SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Nuclear receptor ligand-binding domain alignments

These alignments are sequences aligned to the 0045423 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d2prga_                e............................................................................
Mpf_ENSMPUP00000008313 lt...........................................................................
Mpf_ENSMPUP00000000416 ls...........................................................................
Mpf_ENSMPUP00000003764 n............................................................................
Mpf_ENSMPUP00000017072 r............................................................................
Mpf_ENSMPUP00000012080 k............................................................................
Mpf_ENSMPUP00000016128 ksl..........................................................................
Mpf_ENSMPUP00000012031 r............................................................................
Mpf_ENSMPUP00000002249 n............................................................................
Mpf_ENSMPUP00000004251 rr...........................................................................
Mpf_ENSMPUP00000006062 r............................................................................
Mpf_ENSMPUP00000014752 r............................................................................
Mpf_ENSMPUP00000008953 .............................................................................
Mpf_ENSMPUP00000000435 rtdslkgrr....................................................................
Mpf_ENSMPUP00000012040 tdeeweliktvteahvatnaqgshwkqkrkflpedigqap.....................................
Mpf_ENSMPUP00000010404 palslt.......................................................................
Mpf_ENSMPUP00000004749 lsp..........................................................................
Mpf_ENSMPUP00000001918 qltaa........................................................................
Mpf_ENSMPUP00000008813 eidriaqniikshletcqytmeelhqla.................................................
Mpf_ENSMPUP00000017557 k............................................................................
Mpf_ENSMPUP00000014808 lac..........................................................................
Mpf_ENSMPUP00000012042 mhl..........................................................................
Mpf_ENSMPUP00000014280 lskeqeelvrtllgahsrhvgtmfnqfv.................................................
Mpf_ENSMPUP00000004101 r............................................................................
Mpf_ENSMPUP00000012828 ka...........................................................................
Mpf_ENSMPUP00000010064 k............................................................................
Mpf_ENSMPUP00000010389 kl...........................................................................
Mpf_ENSMPUP00000010600 r............................................................................
Mpf_ENSMPUP00000015812 ishshrqtsqlsssstlcfvfvqaylsllrfaqk...........................................
Mpf_ENSMPUP00000016994 nqdavqnerqprstaqvrlagmesdaetrleplvaplapagpsprdpmpvsaaralgpgaltppghhhfltslitae
Mpf_ENSMPUP00000010444 f............................................................................
Mpf_ENSMPUP00000007646 rtdslkg......................................................................
Mpf_ENSMPUP00000011482 ltpdqqnllhyimdsyskqrmpqeitnkilkeefsaeen......................................
Mpf_ENSMPUP00000006969 pspvm........................................................................
Mpf_ENSMPUP00000017141 kmesvqserkpfdvqrekpsncaastekiyirkdlrspliatptfvadkdgarqtglldpgmlvniqqpliredgtv
Mpf_ENSMPUP00000001766 knc..........................................................................
Mpf_ENSMPUP00000007823 p............................................................................
Mpf_ENSMPUP00000002631 etq..........................................................................
Mpf_ENSMPUP00000013868 rl...........................................................................
Mpf_ENSMPUP00000009731 nkdavqhergprtstirkqvalyfrghkeengaaahfpsaalpapafftavtqlephglelaavsatperqtlvsla
Mpf_ENSMPUP00000014812 keemirslqqrpeptpeewdlihvateahrstnaqgshwkqrrkflpd.............................
Mpf_ENSMPUP00000006636 rtdslkgrrgrlpskpksplqqepsqpsppsppicmmnalvra..................................
Mpf_ENSMPUP00000003519 kaf..........................................................................
Mpf_ENSMPUP00000006634 alsp.........................................................................
Mpf_ENSMPUP00000000742 elehlaqniskshletcqylreelqqitwqtflqeeies......................................
Mpf_ENSMPUP00000013860 iredgmpggrnksigpvqiseeeierimsgqefeeeanhwsnhgdsdhsspgnrasesnqpspgstlssrsvelngf
Mpf_ENSMPUP00000015554 ily..........................................................................
Mpf_ENSMPUP00000005728 ltqeeh.......................................................................
Mpf_ENSMPUP00000003520 etehlvqnvcksyretcqlrled......................................................
Mpf_ENSMPUP00000012363 avg..........................................................................
Mpf_ENSMPUP00000007278 rqdsvqcerkpievsrekssncaastekiyirkdlrsplaatptfvtdsesarsaglldsgmfvnihqsgiktestv


                                                                                                    
                                                                                                    
d2prga_                .............................................................................
Mpf_ENSMPUP00000008313 .............................................................................
Mpf_ENSMPUP00000000416 .............................................................................
Mpf_ENSMPUP00000003764 .............................................................................
Mpf_ENSMPUP00000017072 .............................................................................
Mpf_ENSMPUP00000012080 .............................................................................
Mpf_ENSMPUP00000016128 .............................................................................
Mpf_ENSMPUP00000012031 .............................................................................
Mpf_ENSMPUP00000002249 .............................................................................
Mpf_ENSMPUP00000004251 .............................................................................
Mpf_ENSMPUP00000006062 .............................................................................
Mpf_ENSMPUP00000014752 .............................................................................
Mpf_ENSMPUP00000008953 .............................................................................
Mpf_ENSMPUP00000000435 .............................................................................
Mpf_ENSMPUP00000012040 .............................................................................
Mpf_ENSMPUP00000010404 .............................................................................
Mpf_ENSMPUP00000004749 .............................................................................
Mpf_ENSMPUP00000001918 .............................................................................
Mpf_ENSMPUP00000008813 .............................................................................
Mpf_ENSMPUP00000017557 .............................................................................
Mpf_ENSMPUP00000014808 .............................................................................
Mpf_ENSMPUP00000012042 .............................................................................
Mpf_ENSMPUP00000014280 .............................................................................
Mpf_ENSMPUP00000004101 .............................................................................
Mpf_ENSMPUP00000012828 .............................................................................
Mpf_ENSMPUP00000010064 .............................................................................
Mpf_ENSMPUP00000010389 .............................................................................
Mpf_ENSMPUP00000010600 .............................................................................
Mpf_ENSMPUP00000015812 .............................................................................
Mpf_ENSMPUP00000016994 tcaklepedadenidvtsndpefpss...................................................
Mpf_ENSMPUP00000010444 .............................................................................
Mpf_ENSMPUP00000007646 .............................................................................
Mpf_ENSMPUP00000011482 .............................................................................
Mpf_ENSMPUP00000006969 .............................................................................
Mpf_ENSMPUP00000017141 llatdskaetsqgalgtlanvvtslanlseslnngdasemqpedqsaseitra........................
Mpf_ENSMPUP00000001766 .............................................................................
Mpf_ENSMPUP00000007823 .............................................................................
Mpf_ENSMPUP00000002631 .............................................................................
Mpf_ENSMPUP00000013868 .............................................................................
Mpf_ENSMPUP00000009731 qptpkyphevngtpmylyev.........................................................
Mpf_ENSMPUP00000014812 .............................................................................
Mpf_ENSMPUP00000006636 .............................................................................
Mpf_ENSMPUP00000003519 .............................................................................
Mpf_ENSMPUP00000006634 .............................................................................
Mpf_ENSMPUP00000000742 .............................................................................
Mpf_ENSMPUP00000013860 mafreqymgmsvpphyqyiphllsysahspllppqarsl......................................
Mpf_ENSMPUP00000015554 .............................................................................
Mpf_ENSMPUP00000005728 .............................................................................
Mpf_ENSMPUP00000003520 .............................................................................
Mpf_ENSMPUP00000012363 .............................................................................
Mpf_ENSMPUP00000007278 lmtpdkaescqgdlstlasvvtslanlgktkdpsqnssemsvieslsngdtslcefhqevqtngdvsrafdtlakal


                                                                   10        20          30         
                                                                    |         |           |         
d2prga_                ....................................-SADLRALAKHLYDSYIKSF..PLTKAKARAILTGKTTDK.
Mpf_ENSMPUP00000008313 ....................................--------------------..------------------.
Mpf_ENSMPUP00000000416 ....................................--------------------..------------------.
Mpf_ENSMPUP00000003764 ....................................---------RCQYCRYQKCLvmGMKREAVQEERQRSRERAe
Mpf_ENSMPUP00000017072 ....................................------ALAKHLYDSYIKSF..PLTKAKARAILTGKTTDK.
Mpf_ENSMPUP00000012080 ....................................--------------------..---REAVQEERQRGKDRS.
Mpf_ENSMPUP00000016128 ....................................--------AKRIYEAYLKNF..NMNKVKARVILAGKASNN.
Mpf_ENSMPUP00000012031 ....................................--------NRCQYCRLQKCFevGMSKESVRNDRNKKKKEPs
Mpf_ENSMPUP00000002249 ....................................---------RCQYCRYQKCLatGMKREAVQEERQRGKDKDg
Mpf_ENSMPUP00000004251 ....................................-------RKSCQACRFMKCLkvGMLKEGVRLDRVRGGRQKy
Mpf_ENSMPUP00000006062 ....................................--------NRCQYCRLQKCFevGMSKEAVRNDRNKKKKEVk
Mpf_ENSMPUP00000014752 ....................................--------NRCQYCRLQKCFevGMSKESVRNDRNKKKKEAp
Mpf_ENSMPUP00000008953 ....................................--------------------..-------RLDRVRGGRQKy
Mpf_ENSMPUP00000000435 ....................................--------------------..---------GRLPSKPKSp
Mpf_ENSMPUP00000012040 ....................................--------------------..------------------.
Mpf_ENSMPUP00000010404 ....................................--------------------..------------------.
Mpf_ENSMPUP00000004749 ....................................--------------------..------------------.
Mpf_ENSMPUP00000001918 ....................................--------------------..------------------.
Mpf_ENSMPUP00000008813 ....................................--------------------..------------------.
Mpf_ENSMPUP00000017557 ....................................--------------------..---KEAVQNERDRISTRRs
Mpf_ENSMPUP00000014808 ....................................--------------------..------------------.
Mpf_ENSMPUP00000012042 ....................................--------------------..------------------.
Mpf_ENSMPUP00000014280 ....................................--------------------..------------------.
Mpf_ENSMPUP00000004101 ....................................--------------------..---REAVQRGRMPPTQPNp
Mpf_ENSMPUP00000012828 ....................................----------CQACRFTKCLrvGMLKEGVRLDRVRGGRQKy
Mpf_ENSMPUP00000010064 ....................................--------------------..---KEAVQNERDRISTRRs
Mpf_ENSMPUP00000010389 ....................................--------------------..----EAVRADRMRGGRNKf
Mpf_ENSMPUP00000010600 ....................................--------------------..---REAVQRGRMPPTQPTh
Mpf_ENSMPUP00000015812 ....................................--------------------..------------------.
Mpf_ENSMPUP00000016994 ....................................--------------------..------------------.
Mpf_ENSMPUP00000010444 ....................................--------------------..------------------.
Mpf_ENSMPUP00000007646 ....................................--------------------..-------RRGRLPSKPKQp
Mpf_ENSMPUP00000011482 ....................................--------------------..------------------.
Mpf_ENSMPUP00000006969 ....................................--------------------..------------------.
Mpf_ENSMPUP00000017141 ....................................--------------------..------------------.
Mpf_ENSMPUP00000001766 ....................................-----------PACRLRKCCqaGMVLG----GRKFKKFNKv
Mpf_ENSMPUP00000007823 ....................................--------------------..------------------.
Mpf_ENSMPUP00000002631 ....................................--------------------..------------------.
Mpf_ENSMPUP00000013868 ....................................--------------------..----EAVRADRMRGGRNKf
Mpf_ENSMPUP00000009731 ....................................--------------------..------------------.
Mpf_ENSMPUP00000014812 ....................................--------------------..------------------.
Mpf_ENSMPUP00000006636 ....................................--------------------..------------------.
Mpf_ENSMPUP00000003519 ....................................--------SKHIYNAYLKNF..NMTKKKARGILTGKASHT.
Mpf_ENSMPUP00000006634 ....................................--------------------..------------------.
Mpf_ENSMPUP00000000742 ....................................--------------------..------------------.
Mpf_ENSMPUP00000013860 ....................................--------------------..------------------.
Mpf_ENSMPUP00000015554 ....................................--------------------..------------------.
Mpf_ENSMPUP00000005728 ....................................--------------------..------------------.
Mpf_ENSMPUP00000003520 ....................................--------------------..------------------.
Mpf_ENSMPUP00000012363 ....................................--------------------..------------------.
Mpf_ENSMPUP00000007278 npgestacqssvegmegsvhliagdssinyiekegp--------------------..------------------.


                                                                                                    
                                                                                                    
d2prga_                .............................................................................
Mpf_ENSMPUP00000008313 .............................................................................
Mpf_ENSMPUP00000000416 .............................................................................
Mpf_ENSMPUP00000003764 seaecasgghe..................................................................
Mpf_ENSMPUP00000017072 .............................................................................
Mpf_ENSMPUP00000012080 .............................................................................
Mpf_ENSMPUP00000016128 .............................................................................
Mpf_ENSMPUP00000012031 kqecaesyem...................................................................
Mpf_ENSMPUP00000002249 dgegaggapeempv...............................................................
Mpf_ENSMPUP00000004251 krridaenspylnpqlvqpa.........................................................
Mpf_ENSMPUP00000006062 eegsldsyel...................................................................
Mpf_ENSMPUP00000014752 kpecsesytl...................................................................
Mpf_ENSMPUP00000008953 krrldsesspylslqisppa.........................................................
Mpf_ENSMPUP00000000435 qepsp........................................................................
Mpf_ENSMPUP00000012040 .............................................................................
Mpf_ENSMPUP00000010404 .............................................................................
Mpf_ENSMPUP00000004749 .............................................................................
Mpf_ENSMPUP00000001918 .............................................................................
Mpf_ENSMPUP00000008813 .............................................................................
Mpf_ENSMPUP00000017557 sy...........................................................................
Mpf_ENSMPUP00000014808 .............................................................................
Mpf_ENSMPUP00000012042 .............................................................................
Mpf_ENSMPUP00000014280 .............................................................................
Mpf_ENSMPUP00000004101 gqyaltngdplng................................................................
Mpf_ENSMPUP00000012828 krrpevdplpfpssfpagslavaggprk.................................................
Mpf_ENSMPUP00000010064 tf...........................................................................
Mpf_ENSMPUP00000010389 gpmykrdralkqqkkaliranglkleamsqviqampseltissaiqnmhsaskglplnhaalpptdydrspfvtspi
Mpf_ENSMPUP00000010600 gqfaltngdplnc................................................................
Mpf_ENSMPUP00000015812 .............................................................................
Mpf_ENSMPUP00000016994 .............................................................................
Mpf_ENSMPUP00000010444 .............................................................................
Mpf_ENSMPUP00000007646 p............................................................................
Mpf_ENSMPUP00000011482 .............................................................................
Mpf_ENSMPUP00000006969 .............................................................................
Mpf_ENSMPUP00000017141 .............................................................................
Mpf_ENSMPUP00000001766 rvmraldavalpqsvgipnesqalsqrisfsptqd..........................................
Mpf_ENSMPUP00000007823 .............................................................................
Mpf_ENSMPUP00000002631 .............................................................................
Mpf_ENSMPUP00000013868 gpmykrdralkqqkkaqirangfkletgppmgvppppppppdymlppslhapepkglasgppagplgdfgapalpma
Mpf_ENSMPUP00000009731 .............................................................................
Mpf_ENSMPUP00000014812 .............................................................................
Mpf_ENSMPUP00000006636 .............................................................................
Mpf_ENSMPUP00000003519 .............................................................................
Mpf_ENSMPUP00000006634 .............................................................................
Mpf_ENSMPUP00000000742 .............................................................................
Mpf_ENSMPUP00000013860 .............................................................................
Mpf_ENSMPUP00000015554 .............................................................................
Mpf_ENSMPUP00000005728 .............................................................................
Mpf_ENSMPUP00000003520 .............................................................................
Mpf_ENSMPUP00000012363 .............................................................................
Mpf_ENSMPUP00000007278 .............................................................................


                                                                           40        50             
                                                                            |         |             
d2prga_                ....................................................SPFVIYDMNSLMMGEDK........
Mpf_ENSMPUP00000008313 ....................................................-QEQQTMIRELMDAQMK........
Mpf_ENSMPUP00000000416 ....................................................-EEQQQIIAILLDAHHK........
Mpf_ENSMPUP00000003764 ....................................................DMPVERILEAELAVEPK........
Mpf_ENSMPUP00000017072 ....................................................SPFVIYDMNSLMMGEDK........
Mpf_ENSMPUP00000012080 ....................................................ESEVESTSSANEDMPVEkileaela
Mpf_ENSMPUP00000016128 ....................................................PPFVIHDMETLCMAEKT........
Mpf_ENSMPUP00000012031 ....................................................TAELDDLTEKIRKAHQEtfpslcq.
Mpf_ENSMPUP00000002249 ....................................................D--------RILEAELAveqksdqg
Mpf_ENSMPUP00000004251 ....................................................KKPYNKIVSHLLVAEPE........
Mpf_ENSMPUP00000006062 ....................................................SPQLEELITKVSKAHQEtfpslcq.
Mpf_ENSMPUP00000014752 ....................................................TPEVGELIEKVRKAHQEtfpalcq.
Mpf_ENSMPUP00000008953 ....................................................KKPLTKIVSYLLVAEPD........
Mpf_ENSMPUP00000000435 ....................................................PSPPVSLISALVRAHVDsnpamtsl
Mpf_ENSMPUP00000012040 ....................................................-----------------........
Mpf_ENSMPUP00000010404 ....................................................---ADQMVSALLEAEPP........
Mpf_ENSMPUP00000004749 ....................................................--EQRGMIEKLVAAQQQcnrrsfsd
Mpf_ENSMPUP00000001918 ....................................................---QELMIQQLVAAQLQcnkrsfsd
Mpf_ENSMPUP00000008813 ....................................................-----------------........
Mpf_ENSMPUP00000017557 ....................................................EDSSLPSINALLQAEVLsq......
Mpf_ENSMPUP00000014808 ....................................................-----------------........
Mpf_ENSMPUP00000012042 ....................................................-----------------........
Mpf_ENSMPUP00000014280 ....................................................-----------------........
Mpf_ENSMPUP00000004101 ....................................................HCYLSGYISLLLRAEPY........
Mpf_ENSMPUP00000012828 ....................................................TAPVNALVSHLLVVEPE........
Mpf_ENSMPUP00000010064 ....................................................DGSNIPSINTLAQAEIRsrqis...
Mpf_ENSMPUP00000010389 smtmpppgslqgyqtyghfpsraikseypdpytsspesimgysymdsyqtssPASIPHLIVELLKCEPDepqvqak.
Mpf_ENSMPUP00000010600 ....................................................HSYLSGYISLLLRAEPY........
Mpf_ENSMPUP00000015812 ....................................................-----------------........
Mpf_ENSMPUP00000016994 ....................................................-----------------........
Mpf_ENSMPUP00000010444 ....................................................-------LNVLEAIEPG........
Mpf_ENSMPUP00000007646 ....................................................DASPANLLTSLVRAHLDsgpstakl
Mpf_ENSMPUP00000011482 ....................................................-----------------........
Mpf_ENSMPUP00000006969 ....................................................---------ILENIEPE........
Mpf_ENSMPUP00000017141 ....................................................FDTLAKALNTTDSSSPP........
Mpf_ENSMPUP00000001766 ....................................................IQLVPPLINLLMSIEPE........
Mpf_ENSMPUP00000007823 ....................................................-----TLVSLLEVIEPE........
Mpf_ENSMPUP00000002631 ....................................................-----------------........
Mpf_ENSMPUP00000013868 .....mpgahgplagylyptfpgraikseypepyasppqpgppygypepfsgGPGVPELILQLLQLEPEedqvr...
Mpf_ENSMPUP00000009731 ....................................................-----------------........
Mpf_ENSMPUP00000014812 ....................................................-----------------........
Mpf_ENSMPUP00000006636 ....................................................---------LTDSTPRD........
Mpf_ENSMPUP00000003519 ....................................................APFVIHDIETLWQAEKG........
Mpf_ENSMPUP00000006634 ....................................................----EQLVLTLLEAEPP........
Mpf_ENSMPUP00000000742 ....................................................-----------------........
Mpf_ENSMPUP00000013860 ....................................................DPQSYSLIHQLVSAEDL........
Mpf_ENSMPUP00000015554 ....................................................-----ALLSPSLRARPS........
Mpf_ENSMPUP00000005728 ....................................................-----QLINNIVAAHQK........
Mpf_ENSMPUP00000003520 ....................................................----------LLRQRPN........
Mpf_ENSMPUP00000012363 ....................................................-----------------........
Mpf_ENSMPUP00000007278 ....................................................-----------------........


                             60                                                                     
                              |                                                                     
d2prga_                ...IKFKHITPLQE...............................................................
Mpf_ENSMPUP00000008313 ...TFDTTFSNFKDfrlpeapssghevpeslqppageeaakwsqiredlcslkvtlclrgedgsvwnykpqpd....
Mpf_ENSMPUP00000000416 ...TYDPTYADFSQfrppvrgeggggshssrpssvqtpslsgdsssscsdnytasldvmeptsfsnlglreedsdds
Mpf_ENSMPUP00000003764 ...TESYGDMNM--...............................................................
Mpf_ENSMPUP00000017072 ...IKFKHITPLQE...............................................................
Mpf_ENSMPUP00000012080 vepKTETYVDANMG...............................................................
Mpf_ENSMPUP00000016128 ...LVAKLVANGIQ...............................................................
Mpf_ENSMPUP00000012031 ...LGKYTTNSSAD...............................................................
Mpf_ENSMPUP00000002249 ...VEGPGGTGGSG...............................................................
Mpf_ENSMPUP00000004251 ...KIYAMPDPTVP...............................................................
Mpf_ENSMPUP00000006062 ...LGKYTTNSSAD...............................................................
Mpf_ENSMPUP00000014752 ...LGKYTTNNSSE...............................................................
Mpf_ENSMPUP00000008953 ...KLYAMPPPGMP...............................................................
Mpf_ENSMPUP00000000435 ...DYSRFQANPDY...............................................................
Mpf_ENSMPUP00000012040 ...------IVNAP...............................................................
Mpf_ENSMPUP00000010404 ...IIYSDYDPSRP...............................................................
Mpf_ENSMPUP00000004749 .rlRVTPWPMAPDP...............................................................
Mpf_ENSMPUP00000001918 .qpKVTPWPLGADP...............................................................
Mpf_ENSMPUP00000008813 ...WQTHTYEEIKA...............................................................
Mpf_ENSMPUP00000017557 ...QITSPVSGING...............................................................
Mpf_ENSMPUP00000014808 ...---PMNMYPHG...............................................................
Mpf_ENSMPUP00000012042 ...-VCPMSKSPYV...............................................................
Mpf_ENSMPUP00000014280 ...----------Qfrvslcmdfelkedqkgtrggcpegggssvprpktedeaspepqrpqaprprspsktglerpl
Mpf_ENSMPUP00000004101 ...PTSRYGSQCMQ...............................................................
Mpf_ENSMPUP00000012828 ...KLYAMPDPAGP...............................................................
Mpf_ENSMPUP00000010064 ...VSSPGSST---...............................................................
Mpf_ENSMPUP00000010389 ...IMAYLQQEQAN...............................................................
Mpf_ENSMPUP00000010600 ...PTSRFGSQCMQ...............................................................
Mpf_ENSMPUP00000015812 ...--TPPQRSPPG...............................................................
Mpf_ENSMPUP00000016994 ...-----------...............................................................
Mpf_ENSMPUP00000010444 ...VVCAGHDNNQP...............................................................
Mpf_ENSMPUP00000007646 ...DYSKFQELVLP...............................................................
Mpf_ENSMPUP00000011482 ...-----------...............................................................
Mpf_ENSMPUP00000006969 ...IVYAGYDSSKP...............................................................
Mpf_ENSMPUP00000017141 ...SLADGIDASGGggihvisrdqstpiievegpllsdthvtfkltm..............................
Mpf_ENSMPUP00000001766 ...VIYAGHDNTKP...............................................................
Mpf_ENSMPUP00000007823 ...VLYAGYDSSIP...............................................................
Mpf_ENSMPUP00000002631 ...PAAPWWDPPCG...............................................................
Mpf_ENSMPUP00000013868 ...ARIVGCLQEPA...............................................................
Mpf_ENSMPUP00000009731 ...-----------...............................................................
Mpf_ENSMPUP00000014812 ...DIGQSPIVSMP...............................................................
Mpf_ENSMPUP00000006636 ...LDYSRYCPAEQ...............................................................
Mpf_ENSMPUP00000003519 ...LVWKQLVNGLP...............................................................
Mpf_ENSMPUP00000006634 ...HVLV-SRPSTP...............................................................
Mpf_ENSMPUP00000000742 ...-----------...............................................................
Mpf_ENSMPUP00000013860 ...----------Eplgtpmlied.....................................................
Mpf_ENSMPUP00000015554 ...VPPARSHCLCR...............................................................
Mpf_ENSMPUP00000005728 ...YTIPLEETKKF...............................................................
Mpf_ENSMPUP00000003520 ...IFSREEVAGY-...............................................................
Mpf_ENSMPUP00000012363 ...-----------...............................................................
Mpf_ENSMPUP00000007278 ...----------Llsdshvafrltm...................................................


                                      70         80        90       100       110       120       13
                                       |          |         |         |         |         |         
d2prga_                .............QSKEVAIR.IFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMN
Mpf_ENSMPUP00000008313 .............SSGREIFS.LLPHMADMSTYMFKGIINFAKVISHFRDLPIEDQISLLKGATFELCQLRFNTVFN
Mpf_ENSMPUP00000000416 ...........slTLDLSQLS.MLPHLADLVSYSIQKVIGFAKMIPGFRDLTSDDQIVLLKSSAIEVIMLRSNQSFI
Mpf_ENSMPUP00000003764 .............--ENSTND.PVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVILLRAGWNELLIASFSHRSV
Mpf_ENSMPUP00000017072 .............QSKEVAIR.IFQGCQFRSVEAVQEITEYAKNIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMN
Mpf_ENSMPUP00000012080 .............LNPNSPND.PVTNICQAADKQLFTLVEWAKRVPHFSELPLDDQVILLRAGWNELLIASFSHRSI
Mpf_ENSMPUP00000016128 .............NKE-AEVR.IFHCCQCTSVETVTELTEFAKSIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMN
Mpf_ENSMPUP00000012031 .............HRVRLDLG.LWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYT
Mpf_ENSMPUP00000002249 .............SSP---ND.PVTNICQAADKQLFTLVEWAKRIPHFSSLPLDDQVILLRAGWNELLIASFSHRSI
Mpf_ENSMPUP00000004251 .............DSD---IK.ALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSL
Mpf_ENSMPUP00000006062 .............HRVQLDLG.LWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYT
Mpf_ENSMPUP00000014752 .............QRVSLDID.LWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYT
Mpf_ENSMPUP00000008953 .............EGD---IK.ALTTLCDLADRELVVIIGWAKHIPGFSNLSLGDQMSLLQSAWMEILILGIVYRSL
Mpf_ENSMPUP00000000435 .............QMSGDDTQ.HIQQFYDLLTGSMEIIRGWAEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSN
Mpf_ENSMPUP00000012040 .............EGGKVDLE.AFSHFTKIITPAITRVVDFAKKLPMFCELPCEDQIILLKGCCMEIMSLRAAVRYD
Mpf_ENSMPUP00000010404 .............FSE---AS.MMGLLTNLADRELVHMINWAKRVPGFVDLSLHDQVHLLECAWLEILMIGLVWRSM
Mpf_ENSMPUP00000004749 .............QSREARQQ.RFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLLETSRRYN
Mpf_ENSMPUP00000001918 .............QSRDARQQ.RFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQIALLKASTIEIMLLETARRYN
Mpf_ENSMPUP00000008813 .............YQSKSREA.LWQQCAIQITHAIQYVVEFAKRITGFMELCQNDQILLLKSGCLEVVLVRMCRAFN
Mpf_ENSMPUP00000017557 .............DIRAKKIA.SIADVCESMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSM
Mpf_ENSMPUP00000014808 .............RSGRTVQE.IWEDFSMSFTPAVREVVEFAKHIPGFRDLSQHDQVTLLKAGTFEVLMVRFASLFN
Mpf_ENSMPUP00000012042 .............DPHKSGHE.IWEEFSMSFTPAVKEVVEFAKRIPGFRDLSQHDQVNLLKAGTFEVLMVRFASLFD
Mpf_ENSMPUP00000014280 gppahlfihhqrlPVPVPELP.LLTHFAEVNTFMVQQVIKFTKDVPLFRSLPMEDQISLLKGAAVEICHIALNTTFC
Mpf_ENSMPUP00000004101 .............PNN---IM.GIENICELAARLLFSAVEWARNIPFFPDLQITDQVSLLRLTWSELFVLNAAQCSM
Mpf_ENSMPUP00000012828 .............DGH---LP.AVATLCDLFDREIVVTISWAKSIPGFSSLSLSDQMSVLQSVWMEVLVLGVAQRSL
Mpf_ENSMPUP00000010064 .............DINVKKIA.SIGDVCESMKQQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSM
Mpf_ENSMPUP00000010389 .............RSKHEKLS.TFGLMCKMADQTLFSIVEWARSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQV
Mpf_ENSMPUP00000010600 .............PNN---IM.GIENICELAARMLFSAVEWARNIPFFPDLQITDQVALLRLTWSELFVLNAAQCSM
Mpf_ENSMPUP00000015812 .............YSSPSSFI.CIDNVCELAARLLFSTVEWARHAPFFPELPVADQVALLRLSWSELFVLNAAQCSM
Mpf_ENSMPUP00000016994 .............PYSSSSPC.GLDSIHETSARLLFMAVKWAKNLPVFSNLPFRDQVILLEEAWSELFLLGAIQWSL
Mpf_ENSMPUP00000010444 .............DSF---AA.LLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSF
Mpf_ENSMPUP00000007646 .............HFGKEDAG.DVQQFYDLLSGSLEVIRKWAEKIPGFAELSPSDQDLLLESAFLELFILRLAYRSK
Mpf_ENSMPUP00000011482 .............--------.-FLILTEMATSHVQILVEFTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFN
Mpf_ENSMPUP00000006969 .............DTA---EN.LLSTLNRLAGKQMIQVVKWAKVLPGFRNLPLEDQITLIQYSWMCLSSFALSWRSY
Mpf_ENSMPUP00000017141 .............PSPMPEYL.NVHYICESASRLLFLSMHWARSIPAFQALGQDCNTSLVRACWNELFTLGLAQCAQ
Mpf_ENSMPUP00000001766 .............DTS---SS.LLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSY
Mpf_ENSMPUP00000007823 .............DTT---WR.IMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSY
Mpf_ENSMPUP00000002631 .............AQRRVALS.SPQVVCEAAAAGLLKTLRFVKYLPCFQVLPLDQQLVLVRNCWASLLLLELAQDRL
Mpf_ENSMPUP00000013868 .............KGRPDQPA.PFSLLCRMADQTFISIVDWARRCMVFKELEVADQMTLLQNCWSELLVFDHIYRQI
Mpf_ENSMPUP00000009731 .............--------.ATESVCESAARLLFMSIKWAKSVPAFSTLSLQDQLMLLEDAWRELFVLGIAQWAI
Mpf_ENSMPUP00000014812 .............DGDKVDLE.AFSEFTKIITPAITRVVDFAKKLPMFSELPCEDQIILLKGCCMEIMSLRAAVRYD
Mpf_ENSMPUP00000006636 .............AAAGTDAE.HVQQFYNLLTASIDVSRSWAEKIPGFTDLPKEDQTLLIESAFLELFVLRLSIRSN
Mpf_ENSMPUP00000003519 .............PYKEISVH.VFYRCQYTTVETVRELTEFAKSIPSFSNLFLNDQVTLLKYGVHEAIFAMLASIVN
Mpf_ENSMPUP00000006634 .............FTE---AS.MMMSLTKLADKELVHMIGWAKKIPGFVELSLYDQVRLLESCWMEVLMVGLMWRSI
Mpf_ENSMPUP00000000742 .............YQNKQREV.MWQLCAIKITEAIQYVVEFAKRIDGFMELCQNDQIVLLKAGSLEVVFIRMCRAFD
Mpf_ENSMPUP00000013860 .............GYAVTQAE.LFALLCRLADELLFRQIAWIKKLPFFCELSIKDYTCLLSSTWQELILLSSLTVYS
Mpf_ENSMPUP00000015554 .............QHRPVRLC.APHRTCREALDVLARTVGFLRNLPAFCQLPPQDQQRLLRGCWGPLFLLGLAQDTV
Mpf_ENSMPUP00000005728 .............LQKYVNPElSFLRLSETVVLHLQGLMDFTKGLPGFENLTAEDQTALCKGSKTEVMFLHGAQLYS
Mpf_ENSMPUP00000003520 .............-QTKSMWE.MWERCAHRLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYN
Mpf_ENSMPUP00000012363 .............--------.-----------LLFSTVEWARHAPFFPELPVARQVALLRPRWSELFHCASVGT--
Mpf_ENSMPUP00000007278 .............PSPMPEYL.NVHYIGESASRLLFLSMHWALSIPSFQALGQENSISLVKAYWNELFTLGLAQCWQ


                       0                                       140        150                       
                       |                                         |          |                       
d2prga_                K...DGV.............................LISEGQGFMTREFLKS.LR......................
Mpf_ENSMPUP00000008313 A...ETG.............................TWECGRLSYCLEDPAG.--......................
Mpf_ENSMPUP00000000416 M...DDM.............................SWTCGSPDYKYRISDV.AK......................
Mpf_ENSMPUP00000003764 Sv..QDG.............................ILLATGLHVHRSSAHS.--......................
Mpf_ENSMPUP00000017072 K...DGV.............................LISEGQGFMTREFLKS.LR......................
Mpf_ENSMPUP00000012080 Tv..KDG.............................ILLATGLHVHRNSAHS.--......................
Mpf_ENSMPUP00000016128 K...DGM.............................LVAYGNGFITREFLKS.LR......................
Mpf_ENSMPUP00000012031 Pe..QDT.............................MTFSDGLTLNRTQMHN.--......................
Mpf_ENSMPUP00000002249 Dv..RDG.............................ILLATGLHVHRNSAHS.--......................
Mpf_ENSMPUP00000004251 Sf..EDE.............................LVYADDYIMDEDQSKL.--......................
Mpf_ENSMPUP00000006062 Pe..QDT.............................MTFSDGLTLNRTQMHN.--......................
Mpf_ENSMPUP00000014752 Pe..QDT.............................MTFSDGLTLNRTQMHN.--......................
Mpf_ENSMPUP00000008953 Py..DDK.............................LVFAEDYVMDEEHSRL.--......................
Mpf_ENSMPUP00000000435 Pv..EGK.............................LIFCNGVVLHRLQCVR.--......................
Mpf_ENSMPUP00000012040 Pe..SET.............................LTLNGEMAVTRGQLKN.--......................
Mpf_ENSMPUP00000010404 Eh..PGK.............................LLFAPNLLLDRNQGKC.-V......................
Mpf_ENSMPUP00000004749 Pg..SES.............................ITFLKDFSYNREDFAK.--......................
Mpf_ENSMPUP00000001918 He..TEC.............................ITFLKDFTYSKDDFHR.--......................
Mpf_ENSMPUP00000008813 P...LNN.............................TVLFEGKYGGMQMFKA.--......................
Mpf_ENSMPUP00000017557 Vf..KDV.............................LLLGNDYIVPRHCPEL.--......................
Mpf_ENSMPUP00000014808 Vk..DQT.............................VMFLSRTTYSLQELGA.--......................
Mpf_ENSMPUP00000012042 Ak..ERT.............................VTFLSGKKYSVDDLHS.--......................
Mpf_ENSMPUP00000014280 L...QTQ.............................NFLCGPLCYTLEDGVH.--......................
Mpf_ENSMPUP00000004101 P...LHV.............................APLLAAAGLHASPMSAdRV......................
Mpf_ENSMPUP00000012828 Pl..QDE.............................LAFAEDLVLDEEGARA.--......................
Mpf_ENSMPUP00000010064 Vy..KDI.............................LLLGNNYVIHRNSSEV.--......................
Mpf_ENSMPUP00000010389 VhgkEGS.............................IFLVTGQQVDYSIIAS.-Q......................
Mpf_ENSMPUP00000010600 P...LHV.............................APLLAAAGLHASPMSAdRV......................
Mpf_ENSMPUP00000015812 P...LHV.............................APLLAAAGLHAAPMAA.ERa.....................
Mpf_ENSMPUP00000016994 Pl..DSC.............................PLLAPPQASTAGSSQG.RL......................
Mpf_ENSMPUP00000010444 TnvnSRM.............................LYFAPDLVFNEYRMHK.--......................
Mpf_ENSMPUP00000007646 Pa..EGK.............................LIFCSGLVLHRLQCAR.--......................
Mpf_ENSMPUP00000011482 K...---.............................--KLPAGHADLLEERI.RK......................
Mpf_ENSMPUP00000006969 KhtnSQF.............................LYFAPDLVFNEEKMHQ.--......................
Mpf_ENSMPUP00000017141 V...MSL.............................STILAAIVNHLQNSIQ.EDklsgdri...............
Mpf_ENSMPUP00000001766 KhvsGQM.............................LYFAPDLILNEQRMKE.--......................
Mpf_ENSMPUP00000007823 RqssGNV.............................LCFAPDLIINEQRMSL.--......................
Mpf_ENSMPUP00000002631 NletVET.............................SETSEPSQLQKILTTR.RRetggdeppplpprqpplvsppe
Mpf_ENSMPUP00000013868 QhgkEGS.............................ILLVTGQEVELSTVAA.-Q......................
Mpf_ENSMPUP00000009731 P...VDA.............................NTLLAVSGMNGDNTDS.QK......................
Mpf_ENSMPUP00000014812 Pe..SDT.............................LTLSGEMAVKREQLKN.--......................
Mpf_ENSMPUP00000006636 Ta..EDK.............................FVFCNGLVLHRLQCLR.--......................
Mpf_ENSMPUP00000003519 K...DGL.............................LVANGTGFVTREFLRS.LR......................
Mpf_ENSMPUP00000006634 Dh..PGK.............................LIFAPDLVLDRDEGKC.-V......................
Mpf_ENSMPUP00000000742 S...QNN.............................TVYFDGKYASPDVFKS.--......................
Mpf_ENSMPUP00000013860 Kqi.FGE.............................LADVTAKYSPSDEELH.RF......................
Mpf_ENSMPUP00000015554 T...FEVaeapvpsilkkilleeps...........S-----STSGGQLPDQ.-P......................
Mpf_ENSMPUP00000005728 Q...KEClssasespmrisdhsdhslnfpsqsdnrsVIYSMETFCNEDCPPT.TL......................
Mpf_ENSMPUP00000003520 A...DNH.............................TVFFEGKYGGMELFRA.--......................
Mpf_ENSMPUP00000012363 -...---.............................--APARGAAPGRALHA.--......................
Mpf_ENSMPUP00000007278 V...MNVatilat.......................FVNCLHSSLQQDKMST.ERr.....................


                                  160        170       180                     190         200      
                                    |          |         |                       |           |      
d2prga_                ...KPFG..DFMEPKF.EFAVKFNALELDDSDLAIFIAV......IILSG........DRP..GLLNVKPIEDIQDN
Mpf_ENSMPUP00000008313 ...-GFQq.LLLEPVL.KFHYRLKKLQLHREEYVLMQAI......SLFSP........DRP..GVVQRSVVDQLQER
Mpf_ENSMPUP00000000416 ...AGHSl.ELIEPLI.KFQVGLKKLNLHEEEHVLLMAI......CIVSP........DRP..GVQDAALVEAIQDR
Mpf_ENSMPUP00000003764 ...AGVG..SIFDRVLtELVSKMKDMQMDKSELGCLRAI......VLFNP........DAK..GLSNPSEVETLREK
Mpf_ENSMPUP00000017072 ...KPFG..DFMEPKF.EFAVKFNALELDDSDLAIFIAV......IILSG........DRP..GLLNVKPIEDIQDN
Mpf_ENSMPUP00000012080 ...AGVG..AIFDRVLtELVSKMRDMQMDKTELGCLRAI......VLFNP........DSK..GLSNPAEVEALREK
Mpf_ENSMPUP00000016128 ...KPFC..DIMEPKF.DFAMKFNALELDDSDISLFVAA......IICCG........DRP..GLLNVGHIEKMQEG
Mpf_ENSMPUP00000012031 ...AGFG..PLTDLVF.TFANQLLPLEMDDTETGLLSAI......CLICG........DRQ..DLEEPTKVDKLQEP
Mpf_ENSMPUP00000002249 ...AGVG..AIFDRVLtELVSKMRDMRMDKTELGCLRAI......ILFNP........DAK..GLSNPSEVEVLREK
Mpf_ENSMPUP00000004251 ...AGLL..DLNNAIL.QLVKKYKSMKLEKEEFVTLKAI......ALANS........DSM..HIEDGEAVQKLQDV
Mpf_ENSMPUP00000006062 ...AGFG..PLTDLVF.AFAGQLLPLEMDDTETGLLSAI......CLICG........DRM..DLEEPEKVDKLQEP
Mpf_ENSMPUP00000014752 ...AGFG..PLTDLVF.AFANQLLPLEMDDAETGLLSAI......CLICG........DRQ..DLEQPDRVDMLQEP
Mpf_ENSMPUP00000008953 ...AGLL..ELYRAIL.QLVRRYKKLKVEKEEFVTLKAL......ALANS........DSM..YIEDLEAVQKLQDL
Mpf_ENSMPUP00000000435 ...-GFG..EWIDSIV.EFSSNLQNMNIDISAFSCIAAL......AMVT-........ERH..GLKEPKRVEELQNK
Mpf_ENSMPUP00000012040 ...GGLG..VVSDAIF.DLGMSLSSFNLDDTEVALLQAV......LLMSS........DRP..GLACVERIEKYQDS
Mpf_ENSMPUP00000010404 ...EGMV..EIFDMLL.ATSSRFRMMNLQGEEFVCLKSI......ILLNSgvytflssTLK..SLEEKDHIHRVLDK
Mpf_ENSMPUP00000004749 ...AGLQv.EFINPIF.EFSRAMNELQLNDAEFALLIAI......SIFSA........DRP..NVQDQLQVERLQHT
Mpf_ENSMPUP00000001918 ...AGLQv.EFINPIF.EFSRAMRRLGLDDAEYALLIAI......NIFSA........DRP..NVQEPSRVEALQQP
Mpf_ENSMPUP00000008813 ...LGSD..DLVNEAF.DFAKNLCSLQLTEEEIALFSSA......VLISP........DRA..WLIEPRKVQKLQEK
Mpf_ENSMPUP00000017557 ...AEMSr.VSMRILD.ELVLPFQELQIDDNEYACLKAI......IFFDP........DAK..GLSDPGKIKRLRSQ
Mpf_ENSMPUP00000014808 ...MGMG..DLLSAMF.DFSEKLNSLALTEEELGLFTAV......VLVSA........DRS..GMENSASVEQLQET
Mpf_ENSMPUP00000012042 ...MGAG..DLLNSMF.EFSEKLNALQLSDEEMSLFTAV......VLVSA........DRS..GIENVNSVEALQET
Mpf_ENSMPUP00000014280 ...AGFQq.DFLELLF.RFHGTLRRLQLQEPEYVLMAAM......ALFSP........DRP..GVTQRAEIDHLQEV
Mpf_ENSMPUP00000004101 ...VAFM..DHIRIFQ.EQVEKLKALHVDSAEYSCLKAI......VLFTSaara....DAC..GLSDAAHIESLQEK
Mpf_ENSMPUP00000012828 ...AGLG..ELGAALL.QLVRRLQALRLEREEYVLLKAL......ALANS........DSV..HIEDAEAVEQLREA
Mpf_ENSMPUP00000010064 ...EISR..VANRVLD.ELVRPFQEIQIDDNEYACLKAI......VFFDP........DAK..GLSDPVKIKNMRFQ
Mpf_ENSMPUP00000010389 ...AGATlnNLMSHAQ.DLVAKLRSLQFDQREFVCLKFL......VLFSL........DVK..NLENFQLVEGVQEQ
Mpf_ENSMPUP00000010600 ...VAFM..DHIRIFQ.EQVEKLKALHVDSAEYSCLKAI......VLFTS........DAC..GLSDVAHVESLQEK
Mpf_ENSMPUP00000015812 ...VAFM..DQVRAFQ.EQVDKLGRLQVDSAEYGCLKAI......ALFTP........DAC..GLSDPAHVESLQEK
Mpf_ENSMPUP00000016994 ...ALAG..AESRILQ.ETISRFRALAVDPTEFACMKAL......VLFKP........ETR..GLKDPEHVEALQDQ
Mpf_ENSMPUP00000010444 ...SRMY..SQCVRMR.HLSQEFGWLQITPQEFLCMKAL......LLFSIi.......PVD..GLKNQKFFDELRMN
Mpf_ENSMPUP00000007646 ...-GFG..DWIDSIL.AFSRSLHSLVVDVPAFACLSAL......VLIT-........DRH..GLQEPRRVEELQNR
Mpf_ENSMPUP00000011482 ...SGISd.EYITPMF.SFYKSVAELKMTQEEYALLTAI......VILSP........DRQ..YIKDREAVEKLQEP
Mpf_ENSMPUP00000006969 ...SAMY..ELCQGMH.QISLQFVRLQLTFEEYTIMKVL......LLLS-........TIPkdGLKSQAAFEEMRTN
Mpf_ENSMPUP00000017141 ...KQVM..EHIWKLQ.EFCNSMAKLDIDGYEYAYLKAI......VLFSP........DHP..GLTSTSQIEKFQEK
Mpf_ENSMPUP00000001766 ...SSFY..SLCLTMW.QIPQEFVKLQVSQEEFLCMKVL......LLLN-........TIPleGLRSQNQFEEMRSS
Mpf_ENSMPUP00000007823 ...PCMY..EQCKHML.FVSSELQRLQVSYEEYLCMKTL......LLLSS........-VPkeGLKSQELFDEIRMT
Mpf_ENSMPUP00000002631 agrLPSA..AEVQAIK.CFLAKCWSLDISTKEYAYLKGT......VLFNP........GLP..GLQCMKYIQGLQWG
Mpf_ENSMPUP00000013868 ...AGSLlhSLVLRAQ.ELVLQLHALQLDRQEFVCLKFL......ILFSL........DVK..FLNNHSLVKDAQEK
Mpf_ENSMPUP00000009731 ...LNKIi.SEIQALQ.EVVARFRQLRLDATEFACLKCI......VTFKAvpthsgs.ELR..SFRNAAAIAALQDE
Mpf_ENSMPUP00000014812 ...GGLG..VVSDAIF.ELGKSLSAFNLDDTEVALLQAV......LLMST........DRS..GLLCVDKIEKSQEA
Mpf_ENSMPUP00000006636 ...-GFG..EWLDSIK.DFSLSLQSLNLDIQALACLSAL......SMIT-........ERH..GLKEPKRVEELCNK
Mpf_ENSMPUP00000003519 ...KPFS..DIIEPKF.EFAVKFNALELDDSDLALFIAA......IILC-........---..--------------
Mpf_ENSMPUP00000006634 ...EGIL..EIFDMLL.ATTSRFRELKLQHKEYLCVKAM......VLLNSsmyplaa.ASQ..EAESSRKLTHLLNA
Mpf_ENSMPUP00000000742 ...LGKD..HTVSFVL.IFKG-----GLDQIERASRIAMsissrnVIISL........DRS..WLQEKVKIEKLQQK
Mpf_ENSMPUP00000013860 ...SDEGm.EVIERLI.YLYHKFHQLKVSNEEYACMKAI......NFLNQ........DIR..GLTSASQLEQLNKR
Mpf_ENSMPUP00000015554 ...QPSL..AAVQWLR.GCLESFWSLELGPKEYAFLKET......ILFNP........DVP..GLHASSHIGHLQQE
Mpf_ENSMPUP00000005728 ...TGIAe.EFITTLF.CFYRRMSELNITNTEYALLAAI......TVFFS........DRP..YLKDKQHVENIQEP
Mpf_ENSMPUP00000003520 ...LGCS..ELISSIF.DFSRSLSSLRFSEDEIALYTAL......VLIN-........---..--------------
Mpf_ENSMPUP00000012363 ...GPFT..HQVRAFQ.EQVDKLGRGQVD----ACLKAI......ALFTP........DAC..GLSDPAH-ENLQET
Mpf_ENSMPUP00000007278 ...KLLM..EHIFKLQ.EFCNSMVKLCIDGYEYAYLKAI......VLFSP........G--..--------------


                        210          220          230       240       250          260       270    
                          |            |            |         |         |            |         |    
d2prga_                LLQALELQLKLNH...PES...SQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTET...DMSLHPLLQEIYKD--ly.
Mpf_ENSMPUP00000008313 FAIALKAYIECSR...PQPah.RFLFLKIMAILTELRSINAQHTQRLLRIQDIHP...FA--SPLMRELF----g..
Mpf_ENSMPUP00000000416 LSNTLQTYIRCRHpp.PGS...HLLYAKMIQKLADLRSLNEEHSKQYRCLS-FQPec.SMKLTPLVLEVF----...
Mpf_ENSMPUP00000003764 VYATLEAYTKQKY...PEQ...PGRFAKLLLRLPALRSIGLKCLEHLFFFK-LIG...DTPIDTFLMEML----e..
Mpf_ENSMPUP00000017072 LLQALELQLKMNH...PES...SQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTET...DMSLHPLLQEIYK---d..
Mpf_ENSMPUP00000012080 VYASLEAYCKHKY...PEQ...PGRFAKLLLRLPALRSIGLKCLEHLFFFK-LIG...DTPIDTFLMEMLEA--p..
Mpf_ENSMPUP00000016128 IVHVLKLHLQTNH...PDN...IFLFPKLLQKMADLRQLVTEHAQLVQVIKKTES...DAALHPLLQEIYRD--m..
Mpf_ENSMPUP00000012031 LLEALKIYIRKRR...PSK...PHMFPKILMKITDLRSISAKGAERVITLK-MEI...PGSMPPLIQEML----e..
Mpf_ENSMPUP00000002249 VYASLETYCKQKY...PEQ...QGRFAKLLLRLPALRSIGLKCLEHLFFFK-LIG...DTPIDTFLMEML----e..
Mpf_ENSMPUP00000004251 LHEALQDYEAGQH...MED...PRRAGKMLMTLPLLRQTSTKAVQHFYNIK-LEG...KVPMHKLFLEMLEAK-...
Mpf_ENSMPUP00000006062 LLEALRLYARRRR...PSQ...PYMFPRMLMKITDLRGISTKGAERAITLK-MEI...PGPMPPLIREML----e..
Mpf_ENSMPUP00000014752 LLEALKVYVRKRR...PSR...PHMFPKMLMKITDLRSISAKGAERVITLK-MEI...PGSMPPLIQEML----e..
Mpf_ENSMPUP00000008953 LHEALQDYELSQR...HEE...PRRTGKLLLTLPLLRQTAAKAVQHFYSVK-LQG...KVPMHKLFLEMLEAK-...
Mpf_ENSMPUP00000000435 IVNCLKDHVTFNN...GGLnr.PNYLSKLLGKLPELRTLCTQGLQRIFYLK-LED...LVPPPAIIDKLF----ldt
Mpf_ENSMPUP00000012040 FLLAFEHYINYRK...HHV...THFWPKLLMKVTDLRMIGACHASRFLHMKVECP...TELFPPLFLEVF----...
Mpf_ENSMPUP00000010404 ITDTLIHLMAKAGltlQQQ...HRRLAQLLLILSHIRHMSNKGMEHLYSMK-CKN...VVPLYDLLLEMLDAH-...
Mpf_ENSMPUP00000004749 YVEALHAYVSIHH...PHD...RLMFPRMLMKLVSLRTLSSVHSEQVFALR--LQ...DKKLPPLLSEIW----dv.
Mpf_ENSMPUP00000001918 YVEALLSYTRIKR...PQD...QLRFPRMLMKLVSLRTLSSVHSEQVFALR--LQ...DKKLPPLLSEIWDV--h..
Mpf_ENSMPUP00000008813 IYFALQHVIQKNH...LDD...-ETLAKLIAKIPTITAVCNLHGEKLQVFKQSHPdivNTLFPPLYKELF----...
Mpf_ENSMPUP00000017557 VQVSLEDYINDRQ...YDS...RGRFGELLLLLPTLQSITWQMIEQIQFIK-LFG...MAKIDNLLQEML----...
Mpf_ENSMPUP00000014808 LLRALRALVLKNR...PSE...TSRFTKLLLKLPDLRTLNNMHSEKLLSFR----...----------------v..
Mpf_ENSMPUP00000012042 LIRALRTLIMKNH...PNE...ASIFTKLLLKLPDLRSLNNMHSEELLAFK----...----------------v..
Mpf_ENSMPUP00000014280 VAMTLQSYIKGQPpr.PGD...RFLYAKLLGLLAELRSINNAYGYQIQ---HIQG...LSAMMPLLQEI-----c..
Mpf_ENSMPUP00000004101 SQCALEEYVRSQY...PNQ...PSRFGKLLLRLPSLRTVSSSVIEQLFFVR-LVG...KTPIETLIRDML----...
Mpf_ENSMPUP00000012828 LHEALLEYEAGRAg..PGGgaeRRRAGRLLLTLPLLRQTAGKVLAHFYGVK-LEG...KVPMHKLFLEMLEA--m..
Mpf_ENSMPUP00000010064 VQLSLEDYINDRQ...YDS...RGRFGELLLLLPTLQSITWQMIEQIQFVK-LFG...MVKIDNLLQEML----...
Mpf_ENSMPUP00000010389 VNAALLDYTMCNY...PQQ...TEKFGQLLLRLPEIRAISMQAEEYLYYKH-LNG...DVPYNNLLIEMLHAK-...
Mpf_ENSMPUP00000010600 SQCALEEYVRSQY...PNQ...PTRFGKLLLRLPSLRTVSSSVIEQLFFVR----...----------------l..
Mpf_ENSMPUP00000015812 AQVALTEYVRAQY...PSQ...PQRFGRLLLRLPALRAVPASLISQLFFMR-LVG...KTPIETLIRDML----...
Mpf_ENSMPUP00000016994 SQVMLSQHSKAHH...PSQ...PVRFGKLLLLLPSLRFITSERVELLFFRK-TIG...NTPMEKLLCDMFK---n..
Mpf_ENSMPUP00000010444 YIKELDRIIACKRknpTSC...SRRFYQLTKLLDSVQPIARELHQFTFDLL-IKShmvSVDFPEMMAEIISV--qvp
Mpf_ENSMPUP00000007646 IASCLKEHVSTAAge.PQP...ASCLSRLLGKLPELRTLGTQGLQRIFYLK-LED...LVPPPPIVDKIF----mdt
Mpf_ENSMPUP00000011482 LLDVLQKLCKIYQ...PGN...PQHFACLLGRLTELRTFNHHHAEMLMSWR--VN...DHKFTPLLCEIWD---v..
Mpf_ENSMPUP00000006969 YIKELRKMVTKCPsnsGQS...WQRFYQLTKLLDSMHDLVSDLLEFCFYTF-RESqalKVEFPAMLVEIISDQ-lpk
Mpf_ENSMPUP00000017141 AQMELQDYVQKTY...SED...TYRLARILVRLPALRLMSSNITEELFFTG-LIG...NVSIDSIIPYILKME-t..
Mpf_ENSMPUP00000001766 YIRELIKAIGLRQ...KGVvssSQRFYQLTKLLDNLHDLVKQLHLYCLNTF-IQSralSVEFPEMMSEVI----...
Mpf_ENSMPUP00000007823 YIKELGKAIVKREgnsSQN...WQRFYQLTKLLDSMHDVVENLLNFCFQTF-LDKnm.SIEFPEMLAEIITNQ-ipk
Mpf_ENSMPUP00000002631 TQQILIDHIRMTH...RRH...QARITELNSVLFLLRFINANVIAELFFRP-IIG...SVSMDDMILEMLCAK-...
Mpf_ENSMPUP00000013868 ANAALLDYTLCHY...PHC...GDKFQQLLLCLVEVRALSMQAKEYLYHKH-LGN...EMPRNNLLIEMLQ---a..
Mpf_ENSMPUP00000009731 AQLTLNSYIHTRY...PTQ...PCRFGKLLLLLPALRSISPSTIEEVFFKK-TIG...NVPITRLLSDMY----k..
Mpf_ENSMPUP00000014812 YLLAFEHYVNHRK...HNI...PHFWPKLLMK-----------------------...----------------ere
Mpf_ENSMPUP00000006636 ITSSLKDHQSKGQalePSE...----PKVLGALVELRKLCTLGLQRIFYLK-LED...LVSPPSIIDKLF----ldt
Mpf_ENSMPUP00000003519 -------------...---...---------------------------------...----------------g..
Mpf_ENSMPUP00000006634 VTDALVWVIAKSGipsQQQ...PVRLANLLMLLSHVRH-----------------...----------------ar.
Mpf_ENSMPUP00000000742 IQLALQHVLQKNH...RED...-GILTKLICKVSTLRALCGRHTEKLMAFKAIYPdivRLHFPPLYKELF----...
Mpf_ENSMPUP00000013860 YWYICQDFTEYKY...THQ...PNRFPDLMMCLPEIRYIAGKMV-----------...----------------nvp
Mpf_ENSMPUP00000015554 AHHALWEVLEPCC...PAG...QGRLARVLLTASTLKSISPSLLGDLFFRP-IIG...DIDIAGLLEDML----...
Mpf_ENSMPUP00000005728 ILQILYKYSKIYH...PED...LQHFARLIGRLTELRTLNHNYSEILSTWK----...----------------akd
Mpf_ENSMPUP00000003520 -------------...---...---------------------------------...----------------a..
Mpf_ENSMPUP00000012363 AQVALMECVRAQY...WSQ...PQHFGRPLLRLPALRALPASLNSQLFFMR-LVG...KTPTEWL---------ir.
Mpf_ENSMPUP00000007278 -------------...---...---------------------------------...----------------i..


                                    
                                    
d2prga_                .............
Mpf_ENSMPUP00000008313 .............
Mpf_ENSMPUP00000000416 .............
Mpf_ENSMPUP00000003764 .............
Mpf_ENSMPUP00000017072 .............
Mpf_ENSMPUP00000012080 .............
Mpf_ENSMPUP00000016128 .............
Mpf_ENSMPUP00000012031 .............
Mpf_ENSMPUP00000002249 .............
Mpf_ENSMPUP00000004251 .............
Mpf_ENSMPUP00000006062 .............
Mpf_ENSMPUP00000014752 .............
Mpf_ENSMPUP00000008953 .............
Mpf_ENSMPUP00000000435 l............
Mpf_ENSMPUP00000012040 .............
Mpf_ENSMPUP00000010404 .............
Mpf_ENSMPUP00000004749 .............
Mpf_ENSMPUP00000001918 .............
Mpf_ENSMPUP00000008813 .............
Mpf_ENSMPUP00000017557 .............
Mpf_ENSMPUP00000014808 .............
Mpf_ENSMPUP00000012042 .............
Mpf_ENSMPUP00000014280 .............
Mpf_ENSMPUP00000004101 .............
Mpf_ENSMPUP00000012828 .............
Mpf_ENSMPUP00000010064 .............
Mpf_ENSMPUP00000010389 .............
Mpf_ENSMPUP00000010600 .............
Mpf_ENSMPUP00000015812 .............
Mpf_ENSMPUP00000016994 .............
Mpf_ENSMPUP00000010444 kilsgkvkpiyfh
Mpf_ENSMPUP00000007646 l............
Mpf_ENSMPUP00000011482 .............
Mpf_ENSMPUP00000006969 vesgnakplyfh.
Mpf_ENSMPUP00000017141 .............
Mpf_ENSMPUP00000001766 .............
Mpf_ENSMPUP00000007823 yssgnikkllfhq
Mpf_ENSMPUP00000002631 .............
Mpf_ENSMPUP00000013868 .............
Mpf_ENSMPUP00000009731 .............
Mpf_ENSMPUP00000014812 vqs..........
Mpf_ENSMPUP00000006636 l............
Mpf_ENSMPUP00000003519 .............
Mpf_ENSMPUP00000006634 .............
Mpf_ENSMPUP00000000742 .............
Mpf_ENSMPUP00000013860 leqlpllf.....
Mpf_ENSMPUP00000015554 .............
Mpf_ENSMPUP00000005728 pklassll.....
Mpf_ENSMPUP00000003520 .............
Mpf_ENSMPUP00000012363 .............
Mpf_ENSMPUP00000007278 .............


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0045423 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Caenorhabditis elegans 57 (pseudogenes) - Roundworm
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Aquilegia coerulea v195
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Caenorhabditis elegans 69_215 - Roundworm
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Heliconius numata
NoYes   Loa loa v3.3 - Eye worm
NoYes   Wuchereria bancrofti v1.0 - Agent of lymphatic filariasis
NoYes   Brugia malayi v1.0 - Agent of lymphatic filariasis
NoYes   Lotus japonicus
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   STRING v9.0.5 (STRING)
NoYes   Uniprot 2018_03 genome
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   UniProt viral sequences (Viral)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]