP00000003166 .............................................................................
hFl_ENSPANP00000015752 .............................................................................
hFl_ENSPANP00000001460 .............................................................................
hFl_ENSPANP00000004498 .............................................................................
hFl_ENSPANP00000014540 .............................................................................
hFl_ENSPANP00000002479 .............................................................................
hFl_ENSPANP00000017858 .............................................................................
hFl_ENSPANP00000007886 .............................................................................
hFl_ENSPANP00000018968 .............................................................................
hFl_ENSPANP00000015642 .............................................................................
hFl_ENSPANP00000003731 .............................................................................
hFl_ENSPANP00000019484 .............................................................................
hFl_ENSPANP00000019485 .............................................................................
hFl_ENSPANP00000020575 .............................................................................
hFl_ENSPANP00000017457 .............................................................................
hFl_ENSPANP00000020575 .............................................................................
hFl_ENSPANP00000004562 .............................................................................
hFl_ENSPANP00000004438 .............................................................................
hFl_ENSPANP00000008640 .............................................................................
hFl_ENSPANP00000020327 .............................................................................
hFl_ENSPANP00000020572 .............................................................................
hFl_ENSPANP00000016643 .............................................................................
hFl_ENSPANP00000006588 .............................................................................
hFl_ENSPANP00000003995 .............................................................................
hFl_ENSPANP00000007718 .............................................................................
hFl_ENSPANP00000004384 .............................................................................
hFl_ENSPANP00000011118 .............................................................................
hFl_ENSPANP00000004252 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000006588 .............................................................................
hFl_ENSPANP00000001745 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000004313 .............................................................................
hFl_ENSPANP00000004562 .............................................................................
hFl_ENSPANP00000001425 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000019118 .............................................................................
hFl_ENSPANP00000015209 .............................................................................
hFl_ENSPANP00000006801 .............................................................................
hFl_ENSPANP00000003551 .............................................................................
hFl_ENSPANP00000004252 .............................................................................
hFl_ENSPANP00000002479 .............................................................................
hFl_ENSPANP00000004798 .............................................................................
hFl_ENSPANP00000000477 .............................................................................
hFl_ENSPANP00000007362 .............................................................................
hFl_ENSPANP00000002485 .............................................................................
hFl_ENSPANP00000014498 .............................................................................
hFl_ENSPANP00000017253 .............................................................................
hFl_ENSPANP00000016353 .............................................................................
hFl_ENSPANP00000016352 .............................................................................
hFl_ENSPANP00000018429 .............................................................................
hFl_ENSPANP00000013579 .............................................................................
hFl_ENSPANP00000000348 .............................................................................
hFl_ENSPANP00000015511 .............................................................................
hFl_ENSPANP00000007718 .............................................................................
hFl_ENSPANP00000011118 .............................................................................
hFl_ENSPANP00000007718 .............................................................................
hFl_ENSPANP00000015642 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000010920 .............................................................................
hFl_ENSPANP00000007476 .............................................................................
hFl_ENSPANP00000003968 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000009443 .............................................................................
hFl_ENSPANP00000011463 .............................................................................
hFl_ENSPANP00000002961 .............................................................................
hFl_ENSPANP00000017623 .............................................................................
hFl_ENSPANP00000011215 .............................................................................
hFl_ENSPANP00000000119 .............................................................................
hFl_ENSPANP00000002418 .............................................................................
hFl_ENSPANP00000014391 .............................................................................
hFl_ENSPANP00000020421 .............................................................................
hFl_ENSPANP00000008387 .............................................................................
hFl_ENSPANP00000005487 .............................................................................
hFl_ENSPANP00000002155 .............................................................................
hFl_ENSPANP00000002567 .............................................................................
hFl_ENSPANP00000019509 .............................................................................
hFl_ENSPANP00000005069 .............................................................................
hFl_ENSPANP00000000052 .............................................................................
hFl_ENSPANP00000005735 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000018160 .............................................................................
hFl_ENSPANP00000018982 wdralllavttgnrkaelrlcklvallatleepqeglefahmalalnitlgdrlnecvayhrlaalhqqlgdgklae
hFl_ENSPANP00000018968 .............................................................................
hFl_ENSPANP00000008513 .............................................................................
hFl_ENSPANP00000019509 .............................................................................
hFl_ENSPANP00000006588 .............................................................................
hFl_ENSPANP00000011118 .............................................................................
hFl_ENSPANP00000003166 .............................................................................
hFl_ENSPANP00000004798 .............................................................................
hFl_ENSPANP00000015019 .............................................................................
hFl_ENSPANP00000020573 .............................................................................
hFl_ENSPANP00000004562 .............................................................................
hFl_ENSPANP00000004252 .............................................................................
hFl_ENSPANP00000020003 .............................................................................
hFl_ENSPANP00000006922 .............................................................................
hFl_ENSPANP00000001081 .............................................................................
hFl_ENSPANP00000020426 .............................................................................
hFl_ENSPANP00000014026 .............................................................................
hFl_ENSPANP00000015646 .............................................................................
hFl_ENSPANP00000015647 .............................................................................
hFl_ENSPANP00000015639 .............................................................................
hFl_ENSPANP00000004438 .............................................................................
hFl_ENSPANP00000015636 .............................................................................
hFl_ENSPANP00000006186 .............................................................................
hFl_ENSPANP00000015209 .............................................................................
hFl_ENSPANP00000000119 .............................................................................
hFl_ENSPANP00000011874 .............................................................................
hFl_ENSPANP00000013299 .............................................................................
hFl_ENSPANP00000003968 .............................................................................
hFl_ENSPANP00000005681 .............................................................................
hFl_ENSPANP00000012992 .............................................................................
hFl_ENSPANP00000004384 .............................................................................
hFl_ENSPANP00000020572 .............................................................................
hFl_ENSPANP00000006404 .............................................................................
hFl_ENSPANP00000000870 .............................................................................
hFl_ENSPANP00000001745 .............................................................................
hFl_ENSPANP00000011077 .............................................................................
hFl_ENSPANP00000003398 .............................................................................
hFl_ENSPANP00000008218 .............................................................................
hFl_ENSPANP00000010361 .............................................................................
hFl_ENSPANP00000017310 .............................................................................
hFl_ENSPANP00000004678 .............................................................................
hFl_ENSPANP00000005519 .............................................................................
hFl_ENSPANP00000008921 .............................................................................
hFl_ENSPANP00000016699 .............................................................................
hFl_ENSPANP00000001022 .............................................................................
hFl_ENSPANP00000015209 .............................................................................
hFl_ENSPANP00000012305 .............................................................................
hFl_ENSPANP00000018202 .............................................................................


                                                                      
                                                                      
d1kt1a1                ...............................................
hFl_ENSPANP00000004835 ...............................................
hFl_ENSPANP00000017500 ...............................................
hFl_ENSPANP00000011496 ...............................................
hFl_ENSPANP00000005875 lstleesvvriccirsfghfiarlqgsilqfnpevgifvsiaqseqe
hFl_ENSPANP00000015319 ...............................................
hFl_ENSPANP00000019493 ...............................................
hFl_ENSPANP00000015800 ...............................................
hFl_ENSPANP00000017125 ...............................................
hFl_ENSPANP00000011271 ...............................................
hFl_ENSPANP00000017151 ...............................................
hFl_ENSPANP00000007093 ...............................................
hFl_ENSPANP00000007238 ...............................................
hFl_ENSPANP00000007093 ...............................................
hFl_ENSPANP00000015526 ...............................................
hFl_ENSPANP00000010410 ...............................................
hFl_ENSPANP00000004737 ...............................................
hFl_ENSPANP00000020946 ...............................................
hFl_ENSPANP00000020864 ...............................................
hFl_ENSPANP00000007952 ...............................................
hFl_ENSPANP00000016788 ...............................................
hFl_ENSPANP00000004737 ...............................................
hFl_ENSPANP00000004737 ...............................................
hFl_ENSPANP00000000707 ...............................................
hFl_ENSPANP00000004108 ...............................................
hFl_ENSPANP00000016788 ...............................................
hFl_ENSPANP00000015646 ...............................................
hFl_ENSPANP00000015647 ...............................................
hFl_ENSPANP00000003166 ...............................................
hFl_ENSPANP00000003324 ...............................................
hFl_ENSPANP00000005479 ...............................................
hFl_ENSPANP00000003528 ...............................................
hFl_ENSPANP00000015647 ...............................................
hFl_ENSPANP00000014391 ...............................................
hFl_ENSPANP00000015646 ...............................................
hFl_ENSPANP00000015646 ...............................................
hFl_ENSPANP00000015647 ...............................................
hFl_ENSPANP00000010352 ...............................................
hFl_ENSPANP00000012491 ...............................................
hFl_ENSPANP00000014791 ...............................................
hFl_ENSPANP00000005591 ...............................................
hFl_ENSPANP00000015348 ...............................................
hFl_ENSPANP00000014791 ...............................................
hFl_ENSPANP00000013486 ...............................................
hFl_ENSPANP00000015752 ...............................................
hFl_ENSPANP00000014239 ...............................................
hFl_ENSPANP00000001617 ...............................................
hFl_ENSPANP00000017253 ...............................................
hFl_ENSPANP00000020687 ...............................................
hFl_ENSPANP00000014947 ...............................................
hFl_ENSPANP00000015753 ...............................................
hFl_ENSPANP00000003528 ...............................................
hFl_ENSPANP00000008218 ...............................................
hFl_ENSPANP00000015646 ...............................................
hFl_ENSPANP00000013297 ...............................................
hFl_ENSPANP00000015647 ...............................................
hFl_ENSPANP00000007362 ...............................................
hFl_ENSPANP00000014947 ...............................................
hFl_ENSPANP00000008383 ...............................................
hFl_ENSPANP00000017676 ...............................................
hFl_ENSPANP00000001814 ...............................................
hFl_ENSPANP00000001168 ...............................................
hFl_ENSPANP00000003176 ...............................................
hFl_ENSPANP00000010724 ...............................................
hFl_ENSPANP00000013376 ...............................................
hFl_ENSPANP00000013375 ...............................................
hFl_ENSPANP00000000707 ...............................................
hFl_ENSPANP00000012992 ...............................................
hFl_ENSPANP00000020687 ...............................................
hFl_ENSPANP00000000643 ...............................................
hFl_ENSPANP00000007559 ...............................................
hFl_ENSPANP00000003197 ...............................................
hFl_ENSPANP00000003945 ...............................................
hFl_ENSPANP00000012699 ...............................................
hFl_ENSPANP00000004293 ...............................................
hFl_ENSPANP00000014070 ...............................................
hFl_ENSPANP00000008096 ...............................................
hFl_ENSPANP00000014947 ...............................................
hFl_ENSPANP00000020577 ...............................................
hFl_ENSPANP00000020573 ...............................................
hFl_ENSPANP00000015642 ...............................................
hFl_ENSPANP00000019972 ...............................................
hFl_ENSPANP00000002155 ...............................................
hFl_ENSPANP00000003197 ...............................................
hFl_ENSPANP00000010388 ...............................................
hFl_ENSPANP00000009536 ...............................................
hFl_ENSPANP00000013401 ...............................................
hFl_ENSPANP00000007559 ...............................................
hFl_ENSPANP00000020038 ...............................................
hFl_ENSPANP00000020312 ...............................................
hFl_ENSPANP00000000258 ...............................................
hFl_ENSPANP00000017676 ...............................................
hFl_ENSPANP00000006518 ...............................................
hFl_ENSPANP00000013297 ...............................................
hFl_ENSPANP00000003504 ...............................................
hFl_ENSPANP00000017184 ...............................................
hFl_ENSPANP00000006801 ...............................................
hFl_ENSPANP00000015190 ...............................................
hFl_ENSPANP00000001081 ...............................................
hFl_ENSPANP00000006437 ...............................................
hFl_ENSPANP00000012699 ...............................................
hFl_ENSPANP00000007476 ...............................................
hFl_ENSPANP00000009269 ...............................................
hFl_ENSPANP00000014391 ...............................................
hFl_ENSPANP00000019581 ...............................................
hFl_ENSPANP00000020572 ...............................................
hFl_ENSPANP00000007217 ...............................................
hFl_ENSPANP00000020685 ...............................................
hFl_ENSPANP00000020899 ...............................................
hFl_ENSPANP00000008387 ...............................................
hFl_ENSPANP00000010352 ...............................................
hFl_ENSPANP00000009338 ...............................................
hFl_ENSPANP00000018160 ...............................................
hFl_ENSPANP00000020864 ...............................................
hFl_ENSPANP00000008387 ...............................................
hFl_ENSPANP00000009057 ...............................................
hFl_ENSPANP00000018160 ...............................................
hFl_ENSPANP00000007915 ...............................................
hFl_ENSPANP00000003731 ...............................................
hFl_ENSPANP00000015625 ...............................................
hFl_ENSPANP00000014767 ...............................................
hFl_ENSPANP00000002080 ...............................................
hFl_ENSPANP00000007403 ...............................................
hFl_ENSPANP00000007476 ...............................................
hFl_ENSPANP00000005487 ...............................................
hFl_ENSPANP00000003731 ...............................................
hFl_ENSPANP00000013410 ...............................................
hFl_ENSPANP00000003097 ...............................................
hFl_ENSPANP00000020575 ...............................................
hFl_ENSPANP00000007248 ...............................................
hFl_ENSPANP00000019375 ...............................................
hFl_ENSPANP00000003854 ...............................................
hFl_ENSPANP00000006795 ...............................................
hFl_ENSPANP00000002479 ...............................................
hFl_ENSPANP00000017125 ...............................................
hFl_ENSPANP00000005048 ...............................................
hFl_ENSPANP00000003731 ...............................................
hFl_ENSPANP00000018160 ...............................................
hFl_ENSPANP00000019375 ...............................................
hFl_ENSPANP00000014239 ...............................................
hFl_ENSPANP00000012835 ...............................................
hFl_ENSPANP00000001460 ...............................................
hFl_ENSPANP00000015753 ...............................................
hFl_ENSPANP00000003968 ...............................................
hFl_ENSPANP00000006868 ...............................................
hFl_ENSPANP00000001460 ...............................................
hFl_ENSPANP00000004313 ...............................................
hFl_ENSPANP00000001617 ...............................................
hFl_ENSPANP00000019732 ...............................................
hFl_ENSPANP00000013913 ...............................................
hFl_ENSPANP00000004649 ...............................................
hFl_ENSPANP00000013914 ...............................................
hFl_ENSPANP00000003176 ...............................................
hFl_ENSPANP00000003166 ...............................................
hFl_ENSPANP00000015752 ...............................................
hFl_ENSPANP00000001460 ...............................................
hFl_ENSPANP00000004498 ...............................................
hFl_ENSPANP00000014540 ...............................................
hFl_ENSPANP00000002479 ...............................................
hFl_ENSPANP00000017858 ...............................................
hFl_ENSPANP00000007886 ...............................................
hFl_ENSPANP00000018968 ...............................................
hFl_ENSPANP00000015642 ...............................................
hFl_ENSPANP00000003731 ...............................................
hFl_ENSPANP00000019484 ...............................................
hFl_ENSPANP00000019485 ...............................................
hFl_ENSPANP00000020575 ...............................................
hFl_ENSPANP00000017457 ...............................................
hFl_ENSPANP00000020575 ...............................................
hFl_ENSPANP00000004562 ...............................................
hFl_ENSPANP00000004438 ...............................................
hFl_ENSPANP00000008640 ...............................................
hFl_ENSPANP00000020327 ...............................................
hFl_ENSPANP00000020572 ...............................................
hFl_ENSPANP00000016643 ...............................................
hFl_ENSPANP00000006588 ...............................................
hFl_ENSPANP00000003995 ...............................................
hFl_ENSPANP00000007718 ...............................................
hFl_ENSPANP00000004384 ...............................................
hFl_ENSPANP00000011118 ...............................................
hFl_ENSPANP00000004252 ...............................................
hFl_ENSPANP00000007476 ...............................................
hFl_ENSPANP00000006588 ...............................................
hFl_ENSPANP00000001745 ...............................................
hFl_ENSPANP00000014391 ...............................................
hFl_ENSPANP00000004313 ...............................................
hFl_ENSPANP00000004562 ...............................................
hFl_ENSPANP00000001425 ...............................................
hFl_ENSPANP00000015647 ...............................................
hFl_ENSPANP00000019118 ...............................................
hFl_ENSPANP00000015209 ...............................................
hFl_ENSPANP00000006801 ...............................................
hFl_ENSPANP00000003551 ...............................................
hFl_ENSPANP00000004252 ...............................................
hFl_ENSPANP00000002479 ...............................................
hFl_ENSPANP00000004798 ...............................................
hFl_ENSPANP00000000477 ...............................................
hFl_ENSPANP00000007362 ...............................................
hFl_ENSPANP00000002485 ...............................................
hFl_ENSPANP00000014498 ...............................................
hFl_ENSPANP00000017253 ...............................................
hFl_ENSPANP00000016353 ...............................................
hFl_ENSPANP00000016352 ...............................................
hFl_ENSPANP00000018429 ...............................................
hFl_ENSPANP00000013579 ...............................................
hFl_ENSPANP00000000348 ...............................................
hFl_ENSPANP00000015511 ...............................................
hFl_ENSPANP00000007718 ...............................................
hFl_ENSPANP00000011118 ...............................................
hFl_ENSPANP00000007718 ...............................................
hFl_ENSPANP00000015642 ...............................................
hFl_ENSPANP00000001022 ...............................................
hFl_ENSPANP00000010920 ...............................................
hFl_ENSPANP00000007476 ...............................................
hFl_ENSPANP00000003968 ...............................................
hFl_ENSPANP00000001022 ...............................................
hFl_ENSPANP00000009443 ...............................................
hFl_ENSPANP00000011463 ...............................................
hFl_ENSPANP00000002961 ...............................................
hFl_ENSPANP00000017623 ...............................................
hFl_ENSPANP00000011215 ...............................................
hFl_ENSPANP00000000119 ...............................................
hFl_ENSPANP00000002418 ...............................................
hFl_ENSPANP00000014391 ...............................................
hFl_ENSPANP00000020421 ...............................................
hFl_ENSPANP00000008387 ...............................................
hFl_ENSPANP00000005487 ...............................................
hFl_ENSPANP00000002155 ...............................................
hFl_ENSPANP00000002567 ...............................................
hFl_ENSPANP00000019509 ...............................................
hFl_ENSPANP00000005069 ...............................................
hFl_ENSPANP00000000052 ...............................................
hFl_ENSPANP00000005735 ...............................................
hFl_ENSPANP00000001022 ...............................................
hFl_ENSPANP00000018160 ...............................................
hFl_ENSPANP00000018982 hfylkalslc.....................................
hFl_ENSPANP00000018968 ...............................................
hFl_ENSPANP00000008513 ...............................................
hFl_ENSPANP00000019509 ...............................................
hFl_ENSPANP00000006588 ...............................................
hFl_ENSPANP00000011118 ...............................................
hFl_ENSPANP00000003166 ...............................................
hFl_ENSPANP00000004798 ...............................................
hFl_ENSPANP00000015019 ...............................................
hFl_ENSPANP00000020573 ...............................................
hFl_ENSPANP00000004562 ...............................................
hFl_ENSPANP00000004252 ...............................................
hFl_ENSPANP00000020003 ...............................................
hFl_ENSPANP00000006922 ...............................................
hFl_ENSPANP00000001081 ...............................................
hFl_ENSPANP00000020426 ...............................................
hFl_ENSPANP00000014026 ...............................................
hFl_ENSPANP00000015646 ...............................................
hFl_ENSPANP00000015647 ...............................................
hFl_ENSPANP00000015639 ...............................................
hFl_ENSPANP00000004438 ...............................................
hFl_ENSPANP00000015636 ...............................................
hFl_ENSPANP00000006186 ...............................................
hFl_ENSPANP00000015209 ...............................................
hFl_ENSPANP00000000119 ...............................................
hFl_ENSPANP00000011874 ...............................................
hFl_ENSPANP00000013299 ...............................................
hFl_ENSPANP00000003968 ...............................................
hFl_ENSPANP00000005681 ...............................................
hFl_ENSPANP00000012992 ...............................................
hFl_ENSPANP00000004384 ...............................................
hFl_ENSPANP00000020572 ...............................................
hFl_ENSPANP00000006404 ...............................................
hFl_ENSPANP00000000870 ...............................................
hFl_ENSPANP00000001745 ...............................................
hFl_ENSPANP00000011077 ...............................................
hFl_ENSPANP00000003398 ...............................................
hFl_ENSPANP00000008218 ...............................................
hFl_ENSPANP00000010361 ...............................................
hFl_ENSPANP00000017310 ...............................................
hFl_ENSPANP00000004678 ...............................................
hFl_ENSPANP00000005519 ...............................................
hFl_ENSPANP00000008921 ...............................................
hFl_ENSPANP00000016699 ...............................................
hFl_ENSPANP00000001022 ...............................................
hFl_ENSPANP00000015209 ...............................................
hFl_ENSPANP00000012305 ...............................................
hFl_ENSPANP00000018202 ...............................................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0040251 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Drosophila melanogaster 58 (pseudogenes) - Fruit fly
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Bathycoccus prasinos
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Cyanidioschyzon merolae strain 10D 22
NoYes   Cyanidioschyzon merolae
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Giardia lamblia 2.3
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Ichthyophthirius multifiliis strain G5
NoYes   Cryptosporidium hominis
NoYes   Cryptosporidium muris
NoYes   Cryptosporidium parvum Iowa II
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Babesia bovis T2Bo
NoYes   Theileria parva
NoYes   Theileria annulata
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Plasmodium yoelii ssp. yoelii 1
NoYes   Plasmodium chabaudi
NoYes   Plasmodium berghei ANKA
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Acholeplasma laidlawii PG-8A
NoYes   Thermobaculum terrenum ATCC BAA-798
NoYes   Leptolyngbya sp. PCC 7376
NoYes   Pseudanabaena sp. PCC 7367
NoYes   Acaryochloris marina MBIC11017
NoYes   Synechocystis sp. PCC 6803
NoYes   Thermosynechococcus sp. NK55
NoYes   Thermosynechococcus elongatus BP-1
NoYes   Synechococcus sp. PCC 7502
NoYes   Synechococcus sp. PCC 6312
NoYes   Synechococcus sp. CC9311
NoYes   Synechococcus elongatus PCC 7942
NoYes   Prochlorococcus marinus str. MIT 9515
NoYes   Microcoleus sp. PCC 7113
NoYes   Trichodesmium erythraeum IMS101
NoYes   Geitlerinema sp. PCC 7407
NoYes   Cyanothece sp. PCC 8802
NoYes   Gloeocapsa sp. PCC 7428
NoYes   cyanobacterium UCYN-A
NoYes   Halothece sp. PCC 7418
NoYes   Microcystis aeruginosa NIES-843
NoYes   Gloeobacter violaceus PCC 7421
NoYes   Rivularia sp. PCC 7116
NoYes   Calothrix sp. PCC 7507
NoYes   Anabaena variabilis ATCC 29413
NoYes   'Nostoc azollae' 0708
NoYes   Nostoc sp. PCC 7107
NoYes   Nostoc punctiforme PCC 73102
NoYes   Nostoc sp. PCC 7120
NoYes   Nostoc sp. PCC 7524
NoYes   Anabaena sp. 90
NoYes   Conexibacter woesei DSM 14684
NoYes   Cryptobacterium curtum DSM 15641
NoYes   Eggerthella sp. YY7918
NoYes   Eggerthella lenta DSM 2243
NoYes   Slackia heliotrinireducens DSM 20476
NoYes   Olsenella uli DSM 7084
NoYes   Atopobium parvulum DSM 20469
NoYes   Coriobacterium glomerans PW2
NoYes   Rubrobacter xylanophilus DSM 9941
NoYes   Ilumatobacter coccineus
NoYes   Acidimicrobium ferrooxidans DSM 10331
NoYes   Thermobispora bispora DSM 43833
NoYes   Nakamurella multipartita DSM 44233
NoYes   Acidothermus cellulolyticus 11B
NoYes   Modestobacter marinus
NoYes   Blastococcus saxobsidens DD2
NoYes   Geodermatophilus obscurus DSM 43160
NoYes   Kineococcus radiotolerans SRS30216
NoYes   Catenulispora acidiphila DSM 44928
NoYes   Stackebrandtia nassauensis DSM 44728
NoYes   Frankia symbiont of Datisca glomerata
NoYes   Frankia sp. EAN1pec
NoYes   Frankia alni ACN14a
NoYes   Thermobifida fusca YX
NoYes   Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111
NoYes   Thermomonospora curvata DSM 43183
NoYes   Streptosporangium roseum DSM 43021
NoYes   Kitasatospora setae KM-6054
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces sp. PAMC26508
NoYes   Streptomyces flavogriseus ATCC 33331
NoYes   Streptomyces sp. SirexAA-E
NoYes   Streptomyces griseus subsp. griseus NBRC 13350
NoYes   Streptomyces bingchenggensis BCW-1
NoYes   Streptomyces violaceusniger Tu 4113
NoYes   Streptomyces avermitilis MA-4680
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces scabiei 87.22
NoYes   Streptomyces hygroscopicus subsp. jinggangensis 5008
NoYes   Actinosynnema mirum DSM 43827
NoYes   Saccharomonospora viridis DSM 43017
NoYes   Pseudonocardia dioxanivorans CB1190
NoYes   Saccharopolyspora erythraea NRRL 2338
NoYes   Amycolatopsis mediterranei U32
NoYes   Kribbella flavida DSM 17836
NoYes   Nocardioides sp. JS614
NoYes   Propionibacterium propionicum F0230a
NoYes   Propionibacterium acnes SK137
NoYes   Microlunatus phosphovorus NM-1
NoYes   Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1
NoYes   Salinispora arenicola CNS-205
NoYes   Salinispora tropica CNB-440
NoYes   Verrucosispora maris AB-18-032
NoYes   Micromonospora sp. L5
NoYes   Micromonospora aurantiaca ATCC 27029
NoYes   Actinoplanes sp. N902-109
NoYes   Actinoplanes sp. SE50/110
NoYes   Actinoplanes missouriensis 431
NoYes   Segniliparus rotundus DSM 44985
NoYes   Tsukamurella paurometabola DSM 20162
NoYes   Gordonia sp. KTR9
NoYes   Gordonia polyisoprenivorans VH2
NoYes   Gordonia bronchialis DSM 43247
NoYes   Rhodococcus jostii RHA1
NoYes   Rhodococcus equi 103S
NoYes   Rhodococcus opacus B4
NoYes   Rhodococcus erythropolis PR4
NoYes   Nocardia cyriacigeorgica GUH-2
NoYes   Nocardia farcinica IFM 10152
NoYes   Amycolicicoccus subflavus DQS3-9A1
NoYes   Mycobacterium massiliense str. GO 06
NoYes   Mycobacterium abscessus ATCC 19977
NoYes   Mycobacterium sp. JLS
NoYes   Mycobacterium intracellulare ATCC 13950
NoYes   Mycobacterium avium 104
NoYes   Mycobacterium vanbaalenii PYR-1
NoYes   Mycobacterium canettii CIPT 140010059
NoYes   Mycobacterium africanum GM041182
NoYes   Mycobacterium tuberculosis KZN 1435
NoYes   Mycobacterium tuberculosis
NoYes   Mycobacterium bovis BCG str. Pasteur 1173P2
NoYes   Mycobacterium rhodesiae NBB3
NoYes   Mycobacterium ulcerans Agy99
NoYes   Mycobacterium gilvum PYR-GCK
NoYes   Mycobacterium chubuense NBB4
NoYes   Mycobacterium marinum M
NoYes   Mycobacterium smegmatis str. MC2 155
NoYes   Mycobacterium leprae Br4923
NoYes   Corynebacterium resistens DSM 45100
NoYes   Corynebacterium aurimucosum ATCC 700975
NoYes   Corynebacterium kroppenstedtii DSM 44385
NoYes   Corynebacterium efficiens YS-314
NoYes   Corynebacterium ulcerans 0102
NoYes   Corynebacterium urealyticum DSM 7109
NoYes   Corynebacterium jeikeium K411
NoYes   Corynebacterium variabile DSM 44702
NoYes   Corynebacterium pseudotuberculosis 316
NoYes   Corynebacterium glutamicum R
NoYes   Corynebacterium diphtheriae NCTC 13129
NoYes   Sanguibacter keddieii DSM 10542
NoYes   Kytococcus sedentarius DSM 20547
NoYes   Beutenbergia cavernae DSM 12333
NoYes   Leifsonia xyli subsp. xyli str. CTCB07
NoYes   Microbacterium testaceum StLB037
NoYes   Clavibacter michiganensis subsp. michiganensis NCPPB 382
NoYes   Jonesia denitrificans DSM 20603
NoYes   Intrasporangium calvum DSM 43043
NoYes   Brachybacterium faecium DSM 4810
NoYes   Isoptericola variabilis 225
NoYes   Xylanimonas cellulosilytica DSM 15894
NoYes   Cellulomonas flavigena DSM 20109
NoYes   Cellulomonas fimi ATCC 484
NoYes   [Cellvibrio] gilvus ATCC 13127
NoYes   Arthrobacter phenanthrenivorans Sphe3
NoYes   Arthrobacter chlorophenolicus A6
NoYes   Arthrobacter aurescens TC1
NoYes   Arthrobacter arilaitensis Re117
NoYes   Kocuria rhizophila DC2201
NoYes   Rothia mucilaginosa DY-18
NoYes   Rothia dentocariosa ATCC 17931
NoYes   Arthrobacter sp. Rue61a
NoYes   Arthrobacter sp. FB24
NoYes   Renibacterium salmoninarum ATCC 33209
NoYes   Micrococcus luteus NCTC 2665
NoYes   Gardnerella vaginalis 409-05
NoYes   Bifidobacterium longum subsp. longum JDM301
NoYes   Bifidobacterium animalis subsp. lactis Bl-04
NoYes   Bifidobacterium dentium Bd1
NoYes   Bifidobacterium breve ACS-071-V-Sch8b
NoYes   Bifidobacterium bifidum S17
NoYes   Bifidobacterium adolescentis ATCC 15703
NoYes   Arcanobacterium haemolyticum DSM 20595
NoYes   Mobiluncus curtisii ATCC 43063
NoYes   Actinomyces sp. F0330
NoYes   Caldilinea aerophila DSM 14535 = NBRC 104270
NoYes   Dehalococcoides ethenogenes 195
NoYes   Dehalococcoides sp. BAV1
NoYes   Dehalogenimonas lykanthroporepellens BL-DC-9
NoYes   Anaerolinea thermophila UNI-1
NoYes   Thermomicrobium roseum DSM 5159
NoYes   Sphaerobacter thermophilus DSM 20745
NoYes   Herpetosiphon aurantiacus DSM 785
NoYes   Roseiflexus sp. RS-1
NoYes   Roseiflexus castenholzii DSM 13941
NoYes   Chloroflexus sp. MS-G
NoYes   Chloroflexus sp. Y-400-fl
NoYes   Chloroflexus aggregans DSM 9485
NoYes   Chloroflexus aurantiacus J-10-fl
NoYes   Truepera radiovictrix DSM 17093
NoYes   Deinococcus gobiensis I-0
NoYes   Deinococcus deserti VCD115
NoYes   Deinococcus maricopensis DSM 21211
NoYes   Deinococcus geothermalis DSM 11300
NoYes   Deinococcus proteolyticus MRP
NoYes   Deinococcus radiodurans R1
NoYes   Oceanithermus profundus DSM 14977
NoYes   Marinithermus hydrothermalis DSM 14884
NoYes   Meiothermus silvanus DSM 9946
NoYes   Meiothermus ruber DSM 1279
NoYes   Thermus sp. CCB_US3_UF1
NoYes   Thermus scotoductus SA-01
NoYes   Thermus thermophilus HB27
NoYes   Anaerococcus prevotii DSM 20548
NoYes   Finegoldia magna ATCC 29328
NoYes   Veillonella parvula DSM 2008
NoYes   Megasphaera elsdenii DSM 20460
NoYes   Acidaminococcus intestini RyC-MR95
NoYes   Acidaminococcus fermentans DSM 20731
NoYes   Megamonas hypermegale
NoYes   Selenomonas sputigena ATCC 35185
NoYes   Selenomonas ruminantium subsp. lactilytica TAM6421
NoYes   Erysipelothrix rhusiopathiae str. Fujisawa
NoYes   Natranaerobius thermophilus JW/NM-WN-LF
NoYes   Symbiobacterium thermophilum IAM 14863
NoYes   Clostridiales genomosp. BVAB3 str. UPII9-5
NoYes   Clostridium clariflavum DSM 19732
NoYes   Eubacterium siraeum
NoYes   Clostridium cellulolyticum H10
NoYes   Clostridium thermocellum ATCC 27405
NoYes   Ethanoligenens harbinense YUAN-3
NoYes   Faecalibacterium prausnitzii
NoYes   Ruminococcus sp.
NoYes   Ruminococcus bromii
NoYes   Ruminococcus albus 7
NoYes   Thermaerobacter marianensis DSM 12885
NoYes   Sulfobacillus acidophilus DSM 10332
NoYes   Oscillibacter valericigenes Sjm18-20
NoYes   butyrate-producing bacterium SS3/4
NoYes   butyrate-producing bacterium SM4/1
NoYes   Candidatus Desulforudis audaxviator MP104C
NoYes   Thermincola potens JR
NoYes   Pelotomaculum thermopropionicum SI
NoYes   Desulfosporosinus acidiphilus SJ4
NoYes   Desulfosporosinus orientis DSM 765
NoYes   Dehalobacter sp. DCA
NoYes   Dehalobacter sp. CF
NoYes   Syntrophobotulus glycolicus DSM 8271
NoYes   Desulfitobacterium hafniense Y51
NoYes   Desulfitobacterium dehalogenans ATCC 51507
NoYes   Desulfotomaculum reducens MI-1
NoYes   Desulfotomaculum acetoxidans DSM 771
NoYes   Desulfotomaculum kuznetsovii DSM 6115
NoYes   Desulfotomaculum carboxydivorans CO-1-SRB
NoYes   Desulfotomaculum ruminis DSM 2154
NoYes   Acetobacterium woodii DSM 1030
NoYes   Eubacterium eligens ATCC 27750
NoYes   Eubacterium limosum KIST612
NoYes   Clostridium difficile 630
NoYes   Clostridium sticklandii DSM 519
NoYes   Filifactor alocis ATCC 35896
NoYes   Clostridium saccharolyticum WM1
NoYes   Clostridium phytofermentans ISDg
NoYes   Clostridium lentocellum DSM 5427
NoYes   [Ruminococcus] obeum
NoYes   [Ruminococcus] torques
NoYes   Eubacterium rectale M104/1
NoYes   Eubacterium rectale ATCC 33656
NoYes   Coprococcus sp. ART55/1
NoYes   Roseburia hominis A2-183
NoYes   Roseburia intestinalis
NoYes   Butyrivibrio proteoclasticus B316
NoYes   Butyrivibrio fibrisolvens
NoYes   Syntrophothermus lipocalidus DSM 12680
NoYes   Syntrophomonas wolfei subsp. wolfei str. Goettingen
NoYes   Heliobacterium modesticaldum Ice1
NoYes   Alkaliphilus oremlandii OhILAs
NoYes   Alkaliphilus metalliredigens QYMF
NoYes   Candidatus Arthromitus sp. SFB-mouse-Japan
NoYes   Clostridium sp. BNL1100
NoYes   Clostridium novyi NT
NoYes   Clostridium ljungdahlii DSM 13528
NoYes   Clostridium kluyveri DSM 555
NoYes   Clostridium beijerinckii NCIMB 8052
NoYes   Clostridium tetani E88
NoYes   Clostridium perfringens ATCC 13124
NoYes   Clostridium cellulovorans 743B
NoYes   Clostridium botulinum A str. ATCC 3502
NoYes   Clostridium acetobutylicum ATCC 824
NoYes   Mahella australiensis 50-1 BON
NoYes   Thermosediminibacter oceani DSM 16646
NoYes   Caldicellulosiruptor obsidiansis OB47
NoYes   Caldicellulosiruptor kronotskyensis 2002
NoYes   Caldicellulosiruptor hydrothermalis 108
NoYes   Caldicellulosiruptor owensensis OL
NoYes   Caldicellulosiruptor lactoaceticus 6A
NoYes   Caldicellulosiruptor kristjanssonii 177R1B
NoYes   Caldicellulosiruptor saccharolyticus DSM 8903
NoYes   Caldicellulosiruptor bescii DSM 6725
NoYes   Thermoanaerobacterium xylanolyticum LX-11
NoYes   Thermoanaerobacterium thermosaccharolyticum DSM 571
NoYes   Thermodesulfobium narugense DSM 14796
NoYes   Coprothermobacter proteolyticus DSM 5265
NoYes   Tepidanaerobacter acetatoxydans Re1
NoYes   Thermoanaerobacter tengcongensis MB4
NoYes   Carboxydothermus hydrogenoformans Z-2901
NoYes   Moorella thermoacetica ATCC 39073
NoYes   Ammonifex degensii KC4
NoYes   Thermoanaerobacter mathranii subsp. mathranii str. A3
NoYes   Thermoanaerobacter pseudethanolicus ATCC 33223
NoYes   Thermoanaerobacter sp. X514
NoYes   Thermoanaerobacter italicus Ab9
NoYes   Thermoanaerobacter wiegelii Rt8.B1
NoYes   Thermoanaerobacter brockii subsp. finnii Ako-1
NoYes   Acetohalobium arabaticum DSM 5501
NoYes   Halothermothrix orenii H 168
NoYes   Halanaerobium hydrogeniformans
NoYes   Halanaerobium praevalens DSM 2228
NoYes   Carnobacterium sp. 17-4
NoYes   Carnobacterium sp. WN1359
NoYes   Aerococcus urinae ACS-120-V-Col10a
NoYes   Tetragenococcus halophilus NBRC 12172
NoYes   Melissococcus plutonius DAT561
NoYes   Enterococcus sp. 7L76
NoYes   Enterococcus hirae ATCC 9790
NoYes   Enterococcus faecium Aus0004
NoYes   Enterococcus faecalis 62
NoYes   Weissella koreensis KACC 15510
NoYes   Oenococcus oeni PSU-1
NoYes   Leuconostoc sp. C2
NoYes   Leuconostoc kimchii IMSNU 11154
NoYes   Leuconostoc citreum KM20
NoYes   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
NoYes   Leuconostoc gasicomitatum LMG 18811
NoYes   Lactobacillus casei ATCC 334
NoYes   Lactobacillus kefiranofaciens ZW3
NoYes   Lactobacillus crispatus ST1
NoYes   Lactobacillus rhamnosus Lc 705
NoYes   Lactobacillus johnsonii FI9785
NoYes   Lactobacillus sanfranciscensis TMW 1.1304
NoYes   Lactobacillus salivarius CECT 5713
NoYes   Lactobacillus ruminis ATCC 27782
NoYes   Lactobacillus fermentum IFO 3956
NoYes   Lactobacillus amylovorus GRL1118
NoYes   Lactobacillus sakei subsp. sakei 23K
NoYes   Lactobacillus reuteri DSM 20016
NoYes   Lactobacillus gasseri ATCC 33323
NoYes   Lactobacillus plantarum JDM1
NoYes   Lactobacillus helveticus DPC 4571
NoYes   Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365
NoYes   Lactobacillus buchneri NRRL B-30929
NoYes   Lactobacillus buchneri
NoYes   Lactobacillus brevis ATCC 367
NoYes   Lactobacillus acidophilus 30SC
NoYes   Pediococcus claussenii ATCC BAA-344
NoYes   Pediococcus pentosaceus ATCC 25745
NoYes   Lactococcus garvieae ATCC 49156
NoYes   Lactococcus lactis subsp. cremoris MG1363
NoYes   Streptococcus sp. I-P16
NoYes   Streptococcus sp. I-G2
NoYes   Streptococcus intermedius JTH08
NoYes   Streptococcus gallolyticus UCN34
NoYes   Streptococcus pseudopneumoniae IS7493
NoYes   Streptococcus pasteurianus ATCC 43144
NoYes   Streptococcus equi subsp. equi 4047
NoYes   Streptococcus dysgalactiae subsp. equisimilis GGS_124
NoYes   Streptococcus infantarius subsp. infantarius CJ18
NoYes   Streptococcus macedonicus ACA-DC 198
NoYes   Streptococcus mitis B6
NoYes   Streptococcus uberis 0140J
NoYes   Streptococcus parauberis KCTC 11537
NoYes   Streptococcus parasanguinis ATCC 15912
NoYes   Streptococcus pyogenes str. Manfredo
NoYes   Streptococcus pneumoniae P1031
NoYes   Streptococcus agalactiae A909
NoYes   Streptococcus mutans NN2025
NoYes   Streptococcus thermophilus LMD-9
NoYes   Streptococcus suis P1/7
NoYes   Streptococcus sanguinis SK36
NoYes   Streptococcus salivarius 57.I
NoYes   Streptococcus oralis Uo5
NoYes   Streptococcus gordonii str. Challis substr. CH1
NoYes   Exiguobacterium sp. MH3
NoYes   Exiguobacterium sp. AT1b
NoYes   Exiguobacterium sibiricum 255-15
NoYes   Kyrpidia tusciae DSM 2912
NoYes   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
NoYes   Brevibacillus brevis NBRC 100599
NoYes   Paenibacillus sp. JDR-2
NoYes   Paenibacillus terrae HPL-003
NoYes   Paenibacillus mucilaginosus 3016
NoYes   Paenibacillus polymyxa M1
NoYes   Bacillus selenitireducens MLS10
NoYes   Listeria welshimeri serovar 6b str. SLCC5334
NoYes   Listeria innocua Clip11262
NoYes   Listeria seeligeri serovar 1/2b str. SLCC3954
NoYes   Listeria monocytogenes serotype 4b str. CLIP 80459
NoYes   Listeria ivanovii subsp. ivanovii PAM 55
NoYes   Solibacillus silvestris StLB046
NoYes   Geobacillus thermoglucosidasius C56-YS93
NoYes   Lysinibacillus sphaericus C3-41
NoYes   Oceanobacillus iheyensis HTE831
NoYes   Anoxybacillus flavithermus WK1
NoYes   Geobacillus thermoleovorans CCB_US3_UF5
NoYes   Geobacillus kaustophilus HTA426
NoYes   Geobacillus sp. GHH01
NoYes   Geobacillus sp. WCH70
NoYes   Geobacillus thermodenitrificans NG80-2
NoYes   Halobacillus halophilus DSM 2266
NoYes   Bacillus sp. JS
NoYes   butyrate-producing bacterium SSC/2
NoYes   Bacillus sp. 1NLA3E
NoYes   Bacillus amyloliquefaciens FZB42
NoYes   Bacillus atrophaeus 1942
NoYes   Bacillus subtilis subsp. subtilis str. 168
NoYes   Bacillus licheniformis DSM 13 = ATCC 14580
NoYes   Bacillus halodurans C-125
NoYes   Bacillus weihenstephanensis KBAB4
NoYes   Bacillus thuringiensis str. Al Hakam
NoYes   Bacillus cereus 03BB102
NoYes   Bacillus anthracis str. A0248
NoYes   Bacillus pseudofirmus OF4
NoYes   Bacillus clausii KSM-K16
NoYes   Bacillus cellulosilyticus DSM 2522
NoYes   Bacillus pumilus SAFR-032
NoYes   Bacillus megaterium DSM 319
NoYes   Bacillus coagulans 2-6
NoYes   Macrococcus caseolyticus JCSC5402
NoYes   Staphylococcus pseudintermedius HKU10-03
NoYes   Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305
NoYes   Staphylococcus lugdunensis HKU09-01
NoYes   Staphylococcus haemolyticus JCSC1435
NoYes   Staphylococcus epidermidis RP62A
NoYes   Staphylococcus carnosus subsp. carnosus TM300
NoYes   Staphylococcus aureus subsp. aureus JH1
NoYes   Staphylococcus aureus
NoYes   Candidatus Cloacamonas acidaminovorans
NoYes   Gemmatimonas aurantiaca T-27
NoYes   Melioribacter roseus P3M
NoYes   Ignavibacterium album JCM 16511
NoYes   Pelodictyon phaeoclathratiforme BU-1
NoYes   Chlorobium luteolum DSM 273
NoYes   Chlorobium chlorochromatii CaD3
NoYes   Chlorobium phaeobacteroides DSM 266
NoYes   Chlorobium phaeovibrioides DSM 265
NoYes   Chlorobium limicola DSM 245
NoYes   Chlorobaculum parvum NCIB 8327
NoYes   Chlorobium tepidum TLS
NoYes   Chloroherpeton thalassium ATCC 35110
NoYes   Prosthecochloris aestuarii DSM 271
NoYes   Haliscomenobacter hydrossis DSM 1100
NoYes   Saprospira grandis str. Lewin
NoYes   Niastella koreensis GR20-10
NoYes   Chitinophaga pinensis DSM 2588
NoYes   Salinibacter ruber M8
NoYes   Rhodothermus marinus DSM 4252